F435708

General Info

Members Datasets Scaffolds Average Seq Length
404 318 267 156

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10122977|Ga0307507_101229772
Length 154
Sequence MTYLLLKSLHIIGAAVLLGTGAGIAFFMCMAHAARDLRALQVTARHVVLADWAFTAPAVLLQPVTGFLLIRELGWPMHGAWLHAVLGLYALVGACWIPVVFIQHRLARLAAAATSFDTLGVGYWRLYHLWFALGIPAFTGVLALVWLMVAKPWL

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
7 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
8 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
9 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
10 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
11 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
12 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
13 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
14 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
15 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
16 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
17 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
18 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
19 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
20 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
21 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
22 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
23 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
24 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
25 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
26 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
27 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
28 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
29 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
30 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
31 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
32 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
34 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
35 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
36 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
37 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
38 2791355256 Rhizobium sp. M10 Isolate Nodule
39 2791355260 Rhizobium sp. L9 Isolate Nodule
40 2791355261 Rhizobium sp. J15 Isolate Nodule
41 2791355262 Rhizobium sp. M1 Isolate Nodule
42 2791355263 Rhizobium chutanense C5 Isolate Nodule
43 2791355265 Rhizobium sp. H4 Isolate Nodule
44 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
45 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
46 2802429633 Rhizobium anhuiense J3 Isolate Nodule
47 2802429634 Rhizobium anhuiense S10 Isolate Nodule
48 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
49 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
50 2802429637 Rhizobium anhuiense C15 Isolate Nodule
51 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
52 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
53 2838048938 Rhizobium pisi 27/80 Isolate Nodule
54 2838061910 Rhizobium phaseoli L15 Isolate Nodule
55 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
56 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
57 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
58 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
59 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
60 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
61 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
62 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
63 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
64 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
65 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
66 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
67 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
68 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
69 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
70 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
71 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
72 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
73 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
74 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
75 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
76 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
77 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
78 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
79 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
80 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
81 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
82 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
83 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
84 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
85 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
86 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
87 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
88 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
89 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
90 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
91 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
92 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
93 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
94 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
95 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
96 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
97 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
98 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
99 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
100 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
101 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
102 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
103 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
104 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
105 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
106 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
107 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
108 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
109 2933599457 Rhizobium phaseoli M3 Isolate Nodule
110 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
111 2936381700 Rhizobium chutanense C16 Isolate Unclassified
112 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
113 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
114 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
115 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
116 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
117 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
118 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
119 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
120 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
121 2996887358 Rhizobium sp. R711 Isolate Nodule
122 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
123 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
124 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
125 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
126 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
127 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
128 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
129 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
130 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
131 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
132 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
133 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
134 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
135 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
136 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
137 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
138 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
141 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
142 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
143 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
146 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
149 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
150 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
154 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
157 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
158 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
159 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
163 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
164 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
165 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
166 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
167 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
172 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
173 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
296 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
299 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
303 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
306 8005258706 Rhizobium sp. R693 Isolate Nodule
307 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
308 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
309 8005321885 Rhizobium sp. R72 Isolate Nodule
310 8005382845 Rhizobium sp. R634 Isolate Nodule
311 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
312 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
313 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
314 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
315 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
316 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
317 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
318 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.09
Metatranscriptomes 0
Isolates 33.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.48
Nodule 27.23
Rhizoplane 0.99
Rhizosphere 32.92
Stem 0
Stem Tuber 0
Unclassified 11.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000336 3300002739 Bacteria 10357
2 JGI25152J39213_1003715 3300002773 Bacteria 5111
3 JGI25152J39213_1006182 3300002773 Bacteria 3323
4 JGI25150J39212_1016014 3300002774 Bacteria 1237
5 JGI25159J45721_1000613 3300002987 Bacteria 15891
6 JGI25151J46595_10000802 3300003187 Bacteria 25191
7 JGI25151J46595_10034270 3300003187 Bacteria 1944
8 JGI25151J46595_10095400 3300003187 Bacteria 816
9 JGI25153J46596_10012453 3300003215 Bacteria 3669
10 JGI25153J46596_10014210 3300003215 Bacteria 3323
11 JGI25160J50197_1013773 3300003354 Bacteria 2739
12 JGI25161J50226_1000099 3300003374 Bacteria 70186
13 JGI25161J50226_1000140 3300003374 Bacteria 50175
14 JGI25161J50226_1004634 3300003374 Bacteria 2832
15 Ga0055526_1000484 3300003771 Bacteria 31547
16 Ga0055526_1005523 3300003771 Bacteria 7236
17 Ga0055524_1004689 3300003775 Bacteria 6264
18 Ga0055524_1024972 3300003775 Bacteria 1881
19 Ga0055528_1003598 3300003790 Bacteria 7716
20 Ga0055528_1004902 3300003790 Bacteria 6318
21 Ga0055540_1006077 3300003792 Bacteria 4876
22 Ga0055540_1044881 3300003792 Bacteria 936
23 Ga0055543_1000128 3300004625 Bacteria 63029
24 Ga0055543_1000499 3300004625 Bacteria 22628
25 Ga0065165_1042303 3300005262 Bacteria 1345
26 Ga0065165_1111104 3300005262 Bacteria 674
27 Ga0070660_100140678 3300005339 Bacteria 1936
28 Ga0070659_100000158 3300005366 Bacteria 51870
29 Ga0070681_10059786 3300005458 Bacteria 3791
30 Ga0070681_10481209 3300005458 Bacteria 1154
31 Ga0070684_101453997 3300005535 Bacteria 646
32 Ga0070672_101269049 3300005543 Bacteria 657
33 Ga0070686_100736329 3300005544 Bacteria 789
34 Ga0070665_100526370 3300005548 Bacteria 1194
35 Ga0068855_100170114 3300005563 Bacteria 2468
36 Ga0068855_101410034 3300005563 Bacteria 718
37 Ga0068854_100803588 3300005578 Bacteria 820
38 Ga0068856_100138164 3300005614 Bacteria 2443
39 Ga0068856_100282434 3300005614 Bacteria 1677
40 Ga0068852_100281644 3300005616 Bacteria 1603
41 Ga0068852_100314146 3300005616 Bacteria 1520
42 Ga0068864_100001936 3300005618 Bacteria 17007
43 Ga0068863_100000128 3300005841 Bacteria 79841
44 Ga0075365_10026972 3300006038 Bacteria 3650
45 Ga0075365_10151833 3300006038 Bacteria 1611
46 Ga0075365_10155811 3300006038 Bacteria 1590
47 Ga0075368_10022159 3300006042 Bacteria 2416
48 Ga0075368_10043272 3300006042 Bacteria 1774
49 Ga0075363_100006683 3300006048 Bacteria 5261
50 Ga0075363_100171077 3300006048 Bacteria 1233
51 Ga0075362_10097750 3300006177 Bacteria 1369
52 Ga0075367_10007436 3300006178 Bacteria 5608
53 Ga0075367_10017490 3300006178 Bacteria 3935
54 Ga0075367_10091970 3300006178 Bacteria 1846
55 Ga0075369_10000132 3300006186 Bacteria 20799
56 Ga0075369_10020015 3300006186 Bacteria 2738
57 Ga0075369_10030047 3300006186 Bacteria 2286
58 Ga0075366_10271073 3300006195 Bacteria 1036
59 Ga0075370_10009806 3300006353 Bacteria 4989
60 Ga0075370_10081952 3300006353 Bacteria 1855
61 Ga0075370_10230135 3300006353 Bacteria 1097
62 Ga0075428_100063490 3300006844 Bacteria 4043
63 Ga0105240_10387593 3300009093 Bacteria 1577
64 Ga0105240_11907445 3300009093 Bacteria 618
65 Ga0114129_10078768 3300009147 Bacteria 4583
66 Ga0105237_10189108 3300009545 Bacteria 2059
67 Ga0105238_10274766 3300009551 Bacteria 1665
68 Ga0123341_1151460 3300009765 Bacteria 596
69 Ga0123341_1151461 3300009765 Bacteria 596
70 Ga0123342_1005565 3300009766 Bacteria 18132
71 Ga0105239_10165817 3300010375 Bacteria 2470
72 Ga0157370_10146133 3300013104 Bacteria 2202
73 Ga0157370_11547878 3300013104 Bacteria 596
74 Ga0157372_10090184 3300013307 Bacteria 3484
75 Ga0213874_10002838 3300021377 Bacteria 3776
76 Ga0213876_10037038 3300021384 Bacteria 2573
77 Ga0209436_100029 3300025208 Bacteria 85964
78 Ga0207425_1006299 3300025245 Bacteria 3259
79 Ga0207425_1008702 3300025245 Bacteria 2575
80 Ga0209129_1001312 3300025258 Bacteria 14088
81 Ga0209129_1001999 3300025258 Bacteria 10596
82 Ga0209129_1005114 3300025258 Bacteria 4803
83 Ga0209673_1001611 3300025273 Bacteria 19722
84 Ga0209673_1005688 3300025273 Bacteria 6218
85 Ga0209673_1013499 3300025273 Bacteria 3218
86 Ga0209130_1000020 3300025284 Bacteria 379297
87 Ga0209025_1000058 3300025294 Bacteria 311398
88 Ga0209025_1005836 3300025294 Bacteria 9857
89 Ga0209025_1016047 3300025294 Bacteria 4458
90 Ga0209564_1000512 3300025295 Bacteria 63708
91 Ga0209564_1001530 3300025295 Bacteria 22948
92 Ga0209758_1002719 3300025297 Bacteria 17418
93 Ga0209758_1003069 3300025297 Bacteria 15878
94 Ga0209758_1003364 3300025297 Bacteria 14653
95 Ga0209758_1012299 3300025297 Bacteria 4804
96 Ga0209256_1009553 3300025299 Bacteria 4229
97 Ga0207426_1000008 3300025302 Bacteria 848730
98 Ga0207426_1000221 3300025302 Bacteria 134756
99 Ga0207426_1000946 3300025302 Bacteria 28694
100 Ga0209051_1004871 3300025303 Bacteria 8059
101 Ga0209051_1007466 3300025303 Bacteria 5969
102 Ga0209257_1021628 3300025304 Bacteria 2328
103 Ga0207707_10089631 3300025912 Bacteria 2688
104 Ga0207695_10197077 3300025913 Bacteria 1930
105 Ga0207695_10733556 3300025913 Bacteria 868
106 Ga0207657_10192035 3300025919 Bacteria 1647
107 Ga0207681_10147234 3300025923 Bacteria 1761
108 Ga0207694_10240399 3300025924 Bacteria 1480
109 Ga0207694_10505363 3300025924 Bacteria 1012
110 Ga0207690_10001138 3300025932 Bacteria 16930
111 Ga0207691_10884981 3300025940 Bacteria 748
112 Ga0207667_10262419 3300025949 Bacteria 1766
113 Ga0207640_10729530 3300025981 Bacteria 852
114 Ga0207702_10226720 3300026078 Bacteria 1744
115 Ga0207641_10000005 3300026088 Bacteria 470841
116 Ga0207676_10001118 3300026095 Bacteria 20322
117 Ga0207698_10696220 3300026142 Bacteria 1011
118 Ga0268266_10381118 3300028379 Bacteria 1330
119 Ga0265338_10435779 3300028800 Bacteria 930
120 Ga0265327_10000591 3300031251 Bacteria 60639
121 Ga0307408_100226275 3300031548 Bacteria 1529
122 Ga0265314_10071597 3300031711 Bacteria 2319
123 Ga0265342_10315157 3300031712 Bacteria 821
124 Ga0307516_10133294 3300031730 Bacteria 2262
125 Ga0307410_10229990 3300031852 Bacteria 1431
126 Ga0307407_10072351 3300031903 Bacteria 2056
127 Ga0307409_100134543 3300031995 Bacteria 2119
128 Ga0307414_10193481 3300032004 Bacteria 1648
129 Ga0307411_10079658 3300032005 Bacteria 2250
130 Ga0307507_10122977 3300033179 Bacteria 2067
131 Ga0373943_0328938 3300035170 Bacteria 872
132 Ga0373927_0000810 3300035695 Bacteria 23917
133 Ga0316584_0619129 3300036712 Bacteria 749
134 Ga0395899_0801999 3300037312 Bacteria 582
135 Ga0395898_1108256 3300037466 Bacteria 725
136 Ga0395905_0069189 3300037471 Bacteria 3306
137 Ga0395901_0090880 3300038443 Bacteria 3196
138 Ga0400488_12049 3300038741 Bacteria 1374
139 Ga0436365_1778447 3300039437 Bacteria 6916
140 Ga0436363_0658834 3300039450 Bacteria 6835
141 Ga0439465_0001082 3300041413 Bacteria 8718
142 Ga0439465_0130337 3300041413 Bacteria 887
143 Ga0451807_0622174 3300041486 Bacteria 503
144 Ga0451849_0584124 3300041505 Bacteria 1765
145 Ga0451843_0998701 3300041509 Bacteria 2137
146 Ga0439449_0025625 3300042007 Bacteria 2204
147 Ga0439452_051165 3300042010 Bacteria 946
148 Ga0439462_0051384 3300042015 Bacteria 1108
149 Ga0451577_0242513 3300042876 Bacteria 1631
150 Ga0466969_0274934 3300044656 Bacteria 763
151 Ga0466964_0043877 3300044706 Bacteria 1815
152 Ga0453684_0000937 3300044712 Bacteria 96425
153 Ga0466959_0045490 3300045049 Bacteria 3232
154 Ga0451576_0000430 3300045051 Bacteria 96425
155 Ga0495590_0040651 3300046457 Bacteria 1622
156 Ga0495638_0043758 3300046460 Bacteria 2823
157 Ga0495650_0028905 3300046471 Bacteria 2535
158 Ga0495584_0092849 3300046491 Bacteria 1523
159 Ga0495585_0200865 3300046492 Bacteria 1015
160 Ga0495607_0020859 3300046501 Bacteria 4131
161 Ga0495583_0046516 3300046506 Bacteria 2000
162 Ga0495583_0101246 3300046506 Bacteria 1229
163 Ga0495606_0010451 3300046507 Bacteria 7701
164 Ga0495606_0130180 3300046507 Bacteria 1496
165 Ga0495610_0011895 3300046512 Bacteria 5282
166 Ga0495610_0024109 3300046512 Bacteria 3289
167 Ga0495610_0095129 3300046512 Bacteria 1343
168 Ga0495620_0048655 3300046515 Bacteria 1818
169 Ga0495620_0176824 3300046515 Bacteria 826
170 Ga0495631_0060848 3300046518 Bacteria 1638
171 Ga0495632_0080978 3300046519 Bacteria 1548
172 Ga0495632_0090832 3300046519 Bacteria 1448
173 Ga0495632_0118432 3300046519 Bacteria 1239
174 Ga0495643_0007771 3300046522 Bacteria 6862
175 Ga0495643_0015966 3300046522 Bacteria 4421
176 Ga0495648_0092142 3300046524 Bacteria 1693
177 Ga0495654_0126208 3300046530 Bacteria 1153
178 Ga0495597_0011360 3300046542 Bacteria 4320
179 Ga0495656_0194740 3300046615 Bacteria 1003
180 Ga0495668_0067839 3300046616 Bacteria 1962
181 Ga0495668_0089841 3300046616 Unclassified 1683
182 Ga0495611_0124383 3300046648 Unclassified 1203
183 Ga0495625_0250872 3300046660 Bacteria 1149
184 Ga0495661_0297341 3300046665 Bacteria 809
185 Ga0495613_0000049 3300046689 Bacteria 122792
186 Ga0495671_0266370 3300046692 Bacteria 826
187 Ga0495649_0061730 3300046694 Bacteria 2015
188 Ga0495649_0089309 3300046694 Bacteria 1643
189 Ga0495649_0101454 3300046694 Bacteria 1529
190 Ga0495589_0523866 3300046794 Unclassified 541
191 Ga0495600_0705502 3300046809 Bacteria 607
192 Ga0495660_0046709 3300046810 Bacteria 2373
193 Ga0495660_0193158 3300046810 Unclassified 977
194 Ga0495636_0077919 3300047318 Bacteria 1423
195 Ga0495683_0150707 3300047323 Bacteria 1083
196 Ga0495687_071448 3300047443 Bacteria 1390
197 Ga0495681_0006193 3300047470 Bacteria 7891
198 Ga0495686_0033251 3300047472 Bacteria 3331
199 Ga0495626_0069954 3300048091 Bacteria 1580
200 Ga0496106_0000578 3300048909 Bacteria 26182
201 Ga0496110_0450017 3300048913 Bacteria 1174
202 Ga0496110_0528955 3300048913 Bacteria 1072
203 Ga0496116_0055291 3300048919 Bacteria 2608
204 Ga0496116_0420157 3300048919 Bacteria 584
205 Ga0496118_0027940 3300048921 Bacteria 4764
206 Ga0496118_0555408 3300048921 Bacteria 559
207 Ga0496119_0000208 3300048922 Bacteria 83742
208 Ga0496119_0026494 3300048922 Bacteria 4018
209 Ga0496119_0353572 3300048922 Bacteria 711
210 Ga0496120_0011962 3300048923 Bacteria 5935
211 Ga0496120_0018290 3300048923 Bacteria 4523
212 Ga0496121_0011992 3300048924 Bacteria 9529
213 Ga0496121_0085329 3300048924 Bacteria 2486
214 Ga0496121_0329444 3300048924 Bacteria 1025
215 Ga0496122_0019958 3300048925 Bacteria 6094
216 Ga0496122_0071981 3300048925 Bacteria 2460
217 Ga0496123_0001102 3300048926 Bacteria 40509
218 Ga0496123_0019000 3300048926 Bacteria 5432
219 Ga0496124_0034478 3300048927 Bacteria 4441
220 Ga0496124_0085313 3300048927 Bacteria 2588
221 Ga0496125_0017708 3300048928 Bacteria 6782
222 Ga0496126_0128795 3300048929 Bacteria 2189
223 Ga0495678_053403 3300049459 Bacteria 1552
224 Ga0495682_0223553 3300049460 Unclassified 667
225 Ga0501047_0069047 3300049581 Bacteria 3404
226 nmdc:mga03683_46900_c1 3300050489 Bacteria 1792
227 nmdc:mga03n38_202140_c1 3300050490 Bacteria 1029
228 nmdc:mga03n38_75024_c1 3300050490 Bacteria 1574
229 nmdc:mga00v17_533800_c1 3300050491 Bacteria 759
230 nmdc:mga0yw44_111607_c1 3300050492 Bacteria 1753
231 nmdc:mga0yw44_36680_c1 3300050492 Bacteria 1371
232 nmdc:mga0yw44_628328_c1 3300050492 Bacteria 730
233 nmdc:mga0yw44_646491_c1 3300050492 Bacteria 719
234 nmdc:mga0k408_836085_c1 3300050493 Bacteria 536
235 nmdc:mga06z11_14360_c1 3300050494 Bacteria 3506
236 nmdc:mga06z11_14692_c1 3300050494 Bacteria 3475
237 nmdc:mga06z11_548965_c1 3300050494 Bacteria 702
238 nmdc:mga07m45_110144_c1 3300050496 Bacteria 1585
239 nmdc:mga07m45_39646_c1 3300050496 Bacteria 2633
240 nmdc:mga07m45_8546_c1 3300050496 Bacteria 5269
241 nmdc:mga05p37_409019_c1 3300050507 Bacteria 1582
242 nmdc:mga0sz30_10737_c2 3300050516 Bacteria 1325
243 nmdc:mga0sz30_75031_c1 3300050516 Bacteria 1459
244 Ga0500651_0143447 3300053093 Bacteria 1438
245 Ga0500641_0132334 3300053096 Bacteria 1077
246 Ga0500557_004353 3300053105 Bacteria 2959
247 Ga0500569_012112 3300053109 Bacteria 2078
248 Ga0500592_036335 3300053116 Bacteria 796
249 Ga0500595_018908 3300053119 Bacteria 2510
250 Ga0500642_0181181 3300053130 Bacteria 985
251 Ga0500652_157782 3300053131 Bacteria 939
252 Ga0500658_0002369 3300053134 Bacteria 7302
253 Ga0500568_0000017 3300053139 Bacteria 197578
254 Ga0500568_0008709 3300053139 Bacteria 4869
255 Ga0500568_0057690 3300053139 Bacteria 1510
256 Ga0500604_0007759 3300053151 Bacteria 2844
257 Ga0500604_0018672 3300053151 Bacteria 1934
258 Ga0500604_0069594 3300053151 Bacteria 1120
259 Ga0500616_0071801 3300053153 Bacteria 1761
260 Ga0500622_0000899 3300053156 Bacteria 25323
261 Ga0500622_0068762 3300053156 Bacteria 1794
262 Ga0500622_0084010 3300053156 Bacteria 1590
263 Ga0500627_0048456 3300053158 Bacteria 1845
264 Ga0500627_0185200 3300053158 Bacteria 936
265 Ga0500633_0031808 3300053160 Bacteria 1708
266 Ga0500633_0183429 3300053160 Bacteria 785
267 Ga0500645_010337 3300053730 Bacteria 3091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10884981 Ga0207691_108849812 138
2 3300021377 Ga0213874_10002838 Ga0213874_100028385 139
3 3300039437 Ga0436365_1778447 Ga0436365_1778447_5774_6199 140
4 3300005543 Ga0070672_101269049 Ga0070672_1012690491 141
5 iso_pu_bacteria 2876369609 2876372044 141
6 3300005618 Ga0068864_100001936 Ga0068864_1000019363 142
7 3300005841 Ga0068863_100000128 Ga0068863_10000012877 142
8 3300026088 Ga0207641_10000005 Ga0207641_10000005458 142
9 3300026095 Ga0207676_10001118 Ga0207676_1000111819 142
10 3300046794 Ga0495589_0523866 Ga0495589_0523866_16_462 146
11 3300002773 JGI25152J39213_1006182 JGI25152J39213_10061823 149
12 3300003187 JGI25151J46595_10034270 JGI25151J46595_100342701 149
13 3300003215 JGI25153J46596_10014210 JGI25153J46596_100142103 149
14 3300025245 Ga0207425_1006299 Ga0207425_10062993 149
15 3300025258 Ga0209129_1005114 Ga0209129_10051143 149
16 3300025294 Ga0209025_1005836 Ga0209025_10058364 149
17 3300025297 Ga0209758_1012299 Ga0209758_10122995 149
18 3300036712 Ga0316584_0619129 Ga0316584_0619129_195_674 149
19 3300046665 Ga0495661_0297341 Ga0495661_0297341_302_751 149
20 3300048909 Ga0496106_0000578 Ga0496106_0000578_22205_22675 149
21 3300053139 Ga0500568_0008709 Ga0500568_0008709_1812_2282 149
22 3300048923 Ga0496120_0011962 Ga0496120_0011962_1303_1761 150
23 iso_pu_bacteria 2821443989 2821450696 151
24 iso_pu_bacteria 2510917030 2511196078 152
25 iso_pu_bacteria 2513237085 2513576867 152
26 iso_pu_bacteria 2515154134 2515739406 152
27 iso_pu_bacteria 2516653085 2517076986 152
28 iso_pu_bacteria 2517287029 2517407321 152
29 iso_pu_bacteria 2582581298 2585222748 152
30 iso_pu_bacteria 2582581299 2585232765 152
31 iso_pu_bacteria 2582581306 2585267510 152
32 iso_pu_bacteria 2585427526 2585527366 152
33 iso_pu_bacteria 2585427528 2585538108 152
34 iso_pu_bacteria 2585427529 2585545331 152
35 iso_pu_bacteria 2585427590 2585822840 152
36 iso_pu_bacteria 2585427593 2585836056 152
37 iso_pu_bacteria 2643221634 2644193430 152
38 iso_pu_bacteria 2718217997 2719666080 152
39 iso_pu_bacteria 2718218199 2720492500 152
40 iso_pu_bacteria 2718218232 2720613936 152
41 iso_pu_bacteria 2718218233 2720620740 152
42 iso_pu_bacteria 2718218235 2720632063 152
43 iso_pu_bacteria 2718218269 2720775791 152
44 iso_pu_bacteria 2721755556 2723027398 152
45 iso_pu_bacteria 2721755684 2723561017 152
46 iso_pu_bacteria 2721755685 2723567610 152
47 iso_pu_bacteria 2721755819 2724090398 152
48 iso_pu_bacteria 2721755822 2724104875 152
49 iso_pu_bacteria 2721755823 2724110680 152
50 iso_pu_bacteria 2728369352 2730108334 152
51 iso_pu_bacteria 2738541333 2739032766 152
52 iso_pu_bacteria 2791355256 2793294513 152
53 iso_pu_bacteria 2791355260 2793320441 152
54 iso_pu_bacteria 2791355261 2793331711 152
55 iso_pu_bacteria 2791355262 2793336835 152
56 iso_pu_bacteria 2791355263 2793339126 152
57 iso_pu_bacteria 2791355265 2793351908 152
58 iso_pu_bacteria 2802429606 2805937426 152
59 iso_pu_bacteria 2802429633 2806043745 152
60 iso_pu_bacteria 2802429634 2806050323 152
61 iso_pu_bacteria 2802429635 2806057140 152
62 iso_pu_bacteria 2802429636 2806064522 152
63 iso_pu_bacteria 2802429637 2806071789 152
64 iso_pu_bacteria 2838016132 2838017730 152
65 iso_pu_bacteria 2838048938 2838051976 152
66 iso_pu_bacteria 2838061910 2838067406 152
67 iso_pu_bacteria 2838068647 2838070224 152
68 iso_pu_bacteria 2838686498 2838687132 152
69 iso_pu_bacteria 2838729681 2838729895 152
70 iso_pu_bacteria 2838742623 2838743090 152
71 iso_pu_bacteria 2841851746 2841852576 152
72 iso_pu_bacteria 2842156927 2842157964 152
73 iso_pu_bacteria 2842163707 2842167486 152
74 iso_pu_bacteria 2842180545 2842181583 152
75 iso_pu_bacteria 2842205361 2842205556 152
76 iso_pu_bacteria 2842229732 2842230366 152
77 iso_pu_bacteria 2842243621 2842244268 152
78 iso_pu_bacteria 2842257432 2842257646 152
79 iso_pu_bacteria 2842264693 2842266186 152
80 iso_pu_bacteria 2842271015 2842271330 152
81 iso_pu_bacteria 2842278818 2842279013 152
82 iso_pu_bacteria 2842285085 2842285675 152
83 iso_pu_bacteria 2842304105 2842304959 152
84 iso_pu_bacteria 2842311132 2842314992 152
85 iso_pu_bacteria 2842341865 2842346379 152
86 iso_pu_bacteria 2842395702 2842399959 152
87 iso_pu_bacteria 2842402390 2842403035 152
88 iso_pu_bacteria 2842409023 2842409593 152
89 iso_pu_bacteria 2842415677 2842416244 152
90 iso_pu_bacteria 2842422224 2842423838 152
91 iso_pu_bacteria 2842428310 2842430649 152
92 iso_pu_bacteria 2842434925 2842437364 152
93 iso_pu_bacteria 2842441272 2842443734 152
94 iso_pu_bacteria 2842447887 2842453140 152
95 iso_pu_bacteria 2842462802 2842464792 152
96 iso_pu_bacteria 2842469257 2842471982 152
97 iso_pu_bacteria 2844454524 2844458499 152
98 iso_pu_bacteria 2919100787 2919106634 152
99 iso_pu_bacteria 2933570622 2933570767 152
100 iso_pu_bacteria 2933599457 2933601030 152
101 iso_pu_bacteria 2935901341 2935902036 152
102 iso_pu_bacteria 2936381700 2936382971 152
103 iso_pu_bacteria 8005282627 8005283340 152
104 iso_pu_bacteria 8005307578 8005312753 152
105 iso_pu_bacteria 8005382845 8005385284 152
106 iso_pu_bacteria 8005430974 8005435075 152
107 iso_pu_bacteria 8005497431 8005500813 152
108 iso_pu_bacteria 8005570704 8005573543 152
109 iso_pu_bacteria 8005619151 8005622190 152
110 iso_pu_bacteria 8005626139 8005632334 152
111 iso_pu_bacteria 8005668836 8005672231 152
112 iso_pu_bacteria 8005695170 8005697320 152
113 iso_pu_bacteria 8023680758 8023683248 152
114 3300006844 Ga0075428_100063490 Ga0075428_1000634902 153
115 3300009147 Ga0114129_10078768 Ga0114129_100787684 153
116 3300009551 Ga0105238_10274766 Ga0105238_102747663 153
117 3300025924 Ga0207694_10505363 Ga0207694_105053632 153
118 3300033179 Ga0307507_10122977 Ga0307507_101229772 153
119 3300046491 Ga0495584_0092849 Ga0495584_0092849_161_625 153
120 3300050507 nmdc:mga05p37_409019_c1 nmdc:mga05p37_409019_c1_556_1020 153
121 iso_pu_bacteria 2510917028 2511186983 153
122 iso_pu_bacteria 2512875024 2512958074 153
123 iso_pu_bacteria 2513237088 2513596401 153
124 iso_pu_bacteria 2513237305 2514422601 153
125 iso_pu_bacteria 2582581867 2585402472 153
126 iso_pu_bacteria 2588253730 2588515970 153
127 iso_pu_bacteria 2657244999 2657681492 153
128 iso_pu_bacteria 2690316117 2692315612 153
129 iso_pu_bacteria 2721755686 2723576494 153
130 iso_pu_bacteria 2802429268 2804752684 153
131 iso_pu_bacteria 2847417321 2847419327 153
132 iso_pu_bacteria 2848992105 2848994347 153
133 iso_pu_bacteria 2855872281 2855876134 153
134 iso_pu_bacteria 2856356410 2856357515 153
135 iso_pu_bacteria 2857349434 2857352942 153
136 iso_pu_bacteria 2871488783 2871489742 153
137 iso_pu_bacteria 2878753008 2878754222 153
138 iso_pu_bacteria 2881155292 2881159287 153
139 iso_pu_bacteria 2881845957 2881850233 153
140 iso_pu_bacteria 2881861095 2881867016 153
141 iso_pu_bacteria 2882912400 2882915152 153
142 iso_pu_bacteria 2885305155 2885310075 153
143 iso_pu_bacteria 2885312484 2885314250 153
144 iso_pu_bacteria 2885318864 2885325684 153
145 iso_pu_bacteria 2885326080 2885331637 153
146 iso_pu_bacteria 2885334103 2885340382 153
147 iso_pu_bacteria 2885342637 2885348692 153
148 iso_pu_bacteria 2885350715 2885355351 153
149 iso_pu_bacteria 2903492973 2903497463 153
150 iso_pu_bacteria 2924784321 2924784912 153
151 iso_pu_bacteria 2961127735 2961135678 153
152 iso_pu_bacteria 2961170736 2961176281 153
153 iso_pu_bacteria 2967996073 2967996805 153
154 iso_pu_bacteria 2968003550 2968004868 153
155 iso_pu_bacteria 2970503327 2970508952 153
156 iso_pu_bacteria 2977821940 2977823437 153
157 iso_pu_bacteria 2977986579 2977992427 153
158 iso_pu_bacteria 2979808191 2979813631 153
159 iso_pu_bacteria 2987636660 2987641534 153
160 iso_pu_bacteria 2996887358 2996889112 153
161 iso_pu_bacteria 3000135777 3000138851 153
162 iso_pu_bacteria 3004203850 3004209655 153
163 iso_pu_bacteria 8004374579 8004375799 153
164 iso_pu_bacteria 8005258706 8005260231 153
165 iso_pu_bacteria 8005321885 8005323639 153
166 3300005458 Ga0070681_10059786 Ga0070681_100597862 154
167 3300005458 Ga0070681_10481209 Ga0070681_104812092 154
168 3300005563 Ga0068855_100170114 Ga0068855_1001701143 154
169 3300005578 Ga0068854_100803588 Ga0068854_1008035882 154
170 3300005616 Ga0068852_100314146 Ga0068852_1003141462 154
171 3300006178 Ga0075367_10017490 Ga0075367_100174905 154
172 3300006353 Ga0075370_10009806 Ga0075370_100098065 154
173 3300009093 Ga0105240_11907445 Ga0105240_119074451 154
174 3300013104 Ga0157370_11547878 Ga0157370_115478781 154
175 3300013307 Ga0157372_10090184 Ga0157372_100901845 154
176 3300021384 Ga0213876_10037038 Ga0213876_100370382 154
177 3300025912 Ga0207707_10089631 Ga0207707_100896312 154
178 3300025913 Ga0207695_10197077 Ga0207695_101970772 154
179 3300025949 Ga0207667_10262419 Ga0207667_102624193 154
180 3300025981 Ga0207640_10729530 Ga0207640_107295302 154
181 3300026142 Ga0207698_10696220 Ga0207698_106962202 154
182 3300031548 Ga0307408_100226275 Ga0307408_1002262751 154
183 3300031852 Ga0307410_10229990 Ga0307410_102299901 154
184 3300031903 Ga0307407_10072351 Ga0307407_100723513 154
185 3300031995 Ga0307409_100134543 Ga0307409_1001345433 154
186 3300032004 Ga0307414_10193481 Ga0307414_101934812 154
187 3300032005 Ga0307411_10079658 Ga0307411_100796583 154
188 3300037312 Ga0395899_0801999 Ga0395899_0801999_65_535 154
189 3300037466 Ga0395898_1108256 Ga0395898_1108256_43_516 154
190 3300039450 Ga0436363_0658834 Ga0436363_0658834_2748_3215 154
191 3300042876 Ga0451577_0242513 Ga0451577_0242513_526_999 154
192 3300044656 Ga0466969_0274934 Ga0466969_0274934_44_514 154
193 3300044706 Ga0466964_0043877 Ga0466964_0043877_84_554 154
194 3300044712 Ga0453684_0000937 Ga0453684_0000937_27129_27602 154
195 3300045049 Ga0466959_0045490 Ga0466959_0045490_1163_1633 154
196 3300045051 Ga0451576_0000430 Ga0451576_0000430_27129_27602 154
197 3300048922 Ga0496119_0000208 Ga0496119_0000208_28091_28561 154
198 3300048925 Ga0496122_0019958 Ga0496122_0019958_1782_2252 154
199 3300048926 Ga0496123_0001102 Ga0496123_0001102_16652_17122 154
200 3300050494 nmdc:mga06z11_14360_c1 nmdc:mga06z11_14360_c1_274_744 154
201 3300050496 nmdc:mga07m45_8546_c1 nmdc:mga07m45_8546_c1_2759_3229 154
202 3300053116 Ga0500592_036335 Ga0500592_036335_306_776 154
203 3300053131 Ga0500652_157782 Ga0500652_157782_140_610 154
204 3300053156 Ga0500622_0068762 Ga0500622_0068762_768_1238 154
205 3300053730 Ga0500645_010337 Ga0500645_010337_1553_2023 154
206 3300005535 Ga0070684_101453997 Ga0070684_1014539971 155
207 3300005563 Ga0068855_101410034 Ga0068855_1014100342 155
208 3300005614 Ga0068856_100138164 Ga0068856_1001381642 155
209 3300005614 Ga0068856_100282434 Ga0068856_1002824343 155
210 3300005616 Ga0068852_100281644 Ga0068852_1002816441 155
211 3300006038 Ga0075365_10026972 Ga0075365_100269722 155
212 3300006038 Ga0075365_10151833 Ga0075365_101518332 155
213 3300006042 Ga0075368_10043272 Ga0075368_100432723 155
214 3300006048 Ga0075363_100006683 Ga0075363_1000066833 155
215 3300006178 Ga0075367_10007436 Ga0075367_100074366 155
216 3300009093 Ga0105240_10387593 Ga0105240_103875932 155
217 3300009545 Ga0105237_10189108 Ga0105237_101891082 155
218 3300010375 Ga0105239_10165817 Ga0105239_101658173 155
219 3300013104 Ga0157370_10146133 Ga0157370_101461332 155
220 3300025913 Ga0207695_10733556 Ga0207695_107335561 155
221 3300025924 Ga0207694_10240399 Ga0207694_102403992 155
222 3300026078 Ga0207702_10226720 Ga0207702_102267202 155
223 3300028800 Ga0265338_10435779 Ga0265338_104357792 155
224 3300031251 Ga0265327_10000591 Ga0265327_1000059134 155
225 3300031711 Ga0265314_10071597 Ga0265314_100715972 155
226 3300031712 Ga0265342_10315157 Ga0265342_103151572 155
227 3300038443 Ga0395901_0090880 Ga0395901_0090880_1180_1659 155
228 3300041486 Ga0451807_0622174 Ga0451807_0622174_12_491 155
229 3300041505 Ga0451849_0584124 Ga0451849_0584124_176_649 155
230 3300046512 Ga0495610_0024109 Ga0495610_0024109_2092_2571 155
231 3300046515 Ga0495620_0176824 Ga0495620_0176824_192_671 155
232 3300046689 Ga0495613_0000049 Ga0495613_0000049_9802_10278 155
233 3300046694 Ga0495649_0089309 Ga0495649_0089309_1067_1540 155
234 3300046809 Ga0495600_0705502 Ga0495600_0705502_28_504 155
235 3300048929 Ga0496126_0128795 Ga0496126_0128795_225_704 155
236 3300050490 nmdc:mga03n38_202140_c1 nmdc:mga03n38_202140_c1_344_823 155
237 3300050492 nmdc:mga0yw44_111607_c1 nmdc:mga0yw44_111607_c1_1059_1538 155
238 3300050492 nmdc:mga0yw44_36680_c1 nmdc:mga0yw44_36680_c1_540_1019 155
239 3300050492 nmdc:mga0yw44_628328_c1 nmdc:mga0yw44_628328_c1_50_523 155
240 3300050494 nmdc:mga06z11_14692_c1 nmdc:mga06z11_14692_c1_218_697 155
241 3300053119 Ga0500595_018908 Ga0500595_018908_1215_1694 155
242 3300053139 Ga0500568_0000017 Ga0500568_0000017_63843_64316 155
243 3300053151 Ga0500604_0018672 Ga0500604_0018672_1276_1755 155
244 3300053151 Ga0500604_0069594 Ga0500604_0069594_529_1002 155
245 3300053158 Ga0500627_0048456 Ga0500627_0048456_789_1262 155
246 3300002739 JGI25158J39367_1000336 JGI25158J39367_10003363 156
247 3300002773 JGI25152J39213_1003715 JGI25152J39213_10037155 156
248 3300002774 JGI25150J39212_1016014 JGI25150J39212_10160142 156
249 3300002987 JGI25159J45721_1000613 JGI25159J45721_10006135 156
250 3300003187 JGI25151J46595_10000802 JGI25151J46595_1000080215 156
251 3300003187 JGI25151J46595_10095400 JGI25151J46595_100954002 156
252 3300003215 JGI25153J46596_10012453 JGI25153J46596_100124532 156
253 3300003354 JGI25160J50197_1013773 JGI25160J50197_10137733 156
254 3300003374 JGI25161J50226_1000099 JGI25161J50226_100009927 156
255 3300003374 JGI25161J50226_1000140 JGI25161J50226_100014050 156
256 3300003374 JGI25161J50226_1004634 JGI25161J50226_10046343 156
257 3300003771 Ga0055526_1000484 Ga0055526_10004843 156
258 3300003771 Ga0055526_1005523 Ga0055526_10055236 156
259 3300003775 Ga0055524_1004689 Ga0055524_10046895 156
260 3300003775 Ga0055524_1024972 Ga0055524_10249723 156
261 3300003790 Ga0055528_1003598 Ga0055528_10035987 156
262 3300003790 Ga0055528_1004902 Ga0055528_10049028 156
263 3300003792 Ga0055540_1006077 Ga0055540_10060772 156
264 3300003792 Ga0055540_1044881 Ga0055540_10448812 156
265 3300004625 Ga0055543_1000128 Ga0055543_100012814 156
266 3300004625 Ga0055543_1000499 Ga0055543_100049914 156
267 3300005262 Ga0065165_1042303 Ga0065165_10423032 156
268 3300005262 Ga0065165_1111104 Ga0065165_11111041 156
269 3300005339 Ga0070660_100140678 Ga0070660_1001406781 156
270 3300005366 Ga0070659_100000158 Ga0070659_10000015828 156
271 3300005544 Ga0070686_100736329 Ga0070686_1007363291 156
272 3300005548 Ga0070665_100526370 Ga0070665_1005263702 156
273 3300006038 Ga0075365_10155811 Ga0075365_101558112 156
274 3300006042 Ga0075368_10022159 Ga0075368_100221592 156
275 3300006048 Ga0075363_100171077 Ga0075363_1001710772 156
276 3300006177 Ga0075362_10097750 Ga0075362_100977502 156
277 3300006178 Ga0075367_10091970 Ga0075367_100919702 156
278 3300006186 Ga0075369_10000132 Ga0075369_100001325 156
279 3300006186 Ga0075369_10020015 Ga0075369_100200152 156
280 3300006186 Ga0075369_10030047 Ga0075369_100300472 156
281 3300006195 Ga0075366_10271073 Ga0075366_102710732 156
282 3300006353 Ga0075370_10081952 Ga0075370_100819522 156
283 3300006353 Ga0075370_10230135 Ga0075370_102301352 156
284 3300009765 Ga0123341_1151460 Ga0123341_11514602 156
285 3300009765 Ga0123341_1151461 Ga0123341_11514612 156
286 3300009766 Ga0123342_1005565 Ga0123342_10055659 156
287 3300025208 Ga0209436_100029 Ga0209436_10002989 156
288 3300025245 Ga0207425_1008702 Ga0207425_10087022 156
289 3300025258 Ga0209129_1001312 Ga0209129_100131212 156
290 3300025258 Ga0209129_1001999 Ga0209129_100199911 156
291 3300025273 Ga0209673_1001611 Ga0209673_10016113 156
292 3300025273 Ga0209673_1005688 Ga0209673_10056886 156
293 3300025273 Ga0209673_1013499 Ga0209673_10134995 156
294 3300025284 Ga0209130_1000020 Ga0209130_1000020335 156
295 3300025294 Ga0209025_1000058 Ga0209025_1000058263 156
296 3300025294 Ga0209025_1016047 Ga0209025_10160475 156
297 3300025295 Ga0209564_1000512 Ga0209564_100051241 156
298 3300025295 Ga0209564_1001530 Ga0209564_10015305 156
299 3300025297 Ga0209758_1002719 Ga0209758_10027195 156
300 3300025297 Ga0209758_1003069 Ga0209758_100306919 156
301 3300025297 Ga0209758_1003364 Ga0209758_10033645 156
302 3300025299 Ga0209256_1009553 Ga0209256_10095535 156
303 3300025302 Ga0207426_1000008 Ga0207426_1000008402 156
304 3300025302 Ga0207426_1000221 Ga0207426_100022148 156
305 3300025302 Ga0207426_1000946 Ga0207426_100094624 156
306 3300025303 Ga0209051_1004871 Ga0209051_10048719 156
307 3300025303 Ga0209051_1007466 Ga0209051_10074662 156
308 3300025304 Ga0209257_1021628 Ga0209257_10216281 156
309 3300025919 Ga0207657_10192035 Ga0207657_101920352 156
310 3300025923 Ga0207681_10147234 Ga0207681_101472342 156
311 3300025932 Ga0207690_10001138 Ga0207690_1000113813 156
312 3300028379 Ga0268266_10381118 Ga0268266_103811182 156
313 3300031730 Ga0307516_10133294 Ga0307516_101332943 156
314 3300035170 Ga0373943_0328938 Ga0373943_0328938_212_691 156
315 3300035695 Ga0373927_0000810 Ga0373927_0000810_8372_8851 156
316 3300037471 Ga0395905_0069189 Ga0395905_0069189_848_1336 156
317 3300038741 Ga0400488_12049 Ga0400488_12049_141_650 156
318 3300041413 Ga0439465_0001082 Ga0439465_0001082_6491_6961 156
319 3300041413 Ga0439465_0130337 Ga0439465_0130337_336_806 156
320 3300041509 Ga0451843_0998701 Ga0451843_0998701_849_1325 156
321 3300042007 Ga0439449_0025625 Ga0439449_0025625_1665_2141 156
322 3300042010 Ga0439452_051165 Ga0439452_051165_339_815 156
323 3300042015 Ga0439462_0051384 Ga0439462_0051384_367_843 156
324 3300046457 Ga0495590_0040651 Ga0495590_0040651_1040_1510 156
325 3300046460 Ga0495638_0043758 Ga0495638_0043758_593_1069 156
326 3300046471 Ga0495650_0028905 Ga0495650_0028905_324_800 156
327 3300046492 Ga0495585_0200865 Ga0495585_0200865_487_966 156
328 3300046501 Ga0495607_0020859 Ga0495607_0020859_112_588 156
329 3300046506 Ga0495583_0046516 Ga0495583_0046516_473_949 156
330 3300046506 Ga0495583_0101246 Ga0495583_0101246_641_1111 156
331 3300046507 Ga0495606_0010451 Ga0495606_0010451_3684_4160 156
332 3300046507 Ga0495606_0130180 Ga0495606_0130180_885_1355 156
333 3300046512 Ga0495610_0011895 Ga0495610_0011895_865_1335 156
334 3300046512 Ga0495610_0095129 Ga0495610_0095129_755_1231 156
335 3300046515 Ga0495620_0048655 Ga0495620_0048655_916_1392 156
336 3300046518 Ga0495631_0060848 Ga0495631_0060848_840_1319 156
337 3300046519 Ga0495632_0080978 Ga0495632_0080978_923_1399 156
338 3300046519 Ga0495632_0090832 Ga0495632_0090832_117_587 156
339 3300046519 Ga0495632_0118432 Ga0495632_0118432_500_979 156
340 3300046522 Ga0495643_0007771 Ga0495643_0007771_2685_3155 156
341 3300046522 Ga0495643_0015966 Ga0495643_0015966_3242_3718 156
342 3300046524 Ga0495648_0092142 Ga0495648_0092142_434_910 156
343 3300046530 Ga0495654_0126208 Ga0495654_0126208_236_712 156
344 3300046542 Ga0495597_0011360 Ga0495597_0011360_886_1362 156
345 3300046615 Ga0495656_0194740 Ga0495656_0194740_279_755 156
346 3300046616 Ga0495668_0067839 Ga0495668_0067839_1251_1727 156
347 3300046616 Ga0495668_0089841 Ga0495668_0089841_220_699 156
348 3300046648 Ga0495611_0124383 Ga0495611_0124383_410_889 156
349 3300046660 Ga0495625_0250872 Ga0495625_0250872_419_895 156
350 3300046692 Ga0495671_0266370 Ga0495671_0266370_71_547 156
351 3300046694 Ga0495649_0061730 Ga0495649_0061730_969_1445 156
352 3300046694 Ga0495649_0101454 Ga0495649_0101454_499_969 156
353 3300046810 Ga0495660_0046709 Ga0495660_0046709_1089_1565 156
354 3300046810 Ga0495660_0193158 Ga0495660_0193158_62_541 156
355 3300047318 Ga0495636_0077919 Ga0495636_0077919_914_1390 156
356 3300047323 Ga0495683_0150707 Ga0495683_0150707_362_838 156
357 3300047443 Ga0495687_071448 Ga0495687_071448_241_717 156
358 3300047470 Ga0495681_0006193 Ga0495681_0006193_2566_3048 156
359 3300047472 Ga0495686_0033251 Ga0495686_0033251_895_1371 156
360 3300048091 Ga0495626_0069954 Ga0495626_0069954_455_931 156
361 3300048913 Ga0496110_0450017 Ga0496110_0450017_188_667 156
362 3300048913 Ga0496110_0528955 Ga0496110_0528955_247_726 156
363 3300048919 Ga0496116_0055291 Ga0496116_0055291_1850_2320 156
364 3300048919 Ga0496116_0420157 Ga0496116_0420157_48_524 156
365 3300048921 Ga0496118_0027940 Ga0496118_0027940_2758_3228 156
366 3300048921 Ga0496118_0555408 Ga0496118_0555408_38_514 156
367 3300048922 Ga0496119_0026494 Ga0496119_0026494_1759_2241 156
368 3300048922 Ga0496119_0353572 Ga0496119_0353572_149_619 156
369 3300048923 Ga0496120_0018290 Ga0496120_0018290_1865_2347 156
370 3300048924 Ga0496121_0011992 Ga0496121_0011992_934_1404 156
371 3300048924 Ga0496121_0085329 Ga0496121_0085329_792_1274 156
372 3300048924 Ga0496121_0329444 Ga0496121_0329444_53_529 156
373 3300048925 Ga0496122_0071981 Ga0496122_0071981_188_658 156
374 3300048926 Ga0496123_0019000 Ga0496123_0019000_2393_2863 156
375 3300048927 Ga0496124_0034478 Ga0496124_0034478_1591_2061 156
376 3300048927 Ga0496124_0085313 Ga0496124_0085313_454_933 156
377 3300048928 Ga0496125_0017708 Ga0496125_0017708_4417_4899 156
378 3300049459 Ga0495678_053403 Ga0495678_053403_487_966 156
379 3300049460 Ga0495682_0223553 Ga0495682_0223553_53_532 156
380 3300049581 Ga0501047_0069047 Ga0501047_0069047_1154_1639 156
381 3300050489 nmdc:mga03683_46900_c1 nmdc:mga03683_46900_c1_883_1359 156
382 3300050490 nmdc:mga03n38_75024_c1 nmdc:mga03n38_75024_c1_396_872 156
383 3300050491 nmdc:mga00v17_533800_c1 nmdc:mga00v17_533800_c1_14_490 156
384 3300050492 nmdc:mga0yw44_646491_c1 nmdc:mga0yw44_646491_c1_196_675 156
385 3300050493 nmdc:mga0k408_836085_c1 nmdc:mga0k408_836085_c1_14_490 156
386 3300050494 nmdc:mga06z11_548965_c1 nmdc:mga06z11_548965_c1_182_658 156
387 3300050496 nmdc:mga07m45_110144_c1 nmdc:mga07m45_110144_c1_546_1025 156
388 3300050496 nmdc:mga07m45_39646_c1 nmdc:mga07m45_39646_c1_2071_2547 156
389 3300050516 nmdc:mga0sz30_10737_c2 nmdc:mga0sz30_10737_c2_814_1290 156
390 3300050516 nmdc:mga0sz30_75031_c1 nmdc:mga0sz30_75031_c1_915_1385 156
391 3300053093 Ga0500651_0143447 Ga0500651_0143447_777_1259 156
392 3300053096 Ga0500641_0132334 Ga0500641_0132334_347_829 156
393 3300053105 Ga0500557_004353 Ga0500557_004353_1364_1843 156
394 3300053109 Ga0500569_012112 Ga0500569_012112_481_957 156
395 3300053130 Ga0500642_0181181 Ga0500642_0181181_210_692 156
396 3300053134 Ga0500658_0002369 Ga0500658_0002369_2675_3151 156
397 3300053139 Ga0500568_0057690 Ga0500568_0057690_997_1467 156
398 3300053151 Ga0500604_0007759 Ga0500604_0007759_981_1451 156
399 3300053153 Ga0500616_0071801 Ga0500616_0071801_1089_1565 156
400 3300053156 Ga0500622_0000899 Ga0500622_0000899_3824_4294 156
401 3300053156 Ga0500622_0084010 Ga0500622_0084010_196_672 156
402 3300053158 Ga0500627_0185200 Ga0500627_0185200_174_650 156
403 3300053160 Ga0500633_0031808 Ga0500633_0031808_511_981 156
404 3300053160 Ga0500633_0183429 Ga0500633_0183429_113_589 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

4

152

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.6452 14 144
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.6145 7 150
2gww-assembly1.cif.gz_A human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site (residues 602-633) 0.6081 5 151
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.605 14 144
3tj6-assembly1.cif.gz_A human vinculin head domain (vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-vbs-c; residues 812-835) from rickettsia rickettsii 0.6003 12 153
ID Description Score Start End Superfamily
af_Q9ZT73_453_564_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8207 79 153 1.20.58.390
af_I1KQB5_337_449_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.817 78 153 1.20.58.390
af_A0A0R0JDR7_566_680_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7861 77 146 1.20.140.150
2yfbA01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7528 10 150 1.20.1440.210
af_K7M4Z9_552_665_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7504 76 146 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A4Q5PVK4-F1-model_v4 DUF2269 domain-containing protein 0.9813 3 153 GO:0016020
AF-A0A0Q7PJL4-F1-model_v4 DUF2269 domain-containing protein 0.9752 3 155 GO:0016020
AF-A0A2M7GSS1-F1-model_v4 DUF2269 domain-containing protein 0.975 3 156 GO:0016020
AF-A0A0N1KXX8-F1-model_v4 deleted 0.9744 1 156
AF-J1TB95-F1-model_v4 Putative integral membrane protein 0.9735 1 156 GO:0016020

Feature Viewer

pLDDT pTM Quality
95.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map