F435685

General Info

Members Datasets Scaffolds Average Seq Length
404 281 808 240

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10162776|Ga0207663_101627762
Length 259
Sequence VFVSRWDSAGATKDIESLRNQLSSLRIPSGVVATRWWWVRHAPVRNDGGCIYGQTDIGCDTSDRVVFEAVGKILPRDAVWFASNLRRTHQTADAIWSAGFPQPDHLHHESAFAEQHLGEWQGMNRAAFFASRPIAVGSYWFAPIDDPAPGGESFLDLYNRVCDAIVRINAEHAGRDVIAVAHGGTIKAAIGLALGGQPEKGLAFTIDNCSVTRLDYLASAGHSGWRVPMVNQQPWIADASHNAMHQPAGPEIATASKLA

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
264 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
273 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
277 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
278 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
279 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
280 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
281 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.13
Nodule 0.5
Rhizoplane 5.45
Rhizosphere 74.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10162776 3300025916 Bacteria 1577
2 JGI24740J21852_10006544 3300001979 Bacteria 4810
3 JGI24739J22299_10006916 3300001989 Bacteria 4274
4 JGI24737J22298_10027905 3300001990 Bacteria 1777
5 JGI25406J46586_10001518 3300003203 Bacteria 10965
6 JGI25153J46596_10025476 3300003215 Bacteria 2112
7 JGI25153J46596_10054437 3300003215 Bacteria 1126
8 Ga0055526_1024014 3300003771 Bacteria 2011
9 Ga0070658_10055095 3300005327 Bacteria 3230
10 Ga0070658_10183444 3300005327 Bacteria 1761
11 Ga0070658_10199250 3300005327 Bacteria 1689
12 Ga0070658_10391370 3300005327 Bacteria 1193
13 Ga0070683_100084727 3300005329 Bacteria 2970
14 Ga0070666_10316000 3300005335 Bacteria 1114
15 Ga0070680_100074259 3300005336 Bacteria 2798
16 Ga0070682_100142069 3300005337 Bacteria 1638
17 Ga0070660_100124568 3300005339 Bacteria 2058
18 Ga0070660_100231239 3300005339 Bacteria 1504
19 Ga0070660_100650796 3300005339 Bacteria 882
20 Ga0070661_100126770 3300005344 Bacteria 1915
21 Ga0070667_100399631 3300005367 Bacteria 1251
22 Ga0070709_10042000 3300005434 Bacteria 2821
23 Ga0070709_10139759 3300005434 Bacteria 1663
24 Ga0070714_100647695 3300005435 Bacteria 1017
25 Ga0070713_100025545 3300005436 Bacteria 4619
26 Ga0070713_100566513 3300005436 Bacteria 1077
27 Ga0070701_10262963 3300005438 Bacteria 1046
28 Ga0070711_100010893 3300005439 Bacteria 5637
29 Ga0070711_100058519 3300005439 Bacteria 2672
30 Ga0070711_100062627 3300005439 Bacteria 2593
31 Ga0070708_100060892 3300005445 Bacteria 3370
32 Ga0070663_100018930 3300005455 Bacteria 4526
33 Ga0070663_100656730 3300005455 Bacteria 887
34 Ga0070678_100256928 3300005456 Bacteria 1467
35 Ga0070707_100812541 3300005468 Bacteria 899
36 Ga0070698_100542874 3300005471 Bacteria 1102
37 Ga0070699_100519120 3300005518 Bacteria 1083
38 Ga0070679_100221111 3300005530 Bacteria 1855
39 Ga0070697_100250636 3300005536 Bacteria 1514
40 Ga0068853_100032964 3300005539 Bacteria 4391
41 Ga0068853_100238093 3300005539 Bacteria 1667
42 Ga0070665_100446051 3300005548 Bacteria 1303
43 Ga0068855_100041347 3300005563 Bacteria 5464
44 Ga0068855_100137100 3300005563 Bacteria 2791
45 Ga0068857_100007895 3300005577 Bacteria 9178
46 Ga0068857_100079155 3300005577 Bacteria 2934
47 Ga0068854_100003351 3300005578 Bacteria 9984
48 Ga0068854_100363291 3300005578 Bacteria 1188
49 Ga0068856_100035534 3300005614 Bacteria 4884
50 Ga0068856_100049375 3300005614 Bacteria 4147
51 Ga0068856_100090581 3300005614 Bacteria 3042
52 Ga0068856_100502075 3300005614 Bacteria 1234
53 Ga0068852_100015467 3300005616 Bacteria 5921
54 Ga0068852_100022396 3300005616 Bacteria 5066
55 Ga0068851_10001088 3300005834 Bacteria 11784
56 Ga0068851_10150384 3300005834 Bacteria 1272
57 Ga0081540_1021236 3300005983 Bacteria 3875
58 Ga0081539_10000255 3300005985 Bacteria 123054
59 Ga0070717_10247249 3300006028 Bacteria 1574
60 Ga0075365_10028977 3300006038 Bacteria 3534
61 Ga0070715_10000584 3300006163 Bacteria 9605
62 Ga0075369_10004949 3300006186 Bacteria 4956
63 Ga0075434_100220856 3300006871 Bacteria 1915
64 Ga0099794_10107731 3300007265 Bacteria 1394
65 Ga0099794_10121957 3300007265 Bacteria 1312
66 Ga0099794_10193625 3300007265 Bacteria 1040
67 Ga0105240_10007334 3300009093 Bacteria 16044
68 Ga0105240_10430482 3300009093 Bacteria 1480
69 Ga0105243_10350300 3300009148 Bacteria 1356
70 Ga0105241_10007341 3300009174 Bacteria 8105
71 Ga0105242_10356470 3300009176 Bacteria 1353
72 Ga0105237_10086505 3300009545 Bacteria 3124
73 Ga0105237_10135897 3300009545 Bacteria 2453
74 Ga0105238_10002712 3300009551 Bacteria 17625
75 Ga0105238_10039496 3300009551 Bacteria 4786
76 Ga0105238_10176401 3300009551 Bacteria 2114
77 Ga0105238_10275854 3300009551 Bacteria 1662
78 Ga0099796_10009767 3300010159 Bacteria 2610
79 Ga0105239_10062434 3300010375 Bacteria 4089
80 Ga0105239_10109716 3300010375 Bacteria 3058
81 Ga0105239_10456061 3300010375 Bacteria 1451
82 Ga0105246_10158550 3300011119 Bacteria 1721
83 Ga0105246_10287291 3300011119 Bacteria 1322
84 Ga0157370_10059148 3300013104 Bacteria 3642
85 Ga0157369_10046679 3300013105 Bacteria 4707
86 Ga0157369_10424824 3300013105 Bacteria 1378
87 Ga0157372_10542233 3300013307 Bacteria 1356
88 Ga0163163_10039574 3300014325 Bacteria 4601
89 Ga0157379_10121373 3300014968 Bacteria 2351
90 Ga0157379_10281778 3300014968 Bacteria 1513
91 Ga0157376_10021537 3300014969 Bacteria 5008
92 Ga0213871_10004057 3300021441 Bacteria 2891
93 Ga0209564_1003743 3300025295 Bacteria 9931
94 Ga0209564_1011265 3300025295 Bacteria 4024
95 Ga0209758_1004744 3300025297 Bacteria 11046
96 Ga0207656_10020615 3300025321 Bacteria 2622
97 Ga0207692_10023372 3300025898 Bacteria 2858
98 Ga0207647_10016470 3300025904 Bacteria 5046
99 Ga0207647_10106136 3300025904 Bacteria 1663
100 Ga0207685_10061537 3300025905 Bacteria 1489
101 Ga0207699_10434478 3300025906 Bacteria 939
102 Ga0207705_10143361 3300025909 Bacteria 1785
103 Ga0207654_10000241 3300025911 Bacteria 33087
104 Ga0207707_10012159 3300025912 Bacteria 7482
105 Ga0207695_10001032 3300025913 Bacteria 48974
106 Ga0207671_10035906 3300025914 Bacteria 3675
107 Ga0207693_10059824 3300025915 Bacteria 2984
108 Ga0207663_10011407 3300025916 Bacteria 4773
109 Ga0207660_10162400 3300025917 Bacteria 1724
110 Ga0207657_10017937 3300025919 Bacteria 6773
111 Ga0207649_10343161 3300025920 Bacteria 1103
112 Ga0207652_10184139 3300025921 Bacteria 1878
113 Ga0207652_10246393 3300025921 Bacteria 1611
114 Ga0207694_10000271 3300025924 Bacteria 49284
115 Ga0207694_10075313 3300025924 Bacteria 2642
116 Ga0207694_10088714 3300025924 Bacteria 2438
117 Ga0207694_10321838 3300025924 Bacteria 1276
118 Ga0207694_10381752 3300025924 Bacteria 1169
119 Ga0207700_10300447 3300025928 Bacteria 1386
120 Ga0207665_10000921 3300025939 Bacteria 19869
121 Ga0207665_10032968 3300025939 Bacteria 3431
122 Ga0207667_10005212 3300025949 Bacteria 15860
123 Ga0207667_10082766 3300025949 Bacteria 3323
124 Ga0207667_10184733 3300025949 Bacteria 2140
125 Ga0207640_10204431 3300025981 Bacteria 1499
126 Ga0207703_10105270 3300026035 Bacteria 2398
127 Ga0207639_10146778 3300026041 Bacteria 1971
128 Ga0207639_10211902 3300026041 Bacteria 1668
129 Ga0207678_10044999 3300026067 Bacteria 3817
130 Ga0207678_10064885 3300026067 Bacteria 3137
131 Ga0207678_10272686 3300026067 Bacteria 1451
132 Ga0207702_10000005 3300026078 Bacteria 420296
133 Ga0207702_10408259 3300026078 Bacteria 1311
134 Ga0207676_10249098 3300026095 Bacteria 1598
135 Ga0207674_10051561 3300026116 Bacteria 4198
136 Ga0207674_10096541 3300026116 Bacteria 2940
137 Ga0207698_10203683 3300026142 Bacteria 1774
138 Ga0209179_1042178 3300027512 Bacteria 963
139 Ga0307515_10471780 3300028794 Bacteria 868
140 Ga0265332_10014103 3300031238 Bacteria 3537
141 Ga0265339_10002960 3300031249 Bacteria 11993
142 Ga0307513_10274037 3300031456 Bacteria 1469
143 Ga0307516_10018414 3300031730 Bacteria 7257
144 Ga0307412_10563784 3300031911 Bacteria 959
145 Ga0307411_10159170 3300032005 Bacteria 1689
146 Ga0373926_0221326 3300035083 Bacteria 731
147 Ga0373928_0122301 3300035084 Bacteria 699
148 Ga0373934_0115432 3300035086 Bacteria 1091
149 Ga0373934_0250574 3300035086 Bacteria 732
150 Ga0373944_0122982 3300035089 Bacteria 896
151 Ga0373923_0008973 3300035111 Bacteria 3590
152 Ga0373936_0001057 3300035113 Bacteria 9852
153 Ga0373953_0054554 3300035117 Bacteria 1621
154 Ga0373954_0004666 3300035118 Bacteria 5910
155 Ga0373956_0067073 3300035119 Bacteria 1633
156 Ga0373957_0053763 3300035120 Bacteria 1545
157 Ga0373957_0148478 3300035120 Bacteria 961
158 Ga0373943_0010281 3300035170 Bacteria 4198
159 Ga0373946_0027354 3300035171 Bacteria 2255
160 Ga0373946_0072617 3300035171 Bacteria 1490
161 Ga0373942_0094772 3300035207 Bacteria 904
162 Ga0373962_0061128 3300035242 Bacteria 1107
163 Ga0373924_0041764 3300035410 Bacteria 1880
164 Ga0373924_0188538 3300035410 Bacteria 908
165 Ga0373935_0027728 3300035692 Bacteria 3500
166 Ga0373927_0002077 3300035695 Bacteria 14794
167 Ga0373927_0029808 3300035695 Bacteria 3558
168 Ga0373933_0050379 3300035724 Bacteria 2486
169 Ga0373933_0065193 3300035724 Bacteria 2205
170 Ga0373933_0066391 3300035724 Bacteria 2186
171 Ga0373947_0003659 3300035725 Bacteria 9068
172 Ga0373937_0030028 3300036401 Bacteria 4923
173 Ga0373937_0607054 3300036401 Bacteria 1038
174 Ga0373925_0016108 3300037068 Bacteria 5413
175 Ga0373925_0173639 3300037068 Bacteria 1702
176 Ga0395898_0155839 3300037466 Bacteria 2185
177 Ga0395898_0412392 3300037466 Bacteria 1288
178 Ga0395905_0074842 3300037471 Bacteria 3174
179 Ga0395901_0536073 3300038443 Bacteria 1188
180 Ga0395901_0554800 3300038443 Bacteria 1164
181 Ga0436365_0581128 3300039437 Bacteria 1234
182 Ga0436360_0200211 3300039438 Bacteria 787
183 Ga0436360_0739564 3300039438 Bacteria 1261
184 Ga0436360_0846060 3300039438 Bacteria 3593
185 Ga0436361_0845483 3300039447 Bacteria 6175
186 Ga0436363_0780128 3300039450 Bacteria 4054
187 Ga0436363_0987115 3300039450 Bacteria 844
188 Ga0436362_0959589 3300039453 Bacteria 4332
189 Ga0439465_0011969 3300041413 Bacteria 2717
190 Ga0451802_0698077 3300041460 Bacteria 880
191 Ga0451804_1113553 3300041463 Bacteria 754
192 Ga0466966_0204002 3300044684 Bacteria 1196
193 Ga0466968_0191456 3300044735 Bacteria 955
194 Ga0466970_0100653 3300044765 Bacteria 1574
195 Ga0466967_0071969 3300045976 Bacteria 3097
196 Ga0466967_0169217 3300045976 Bacteria 2055
197 Ga0495592_0024787 3300046454 Bacteria 4559
198 Ga0495592_0043092 3300046454 Bacteria 3378
199 Ga0495603_0001363 3300046455 Bacteria 14202
200 Ga0495603_0011547 3300046455 Bacteria 5342
201 Ga0495629_0003339 3300046459 Bacteria 12124
202 Ga0495629_0111912 3300046459 Bacteria 1903
203 Ga0495638_0095742 3300046460 Bacteria 1782
204 Ga0495641_0003755 3300046461 Bacteria 11170
205 Ga0495651_0071737 3300046462 Bacteria 2632
206 Ga0495653_0085766 3300046463 Bacteria 2315
207 Ga0495653_0108568 3300046463 Bacteria 1998
208 Ga0495650_0124953 3300046471 Bacteria 944
209 Ga0495580_0005035 3300046472 Bacteria 11017
210 Ga0495580_0077330 3300046472 Bacteria 2321
211 Ga0495582_0000568 3300046473 Bacteria 20448
212 Ga0495639_0001874 3300046475 Bacteria 9311
213 Ga0495662_0001167 3300046476 Bacteria 12950
214 Ga0495664_0014396 3300046477 Bacteria 4484
215 Ga0495594_0006807 3300046499 Bacteria 5873
216 Ga0495583_0183743 3300046506 Bacteria 855
217 Ga0495606_0001832 3300046507 Bacteria 26910
218 Ga0495608_0039559 3300046511 Bacteria 3160
219 Ga0495610_0043775 3300046512 Bacteria 2227
220 Ga0495616_0019492 3300046513 Bacteria 3701
221 Ga0495620_0015236 3300046515 Bacteria 3886
222 Ga0495628_0028876 3300046516 Bacteria 4503
223 Ga0495628_0035972 3300046516 Bacteria 3977
224 Ga0495628_0561068 3300046516 Bacteria 819
225 Ga0495630_0001430 3300046517 Bacteria 16542
226 Ga0495631_0126500 3300046518 Bacteria 1098
227 Ga0495637_0086842 3300046520 Bacteria 1239
228 Ga0495648_0001345 3300046524 Bacteria 24267
229 Ga0495648_0022402 3300046524 Bacteria 4349
230 Ga0495666_0046578 3300046526 Bacteria 2090
231 Ga0495652_0066800 3300046529 Bacteria 3016
232 Ga0495652_0378135 3300046529 Bacteria 1008
233 Ga0495654_0007301 3300046530 Bacteria 6189
234 Ga0495665_0004511 3300046531 Bacteria 7513
235 Ga0495640_0003914 3300046533 Bacteria 11927
236 Ga0495640_0049414 3300046533 Bacteria 2900
237 Ga0495645_0017485 3300046543 Bacteria 5137
238 Ga0495622_0331317 3300046557 Bacteria 660
239 Ga0495667_0016347 3300046559 Bacteria 5015
240 Ga0495667_0103294 3300046559 Bacteria 1843
241 Ga0495634_0004112 3300046642 Bacteria 11523
242 Ga0495634_0018642 3300046642 Bacteria 4937
243 Ga0495625_0158346 3300046660 Bacteria 1518
244 Ga0495635_0010514 3300046663 Bacteria 6478
245 Ga0495635_0045939 3300046663 Bacteria 3012
246 Ga0495635_0582384 3300046663 Bacteria 732
247 Ga0495588_0046090 3300046674 Bacteria 2236
248 Ga0495657_0045621 3300046675 Bacteria 2973
249 Ga0495623_0057971 3300046679 Bacteria 2436
250 Ga0495623_0144499 3300046679 Bacteria 1412
251 Ga0495646_0035918 3300046680 Bacteria 3071
252 Ga0495646_0050943 3300046680 Bacteria 2507
253 Ga0495658_0002294 3300046683 Bacteria 9650
254 Ga0495613_0014401 3300046689 Bacteria 5870
255 Ga0495624_0004012 3300046690 Bacteria 10839
256 Ga0495624_0445719 3300046690 Bacteria 776
257 Ga0495670_0025366 3300046691 Bacteria 2932
258 Ga0495600_0026851 3300046809 Bacteria 3718
259 Ga0495600_0551176 3300046809 Bacteria 704
260 Ga0495581_0003679 3300047315 Bacteria 8827
261 Ga0495674_0004855 3300047319 Bacteria 12928
262 Ga0495674_0090793 3300047319 Bacteria 2610
263 Ga0495674_0389713 3300047319 Bacteria 1126
264 Ga0495674_0645909 3300047319 Bacteria 835
265 Ga0495672_0060025 3300047320 Bacteria 2198
266 Ga0495676_0040221 3300047321 Bacteria 3861
267 Ga0495680_0153635 3300047322 Bacteria 1676
268 Ga0495680_0173221 3300047322 Bacteria 1561
269 Ga0495680_0490956 3300047322 Bacteria 835
270 Ga0495675_0027406 3300047444 Bacteria 3629
271 Ga0495673_0044478 3300047469 Bacteria 1980
272 Ga0495684_0051504 3300047471 Bacteria 3142
273 Ga0495684_0085965 3300047471 Bacteria 2384
274 Ga0495686_0020984 3300047472 Bacteria 4349
275 Ga0495686_0162423 3300047472 Bacteria 1304
276 Ga0495593_0000499 3300047673 Bacteria 22186
277 Ga0495593_0227567 3300047673 Bacteria 935
278 Ga0495602_0234460 3300048088 Bacteria 1376
279 Ga0495614_0013958 3300048089 Bacteria 3522
280 Ga0496101_0160688 3300048904 Bacteria 1723
281 Ga0496102_0426161 3300048905 Bacteria 1246
282 Ga0496104_0343757 3300048907 Bacteria 1405
283 Ga0496104_0655709 3300048907 Bacteria 958
284 Ga0496105_0123114 3300048908 Bacteria 2138
285 Ga0496105_0180511 3300048908 Bacteria 1729
286 Ga0496106_0100154 3300048909 Bacteria 2247
287 Ga0496107_0329342 3300048910 Bacteria 1136
288 Ga0496108_0034965 3300048911 Bacteria 4175
289 Ga0496109_0066220 3300048912 Bacteria 3307
290 Ga0496110_0256056 3300048913 Bacteria 1593
291 Ga0496111_0270576 3300048914 Bacteria 1260
292 Ga0496111_0470750 3300048914 Bacteria 926
293 Ga0496112_0000122 3300048915 Bacteria 48608
294 Ga0496112_0014149 3300048915 Bacteria 7391
295 Ga0496112_0114889 3300048915 Bacteria 2662
296 Ga0496112_0206462 3300048915 Bacteria 1922
297 Ga0496113_0078925 3300048916 Bacteria 2519
298 Ga0496115_0049193 3300048918 Bacteria 3374
299 Ga0496116_0008272 3300048919 Bacteria 9049
300 Ga0496117_0098269 3300048920 Bacteria 1862
301 Ga0496117_0181331 3300048920 Bacteria 1210
302 Ga0496118_0048508 3300048921 Bacteria 3279
303 Ga0496118_0069790 3300048921 Bacteria 2542
304 Ga0496119_0156040 3300048922 Bacteria 1218
305 Ga0496119_0274418 3300048922 Bacteria 841
306 Ga0496121_0029029 3300048924 Bacteria 5131
307 Ga0496121_0045434 3300048924 Bacteria 3774
308 Ga0496121_0116228 3300048924 Bacteria 2029
309 Ga0496121_0161314 3300048924 Bacteria 1639
310 Ga0496122_0199807 3300048925 Bacteria 1170
311 Ga0496123_0027288 3300048926 Bacteria 4256
312 Ga0496125_0003174 3300048928 Bacteria 20373
313 Ga0496125_0017482 3300048928 Bacteria 6832
314 Ga0496125_0028762 3300048928 Bacteria 5010
315 Ga0496126_0076977 3300048929 Bacteria 2958
316 Ga0496126_0111146 3300048929 Bacteria 2386
317 Ga0496126_0146361 3300048929 Bacteria 2029
318 Ga0496126_0183641 3300048929 Bacteria 1775
319 Ga0496126_0237392 3300048929 Bacteria 1525
320 Ga0501031_0059064 3300049568 Bacteria 2499
321 Ga0501032_0001088 3300049569 Bacteria 21684
322 Ga0501033_0001172 3300049570 Bacteria 23634
323 Ga0501034_0000061 3300049571 Bacteria 195178
324 Ga0501036_0000699 3300049572 Bacteria 24755
325 Ga0501037_0002200 3300049573 Bacteria 14088
326 Ga0501038_0000066 3300049574 Bacteria 86216
327 Ga0501043_0000325 3300049579 Bacteria 43003
328 Ga0501046_0001366 3300049580 Bacteria 23518
329 Ga0501047_0002994 3300049581 Bacteria 16024
330 Ga0501047_0192546 3300049581 Bacteria 1902
331 Ga0501047_0211926 3300049581 Bacteria 1795
332 Ga0501048_0006378 3300049582 Bacteria 8967
333 Ga0501048_0472080 3300049582 Bacteria 899
334 Ga0501067_0001932 3300049583 Bacteria 11397
335 Ga0501068_0016343 3300049584 Bacteria 4276
336 Ga0501069_0006710 3300049585 Bacteria 6027
337 Ga0501070_0010761 3300049586 Bacteria 7731
338 Ga0501070_0539207 3300049586 Bacteria 935
339 Ga0501071_0378859 3300049587 Bacteria 1079
340 Ga0501072_0002040 3300049588 Bacteria 15033
341 Ga0501073_0000973 3300049589 Bacteria 20612
342 Ga0501074_0000857 3300049590 Bacteria 19359
343 Ga0501076_0296970 3300049592 Bacteria 1324
344 Ga0501079_0007584 3300049741 Bacteria 8219
345 Ga0501080_0030933 3300049742 Bacteria 4988
346 Ga0501080_0031175 3300049742 Bacteria 4968
347 Ga0501083_0094314 3300049744 Bacteria 1976
348 Ga0501035_0048528 3300049822 Bacteria 3807
349 Ga0501044_0000367 3300049823 Bacteria 56521
350 Ga0501044_0692356 3300049823 Bacteria 905
351 nmdc:mga03683_44685_c1 3300050489 Bacteria 1831
352 nmdc:mga03n38_3576_c1 3300050490 Bacteria 5017
353 nmdc:mga0yw44_3311_c1 3300050492 Bacteria 7123
354 nmdc:mga0yw44_399037_c1 3300050492 Bacteria 930
355 nmdc:mga0sz30_194566_c1 3300050516 Bacteria 900
356 nmdc:mga0sz30_5538_c1 3300050516 Bacteria 4269
357 Ga0495601_0147185 3300053077 Bacteria 1537
358 Ga0495612_0019371 3300053078 Bacteria 2725
359 Ga0495655_0152428 3300053083 Bacteria 728
360 Ga0495595_0089980 3300053084 Bacteria 1471
361 Ga0495619_0264182 3300053085 Bacteria 1192
362 Ga0500578_0160171 3300053086 Bacteria 1397
363 Ga0500643_038036 3300053087 Bacteria 1429
364 Ga0500581_023465 3300053089 Bacteria 3130
365 Ga0500651_0058870 3300053093 Bacteria 2402
366 Ga0500651_0317546 3300053093 Bacteria 890
367 Ga0500651_0394444 3300053093 Bacteria 778
368 Ga0500566_0004045 3300053094 Bacteria 8745
369 Ga0500566_0227552 3300053094 Bacteria 922
370 Ga0500641_0006528 3300053096 Bacteria 4137
371 Ga0500650_0030966 3300053098 Bacteria 2429
372 Ga0500556_0000066 3300053104 Bacteria 105850
373 Ga0500562_037503 3300053108 Bacteria 1286
374 Ga0500592_009424 3300053116 Bacteria 1552
375 Ga0500595_001240 3300053119 Bacteria 14053
376 Ga0500595_016267 3300053119 Bacteria 2774
377 Ga0500595_031451 3300053119 Bacteria 1781
378 Ga0500608_183500 3300053122 Bacteria 883
379 Ga0500642_0000012 3300053130 Bacteria 206424
380 Ga0500658_0162837 3300053134 Bacteria 1010
381 Ga0500559_0001286 3300053136 Bacteria 14564
382 Ga0500559_0003483 3300053136 Bacteria 7722
383 Ga0500568_0007089 3300053139 Bacteria 5541
384 Ga0500577_0000743 3300053142 Bacteria 8363
385 Ga0500586_000345 3300053145 Bacteria 9177
386 Ga0500588_0022610 3300053146 Bacteria 1715
387 Ga0500590_145986 3300053148 Bacteria 1074
388 Ga0500604_0012163 3300053151 Bacteria 2320
389 Ga0500616_0000177 3300053153 Bacteria 106498
390 Ga0500622_0020068 3300053156 Bacteria 3548
391 Ga0500622_0075361 3300053156 Bacteria 1698
392 Ga0500634_0189106 3300053161 Bacteria 917
393 Ga0500638_174558 3300053162 Bacteria 933
394 Ga0500639_083755 3300053163 Bacteria 1602
395 Ga0500636_0008061 3300053177 Bacteria 6098
396 Ga0500636_0038592 3300053177 Bacteria 2825
397 Ga0501084_0012652 3300054114 Bacteria 6992
398 Ga0501082_0018863 3300060353 Bacteria 5942
399 2509149670 2508501128 Bacteria 8613869
400 2603856928 2602042107 Bacteria 6226103
401 2857528551 2857524615 Bacteria 6615449
402 2893066234 2893066018 Bacteria 6158120
403 2919076084 2919073203 Bacteria 6531949
404 2935648700 2935648319 Bacteria 8801166
405 Ga0207663_10162776
406 JGI24740J21852_10006544
407 JGI24739J22299_10006916
408 JGI24737J22298_10027905
409 JGI25406J46586_10001518
410 JGI25153J46596_10025476
411 JGI25153J46596_10054437
412 Ga0055526_1024014
413 Ga0070658_10055095
414 Ga0070658_10183444
415 Ga0070658_10199250
416 Ga0070658_10391370
417 Ga0070683_100084727
418 Ga0070666_10316000
419 Ga0070680_100074259
420 Ga0070682_100142069
421 Ga0070660_100124568
422 Ga0070660_100231239
423 Ga0070660_100650796
424 Ga0070661_100126770
425 Ga0070667_100399631
426 Ga0070709_10042000
427 Ga0070709_10139759
428 Ga0070714_100647695
429 Ga0070713_100025545
430 Ga0070713_100566513
431 Ga0070701_10262963
432 Ga0070711_100010893
433 Ga0070711_100058519
434 Ga0070711_100062627
435 Ga0070708_100060892
436 Ga0070663_100018930
437 Ga0070663_100656730
438 Ga0070678_100256928
439 Ga0070707_100812541
440 Ga0070698_100542874
441 Ga0070699_100519120
442 Ga0070679_100221111
443 Ga0070697_100250636
444 Ga0068853_100032964
445 Ga0068853_100238093
446 Ga0070665_100446051
447 Ga0068855_100041347
448 Ga0068855_100137100
449 Ga0068857_100007895
450 Ga0068857_100079155
451 Ga0068854_100003351
452 Ga0068854_100363291
453 Ga0068856_100035534
454 Ga0068856_100049375
455 Ga0068856_100090581
456 Ga0068856_100502075
457 Ga0068852_100015467
458 Ga0068852_100022396
459 Ga0068851_10001088
460 Ga0068851_10150384
461 Ga0081540_1021236
462 Ga0081539_10000255
463 Ga0070717_10247249
464 Ga0075365_10028977
465 Ga0070715_10000584
466 Ga0075369_10004949
467 Ga0075434_100220856
468 Ga0099794_10107731
469 Ga0099794_10121957
470 Ga0099794_10193625
471 Ga0105240_10007334
472 Ga0105240_10430482
473 Ga0105243_10350300
474 Ga0105241_10007341
475 Ga0105242_10356470
476 Ga0105237_10086505
477 Ga0105237_10135897
478 Ga0105238_10002712
479 Ga0105238_10039496
480 Ga0105238_10176401
481 Ga0105238_10275854
482 Ga0099796_10009767
483 Ga0105239_10062434
484 Ga0105239_10109716
485 Ga0105239_10456061
486 Ga0105246_10158550
487 Ga0105246_10287291
488 Ga0157370_10059148
489 Ga0157369_10046679
490 Ga0157369_10424824
491 Ga0157372_10542233
492 Ga0163163_10039574
493 Ga0157379_10121373
494 Ga0157379_10281778
495 Ga0157376_10021537
496 Ga0213871_10004057
497 Ga0209564_1003743
498 Ga0209564_1011265
499 Ga0209758_1004744
500 Ga0207656_10020615
501 Ga0207692_10023372
502 Ga0207647_10016470
503 Ga0207647_10106136
504 Ga0207685_10061537
505 Ga0207699_10434478
506 Ga0207705_10143361
507 Ga0207654_10000241
508 Ga0207707_10012159
509 Ga0207695_10001032
510 Ga0207671_10035906
511 Ga0207693_10059824
512 Ga0207663_10011407
513 Ga0207660_10162400
514 Ga0207657_10017937
515 Ga0207649_10343161
516 Ga0207652_10184139
517 Ga0207652_10246393
518 Ga0207694_10000271
519 Ga0207694_10075313
520 Ga0207694_10088714
521 Ga0207694_10321838
522 Ga0207694_10381752
523 Ga0207700_10300447
524 Ga0207665_10000921
525 Ga0207665_10032968
526 Ga0207667_10005212
527 Ga0207667_10082766
528 Ga0207667_10184733
529 Ga0207640_10204431
530 Ga0207703_10105270
531 Ga0207639_10146778
532 Ga0207639_10211902
533 Ga0207678_10044999
534 Ga0207678_10064885
535 Ga0207678_10272686
536 Ga0207702_10000005
537 Ga0207702_10408259
538 Ga0207676_10249098
539 Ga0207674_10051561
540 Ga0207674_10096541
541 Ga0207698_10203683
542 Ga0209179_1042178
543 Ga0307515_10471780
544 Ga0265332_10014103
545 Ga0265339_10002960
546 Ga0307513_10274037
547 Ga0307516_10018414
548 Ga0307412_10563784
549 Ga0307411_10159170
550 Ga0373926_0221326
551 Ga0373928_0122301
552 Ga0373934_0115432
553 Ga0373934_0250574
554 Ga0373944_0122982
555 Ga0373923_0008973
556 Ga0373936_0001057
557 Ga0373953_0054554
558 Ga0373954_0004666
559 Ga0373956_0067073
560 Ga0373957_0053763
561 Ga0373957_0148478
562 Ga0373943_0010281
563 Ga0373946_0027354
564 Ga0373946_0072617
565 Ga0373942_0094772
566 Ga0373962_0061128
567 Ga0373924_0041764
568 Ga0373924_0188538
569 Ga0373935_0027728
570 Ga0373927_0002077
571 Ga0373927_0029808
572 Ga0373933_0050379
573 Ga0373933_0065193
574 Ga0373933_0066391
575 Ga0373947_0003659
576 Ga0373937_0030028
577 Ga0373937_0607054
578 Ga0373925_0016108
579 Ga0373925_0173639
580 Ga0395898_0155839
581 Ga0395898_0412392
582 Ga0395905_0074842
583 Ga0395901_0536073
584 Ga0395901_0554800
585 Ga0436365_0581128
586 Ga0436360_0200211
587 Ga0436360_0739564
588 Ga0436360_0846060
589 Ga0436361_0845483
590 Ga0436363_0780128
591 Ga0436363_0987115
592 Ga0436362_0959589
593 Ga0439465_0011969
594 Ga0451802_0698077
595 Ga0451804_1113553
596 Ga0466966_0204002
597 Ga0466968_0191456
598 Ga0466970_0100653
599 Ga0466967_0071969
600 Ga0466967_0169217
601 Ga0495592_0024787
602 Ga0495592_0043092
603 Ga0495603_0001363
604 Ga0495603_0011547
605 Ga0495629_0003339
606 Ga0495629_0111912
607 Ga0495638_0095742
608 Ga0495641_0003755
609 Ga0495651_0071737
610 Ga0495653_0085766
611 Ga0495653_0108568
612 Ga0495650_0124953
613 Ga0495580_0005035
614 Ga0495580_0077330
615 Ga0495582_0000568
616 Ga0495639_0001874
617 Ga0495662_0001167
618 Ga0495664_0014396
619 Ga0495594_0006807
620 Ga0495583_0183743
621 Ga0495606_0001832
622 Ga0495608_0039559
623 Ga0495610_0043775
624 Ga0495616_0019492
625 Ga0495620_0015236
626 Ga0495628_0028876
627 Ga0495628_0035972
628 Ga0495628_0561068
629 Ga0495630_0001430
630 Ga0495631_0126500
631 Ga0495637_0086842
632 Ga0495648_0001345
633 Ga0495648_0022402
634 Ga0495666_0046578
635 Ga0495652_0066800
636 Ga0495652_0378135
637 Ga0495654_0007301
638 Ga0495665_0004511
639 Ga0495640_0003914
640 Ga0495640_0049414
641 Ga0495645_0017485
642 Ga0495622_0331317
643 Ga0495667_0016347
644 Ga0495667_0103294
645 Ga0495634_0004112
646 Ga0495634_0018642
647 Ga0495625_0158346
648 Ga0495635_0010514
649 Ga0495635_0045939
650 Ga0495635_0582384
651 Ga0495588_0046090
652 Ga0495657_0045621
653 Ga0495623_0057971
654 Ga0495623_0144499
655 Ga0495646_0035918
656 Ga0495646_0050943
657 Ga0495658_0002294
658 Ga0495613_0014401
659 Ga0495624_0004012
660 Ga0495624_0445719
661 Ga0495670_0025366
662 Ga0495600_0026851
663 Ga0495600_0551176
664 Ga0495581_0003679
665 Ga0495674_0004855
666 Ga0495674_0090793
667 Ga0495674_0389713
668 Ga0495674_0645909
669 Ga0495672_0060025
670 Ga0495676_0040221
671 Ga0495680_0153635
672 Ga0495680_0173221
673 Ga0495680_0490956
674 Ga0495675_0027406
675 Ga0495673_0044478
676 Ga0495684_0051504
677 Ga0495684_0085965
678 Ga0495686_0020984
679 Ga0495686_0162423
680 Ga0495593_0000499
681 Ga0495593_0227567
682 Ga0495602_0234460
683 Ga0495614_0013958
684 Ga0496101_0160688
685 Ga0496102_0426161
686 Ga0496104_0343757
687 Ga0496104_0655709
688 Ga0496105_0123114
689 Ga0496105_0180511
690 Ga0496106_0100154
691 Ga0496107_0329342
692 Ga0496108_0034965
693 Ga0496109_0066220
694 Ga0496110_0256056
695 Ga0496111_0270576
696 Ga0496111_0470750
697 Ga0496112_0000122
698 Ga0496112_0014149
699 Ga0496112_0114889
700 Ga0496112_0206462
701 Ga0496113_0078925
702 Ga0496115_0049193
703 Ga0496116_0008272
704 Ga0496117_0098269
705 Ga0496117_0181331
706 Ga0496118_0048508
707 Ga0496118_0069790
708 Ga0496119_0156040
709 Ga0496119_0274418
710 Ga0496121_0029029
711 Ga0496121_0045434
712 Ga0496121_0116228
713 Ga0496121_0161314
714 Ga0496122_0199807
715 Ga0496123_0027288
716 Ga0496125_0003174
717 Ga0496125_0017482
718 Ga0496125_0028762
719 Ga0496126_0076977
720 Ga0496126_0111146
721 Ga0496126_0146361
722 Ga0496126_0183641
723 Ga0496126_0237392
724 Ga0501031_0059064
725 Ga0501032_0001088
726 Ga0501033_0001172
727 Ga0501034_0000061
728 Ga0501036_0000699
729 Ga0501037_0002200
730 Ga0501038_0000066
731 Ga0501043_0000325
732 Ga0501046_0001366
733 Ga0501047_0002994
734 Ga0501047_0192546
735 Ga0501047_0211926
736 Ga0501048_0006378
737 Ga0501048_0472080
738 Ga0501067_0001932
739 Ga0501068_0016343
740 Ga0501069_0006710
741 Ga0501070_0010761
742 Ga0501070_0539207
743 Ga0501071_0378859
744 Ga0501072_0002040
745 Ga0501073_0000973
746 Ga0501074_0000857
747 Ga0501076_0296970
748 Ga0501079_0007584
749 Ga0501080_0030933
750 Ga0501080_0031175
751 Ga0501083_0094314
752 Ga0501035_0048528
753 Ga0501044_0000367
754 Ga0501044_0692356
755 nmdc:mga03683_44685_c1
756 nmdc:mga03n38_3576_c1
757 nmdc:mga0yw44_3311_c1
758 nmdc:mga0yw44_399037_c1
759 nmdc:mga0sz30_194566_c1
760 nmdc:mga0sz30_5538_c1
761 Ga0495601_0147185
762 Ga0495612_0019371
763 Ga0495655_0152428
764 Ga0495595_0089980
765 Ga0495619_0264182
766 Ga0500578_0160171
767 Ga0500643_038036
768 Ga0500581_023465
769 Ga0500651_0058870
770 Ga0500651_0317546
771 Ga0500651_0394444
772 Ga0500566_0004045
773 Ga0500566_0227552
774 Ga0500641_0006528
775 Ga0500650_0030966
776 Ga0500556_0000066
777 Ga0500562_037503
778 Ga0500592_009424
779 Ga0500595_001240
780 Ga0500595_016267
781 Ga0500595_031451
782 Ga0500608_183500
783 Ga0500642_0000012
784 Ga0500658_0162837
785 Ga0500559_0001286
786 Ga0500559_0003483
787 Ga0500568_0007089
788 Ga0500577_0000743
789 Ga0500586_000345
790 Ga0500588_0022610
791 Ga0500590_145986
792 Ga0500604_0012163
793 Ga0500616_0000177
794 Ga0500622_0020068
795 Ga0500622_0075361
796 Ga0500634_0189106
797 Ga0500638_174558
798 Ga0500639_083755
799 Ga0500636_0008061
800 Ga0500636_0038592
801 Ga0501084_0012652
802 Ga0501082_0018863
803 2509149670
804 2603856928
805 2857528551
806 2893066234
807 2919076084
808 2935648700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

36

233

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.8418 21 221
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8282 21 220
6s2q-assembly1.cif.gz_A mycobacterial hydrolase 1 0.8197 21 220
2p9y-assembly2.cif.gz_B crystal structure of tthb049 from thermus thermophilus hb8 0.8162 21 200
6s2q-assembly2.cif.gz_C mycobacterial hydrolase 1 0.8125 20 220
ID Description Score Start End Superfamily
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8282 21 220 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8201 19 200 3.40.50.1240
af_Q8BZA9_1_269_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8045 20 221 3.40.50.1240
4qihB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.802 21 220 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7985 21 220 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A420WBX4-F1-model_v4 Broad specificity phosphatase PhoE 0.9517 19 221
AF-A0A2E0M0J4-F1-model_v4 Histidine phosphatase family protein 0.9097 20 221
AF-A0A1Y5FS17-F1-model_v4 Histidine phosphatase family protein 0.9089 19 221 GO:0005737
GO:0016791
AF-A0A2E8YQP2-F1-model_v4 Histidine phosphatase family protein 0.9048 15 217 GO:0005737
GO:0016791
AF-A0A1C3REU6-F1-model_v4 Phosphoglycerate/bisphosphoglycerate mutase 0.9043 18 219 GO:0005737
GO:0016791

Map