F435632

General Info

Members Datasets Scaffolds Average Seq Length
404 197 387 289

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10002146|Ga0075370_100021469
Length 316
Sequence MSRGFGCILLAKSKTRKTETLALAVRRLPPLRALEAFVRVVRLGSAKAAASELGLSPSALSRRVAALEDFTGKRLFTRQHQAMKLTDEGQAFYAAVSPKLEELAEAVEAQVDPGRVLRLHLGVPSLFGGQRLFPRLPELRKQHPRLHIDIDTSPHLDTRVGDTLDAAIILSKEPDPQFHAVQLDQNNVYAITSQALAKEIGDVPDPAKLSRQTFLIHHDLPDSFDAWKAAMNLTRLQPAAIDHFDSGQLILEAAAQGLGIAIMHDDHFNRSGDTRLARLYDVDVKSPYSYWFICRPRDLEARPVKIFHEWIRSAGL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
12 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
13 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
14 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
15 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
16 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
17 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
187 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
188 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
189 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
194 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
195 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 0
Isolates 4.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.84
Nodule 0
Rhizoplane 5.2
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1584582 2162886007 Bacteria 10355
2 SwRhRL2b_contig_3436808 2162886007 Bacteria 1009
3 JGI24034J26672_10018358 3300002239 Bacteria 1086
4 Ga0065704_10000204 3300005289 Bacteria 211587
5 Ga0065704_10002033 3300005289 Bacteria 6241
6 Ga0065704_10003890 3300005289 Bacteria 4075
7 Ga0065704_10148997 3300005289 Bacteria 1446
8 Ga0065707_10085682 3300005295 Bacteria 5970
9 Ga0070658_10086342 3300005327 Bacteria 2581
10 Ga0070670_100008621 3300005331 Bacteria 8703
11 Ga0070670_100036706 3300005331 Bacteria 4217
12 Ga0070670_100052945 3300005331 Bacteria 3486
13 Ga0070666_10002955 3300005335 Bacteria 10299
14 Ga0070666_10004087 3300005335 Bacteria 8863
15 Ga0070666_10024376 3300005335 Bacteria 3940
16 Ga0070668_100009943 3300005347 Bacteria 7047
17 Ga0070668_100010875 3300005347 Bacteria 6771
18 Ga0070668_100013611 3300005347 Bacteria 6075
19 Ga0070668_100015512 3300005347 Bacteria 5696
20 Ga0070668_100143234 3300005347 Bacteria 1927
21 Ga0070669_100000008 3300005353 Bacteria 226764
22 Ga0070669_100000620 3300005353 Bacteria 26234
23 Ga0070669_100001027 3300005353 Bacteria 20334
24 Ga0070669_100001462 3300005353 Bacteria 17091
25 Ga0070669_100005271 3300005353 Bacteria 9333
26 Ga0070669_100254893 3300005353 Bacteria 1398
27 Ga0070671_100000010 3300005355 Bacteria 202799
28 Ga0070671_100000062 3300005355 Bacteria 73417
29 Ga0070671_100002834 3300005355 Bacteria 13466
30 Ga0070671_100202072 3300005355 Bacteria 1685
31 Ga0070667_100000690 3300005367 Bacteria 32571
32 Ga0070667_100001088 3300005367 Bacteria 24888
33 Ga0070667_100003291 3300005367 Bacteria 13805
34 Ga0070667_100005409 3300005367 Bacteria 10666
35 Ga0070667_100012385 3300005367 Bacteria 7056
36 Ga0070667_100030692 3300005367 Bacteria 4482
37 Ga0070667_100034934 3300005367 Bacteria 4209
38 Ga0070705_100083318 3300005440 Bacteria 1970
39 Ga0070708_100039546 3300005445 Bacteria 4127
40 Ga0070665_100006357 3300005548 Bacteria 12049
41 Ga0070665_100015502 3300005548 Bacteria 7656
42 Ga0070665_100016546 3300005548 Bacteria 7395
43 Ga0070665_100302856 3300005548 Bacteria 1601
44 Ga0068855_100035032 3300005563 Bacteria 5981
45 Ga0068857_100060958 3300005577 Bacteria 3352
46 Ga0068854_100001444 3300005578 Bacteria 14386
47 Ga0068854_100002421 3300005578 Bacteria 11519
48 Ga0068856_100047956 3300005614 Bacteria 4208
49 Ga0068852_100000930 3300005616 Bacteria 19327
50 Ga0068852_100082969 3300005616 Bacteria 2850
51 Ga0068852_100104701 3300005616 Bacteria 2562
52 Ga0068852_100374390 3300005616 Bacteria 1396
53 Ga0068852_100545479 3300005616 Bacteria 1159
54 Ga0068859_100000396 3300005617 Bacteria 43397
55 Ga0068859_100633207 3300005617 Bacteria 1162
56 Ga0068864_100000851 3300005618 Bacteria 25734
57 Ga0068864_100040114 3300005618 Bacteria 4005
58 Ga0068861_100006849 3300005719 Bacteria 7783
59 Ga0068863_100000379 3300005841 Bacteria 45297
60 Ga0068863_100004185 3300005841 Bacteria 14245
61 Ga0068863_100005928 3300005841 Bacteria 11986
62 Ga0068863_100029590 3300005841 Bacteria 5228
63 Ga0068863_100058938 3300005841 Bacteria 3633
64 Ga0068863_100153032 3300005841 Bacteria 2207
65 Ga0068858_100004631 3300005842 Bacteria 13468
66 Ga0068858_100034203 3300005842 Bacteria 4713
67 Ga0068858_100058614 3300005842 Bacteria 3561
68 Ga0068858_100139334 3300005842 Bacteria 2277
69 Ga0068860_100001052 3300005843 Bacteria 30421
70 Ga0068860_100008925 3300005843 Bacteria 9990
71 Ga0068860_100013792 3300005843 Bacteria 7924
72 Ga0068860_100056345 3300005843 Bacteria 3737
73 Ga0068860_100068926 3300005843 Bacteria 3361
74 Ga0068860_100076591 3300005843 Bacteria 3181
75 Ga0068860_100082088 3300005843 Bacteria 3066
76 Ga0068860_100231774 3300005843 Bacteria 1795
77 Ga0068862_100000334 3300005844 Bacteria 51308
78 Ga0068862_100004394 3300005844 Bacteria 11911
79 Ga0068862_100021666 3300005844 Bacteria 5373
80 Ga0068862_100030947 3300005844 Bacteria 4513
81 Ga0068862_100061546 3300005844 Bacteria 3227
82 Ga0068862_100163232 3300005844 Bacteria 1990
83 Ga0075365_10014828 3300006038 Bacteria 4696
84 Ga0075368_10000517 3300006042 Bacteria 11528
85 Ga0075364_10001169 3300006051 Bacteria 14073
86 Ga0075432_10000204 3300006058 Bacteria 15535
87 Ga0075362_10000119 3300006177 Bacteria 22052
88 Ga0075362_10001592 3300006177 Bacteria 7357
89 Ga0075362_10059809 3300006177 Bacteria 1721
90 Ga0075369_10000252 3300006186 Bacteria 15880
91 Ga0075366_10000014 3300006195 Bacteria 66940
92 Ga0075366_10009771 3300006195 Bacteria 5364
93 Ga0075370_10000141 3300006353 Bacteria 24359
94 Ga0075370_10002146 3300006353 Bacteria 9020
95 Ga0075370_10040213 3300006353 Unclassified 2637
96 Ga0097620_100000396 3300006931 Bacteria 43397
97 Ga0097620_100633101 3300006931 Bacteria 1162
98 Ga0105251_10007884 3300009011 Bacteria 6473
99 Ga0105251_10025111 3300009011 Bacteria 3052
100 Ga0105251_10072684 3300009011 Bacteria 1599
101 Ga0105250_10011967 3300009092 Bacteria 3593
102 Ga0105240_10004776 3300009093 Bacteria 20437
103 Ga0105247_10001991 3300009101 Bacteria 14165
104 Ga0105247_10033171 3300009101 Bacteria 3139
105 Ga0105247_10057092 3300009101 Bacteria 2412
106 Ga0105247_10230802 3300009101 Bacteria 1257
107 Ga0114129_10623015 3300009147 Bacteria 1395
108 Ga0105241_10391686 3300009174 Bacteria 1217
109 Ga0105248_10015716 3300009177 Bacteria 8343
110 Ga0105248_10063939 3300009177 Bacteria 4131
111 Ga0105248_10089847 3300009177 Bacteria 3458
112 Ga0105248_10100358 3300009177 Bacteria 3262
113 Ga0105248_10127757 3300009177 Bacteria 2868
114 Ga0105248_10372422 3300009177 Bacteria 1608
115 Ga0105238_10314466 3300009551 Bacteria 1551
116 Ga0105249_10001016 3300009553 Bacteria 24808
117 Ga0163162_10011201 3300013306 Bacteria 8741
118 Ga0163162_10015630 3300013306 Bacteria 7417
119 Ga0163162_10035897 3300013306 Bacteria 4938
120 Ga0163163_10079458 3300014325 Bacteria 3278
121 Ga0157380_10095054 3300014326 Bacteria 2468
122 Ga0157379_10034960 3300014968 Bacteria 4479
123 Ga0163161_10003037 3300017792 Bacteria 11854
124 Ga0209050_1000254 3300025298 Bacteria 114395
125 Ga0207697_10002363 3300025315 Bacteria 9831
126 Ga0207696_1015530 3300025711 Bacteria 2579
127 Ga0207713_1002311 3300025735 Bacteria 14016
128 Ga0207713_1004651 3300025735 Bacteria 8860
129 Ga0207710_10002592 3300025900 Bacteria 8350
130 Ga0207710_10106313 3300025900 Bacteria 1329
131 Ga0207680_10000044 3300025903 Bacteria 64236
132 Ga0207680_10001705 3300025903 Bacteria 10357
133 Ga0207680_10262507 3300025903 Bacteria 1196
134 Ga0207705_10000621 3300025909 Bacteria 29636
135 Ga0207695_10003649 3300025913 Bacteria 21496
136 Ga0207681_10000002 3300025923 Bacteria 985597
137 Ga0207681_10000147 3300025923 Bacteria 58825
138 Ga0207681_10000558 3300025923 Bacteria 25541
139 Ga0207681_10001210 3300025923 Bacteria 16603
140 Ga0207681_10003505 3300025923 Bacteria 9772
141 Ga0207681_10237504 3300025923 Bacteria 1417
142 Ga0207694_10212053 3300025924 Bacteria 1578
143 Ga0207650_10023046 3300025925 Bacteria 4413
144 Ga0207650_10027366 3300025925 Bacteria 4081
145 Ga0207650_10164322 3300025925 Bacteria 1760
146 Ga0207644_10000002 3300025931 Bacteria 942221
147 Ga0207644_10000005 3300025931 Bacteria 441948
148 Ga0207644_10002420 3300025931 Bacteria 12027
149 Ga0207644_10013194 3300025931 Bacteria 5504
150 Ga0207644_10125636 3300025931 Bacteria 1958
151 Ga0207711_10037445 3300025941 Bacteria 4120
152 Ga0207711_10189633 3300025941 Bacteria 1873
153 Ga0207711_10286695 3300025941 Bacteria 1517
154 Ga0207711_10681518 3300025941 Bacteria 959
155 Ga0207667_10002049 3300025949 Bacteria 25269
156 Ga0207667_10010539 3300025949 Bacteria 10800
157 Ga0207712_10004295 3300025961 Bacteria 8996
158 Ga0207668_10001408 3300025972 Bacteria 14151
159 Ga0207668_10001703 3300025972 Bacteria 12868
160 Ga0207668_10093767 3300025972 Bacteria 2212
161 Ga0207668_10401655 3300025972 Bacteria 1159
162 Ga0207640_10000775 3300025981 Bacteria 18166
163 Ga0207640_10005493 3300025981 Bacteria 6910
164 Ga0207658_10000292 3300025986 Bacteria 52512
165 Ga0207658_10000526 3300025986 Bacteria 34963
166 Ga0207658_10002344 3300025986 Bacteria 13913
167 Ga0207658_10002362 3300025986 Bacteria 13864
168 Ga0207658_10005292 3300025986 Bacteria 8873
169 Ga0207658_10005863 3300025986 Bacteria 8402
170 Ga0207658_10362853 3300025986 Bacteria 1264
171 Ga0207703_10002142 3300026035 Bacteria 17354
172 Ga0207703_10005695 3300026035 Bacteria 9996
173 Ga0207702_10023174 3300026078 Bacteria 5150
174 Ga0207641_10000438 3300026088 Bacteria 47782
175 Ga0207641_10001778 3300026088 Bacteria 20758
176 Ga0207641_10003799 3300026088 Bacteria 13248
177 Ga0207641_10004367 3300026088 Bacteria 12250
178 Ga0207641_10005156 3300026088 Bacteria 11180
179 Ga0207641_10060794 3300026088 Bacteria 3221
180 Ga0207676_10012126 3300026095 Bacteria 6170
181 Ga0207674_10067682 3300026116 Bacteria 3595
182 Ga0207674_10076709 3300026116 Bacteria 3349
183 Ga0207674_10274407 3300026116 Bacteria 1634
184 Ga0207675_100001688 3300026118 Bacteria 22095
185 Ga0207698_10000005 3300026142 Bacteria 295687
186 Ga0207698_10061701 3300026142 Bacteria 2923
187 Ga0207698_10230851 3300026142 Bacteria 1680
188 Ga0209813_10000130 3300027866 Bacteria 27121
189 Ga0207428_10011309 3300027907 Bacteria 7899
190 Ga0268266_10000479 3300028379 Bacteria 57570
191 Ga0268266_10009632 3300028379 Bacteria 8496
192 Ga0268266_10041830 3300028379 Bacteria 3912
193 Ga0268266_10443285 3300028379 Bacteria 1233
194 Ga0268265_10003908 3300028380 Bacteria 10504
195 Ga0268265_10023199 3300028380 Bacteria 4371
196 Ga0268265_10098286 3300028380 Bacteria 2357
197 Ga0268265_10163018 3300028380 Bacteria 1896
198 Ga0268265_10259287 3300028380 Bacteria 1544
199 Ga0268264_10000010 3300028381 Bacteria 596543
200 Ga0268264_10000253 3300028381 Bacteria 98587
201 Ga0268264_10016039 3300028381 Bacteria 6138
202 Ga0268264_10028521 3300028381 Bacteria 4566
203 Ga0268264_10034395 3300028381 Bacteria 4168
204 Ga0268264_10051533 3300028381 Bacteria 3430
205 Ga0268264_10055121 3300028381 Bacteria 3322
206 Ga0268264_10057413 3300028381 Bacteria 3256
207 Ga0307408_100018312 3300031548 Bacteria 4700
208 Ga0307408_100071846 3300031548 Bacteria 2560
209 Ga0307405_10003241 3300031731 Bacteria 7420
210 Ga0307405_10011894 3300031731 Bacteria 4582
211 Ga0307405_10164928 3300031731 Bacteria 1574
212 Ga0307413_10101905 3300031824 Bacteria 1899
213 Ga0307410_10025917 3300031852 Bacteria 3684
214 Ga0307406_10012814 3300031901 Bacteria 4788
215 Ga0307406_10071073 3300031901 Bacteria 2280
216 Ga0307407_10041460 3300031903 Bacteria 2574
217 Ga0307407_10361215 3300031903 Bacteria 1031
218 Ga0307412_10000511 3300031911 Bacteria 23159
219 Ga0307412_10013557 3300031911 Bacteria 4783
220 Ga0307412_10043728 3300031911 Bacteria 2919
221 Ga0307409_100102026 3300031995 Bacteria 2382
222 Ga0307416_100010697 3300032002 Bacteria 6079
223 Ga0307416_100056215 3300032002 Bacteria 3174
224 Ga0307416_100491420 3300032002 Bacteria 1289
225 Ga0307414_10000068 3300032004 Bacteria 100925
226 Ga0307414_10001771 3300032004 Bacteria 11184
227 Ga0307414_10034789 3300032004 Bacteria 3345
228 Ga0307414_10046979 3300032004 Bacteria 2968
229 Ga0307411_10031760 3300032005 Bacteria 3254
230 Ga0307415_100073658 3300032126 Bacteria 2410
231 Ga0395905_0376033 3300037471 Unclassified 1314
232 Ga0436364_0735490 3300037853 Bacteria 1528
233 Ga0453684_0115209 3300044712 Bacteria 3257
234 Ga0451576_0000023 3300045051 Bacteria 477965
235 Ga0451576_0043465 3300045051 Bacteria 4741
236 Ga0495627_000230 3300046453 Bacteria 59380
237 Ga0495638_0039930 3300046460 Bacteria 2976
238 Ga0495638_0053047 3300046460 Unclassified 2524
239 Ga0495650_0000926 3300046471 Bacteria 34330
240 Ga0495650_0102713 3300046471 Bacteria 1071
241 Ga0495596_0000314 3300046500 Bacteria 31893
242 Ga0495583_0014344 3300046506 Bacteria 4377
243 Ga0495583_0078505 3300046506 Bacteria 1438
244 Ga0495606_0014049 3300046507 Bacteria 6274
245 Ga0495606_0028439 3300046507 Bacteria 3944
246 Ga0495610_0000031 3300046512 Bacteria 254606
247 Ga0495610_0000083 3300046512 Bacteria 112946
248 Ga0495610_0002416 3300046512 Bacteria 15729
249 Ga0495610_0005332 3300046512 Bacteria 9174
250 Ga0495616_0000640 3300046513 Bacteria 26130
251 Ga0495620_0026428 3300046515 Bacteria 2730
252 Ga0495632_0001835 3300046519 Bacteria 17118
253 Ga0495643_0000080 3300046522 Bacteria 161872
254 Ga0495643_0007996 3300046522 Bacteria 6745
255 Ga0495643_0078546 3300046522 Bacteria 1722
256 Ga0495643_0088461 3300046522 Bacteria 1601
257 Ga0495654_0060968 3300046530 Bacteria 1812
258 Ga0495654_0066698 3300046530 Bacteria 1715
259 Ga0495598_0005468 3300046537 Bacteria 2818
260 Ga0495622_0030983 3300046557 Bacteria 2500
261 Ga0495668_0005854 3300046616 Bacteria 8203
262 Ga0495668_0030518 3300046616 Bacteria 3043
263 Ga0495625_0029402 3300046660 Unclassified 4110
264 Ga0495625_0030330 3300046660 Bacteria 4037
265 Ga0495625_0035498 3300046660 Bacteria 3674
266 Ga0495661_0100030 3300046665 Bacteria 1634
267 Ga0495671_0033775 3300046692 Bacteria 2604
268 Ga0495671_0081161 3300046692 Bacteria 1589
269 Ga0495681_0000211 3300047470 Bacteria 48554
270 Ga0495681_0000279 3300047470 Bacteria 40888
271 Ga0495686_0049097 3300047472 Bacteria 2656
272 Ga0495615_0000156 3300048090 Bacteria 17268
273 Ga0495626_0000139 3300048091 Bacteria 92719
274 Ga0496101_0077652 3300048904 Bacteria 2447
275 Ga0496102_0000445 3300048905 Bacteria 47017
276 Ga0496102_0096607 3300048905 Bacteria 2739
277 Ga0496103_0000021 3300048906 Bacteria 229062
278 Ga0496103_0011806 3300048906 Bacteria 5182
279 Ga0496103_0047954 3300048906 Bacteria 2639
280 Ga0496103_0048457 3300048906 Bacteria 2626
281 Ga0496104_0011573 3300048907 Bacteria 7905
282 Ga0496104_0049835 3300048907 Bacteria 3949
283 Ga0496104_0074856 3300048907 Bacteria 3223
284 Ga0496105_0000913 3300048908 Bacteria 20104
285 Ga0496105_0061591 3300048908 Bacteria 3096
286 Ga0496107_0034325 3300048910 Bacteria 3634
287 Ga0496108_0115627 3300048911 Bacteria 2297
288 Ga0496109_0484788 3300048912 Bacteria 1167
289 Ga0496110_0034645 3300048913 Bacteria 4375
290 Ga0496112_0014171 3300048915 Bacteria 7387
291 Ga0496112_0186635 3300048915 Bacteria 2036
292 Ga0496113_0000070 3300048916 Bacteria 44958
293 Ga0496113_0033734 3300048916 Bacteria 3729
294 Ga0496113_0250221 3300048916 Bacteria 1415
295 Ga0496116_0000045 3300048919 Bacteria 324307
296 Ga0496117_0000642 3300048920 Bacteria 56330
297 Ga0496118_0013955 3300048921 Bacteria 7555
298 Ga0496118_0016614 3300048921 Bacteria 6744
299 Ga0496118_0037393 3300048921 Bacteria 3907
300 Ga0496119_0007406 3300048922 Bacteria 9895
301 Ga0496120_0035285 3300048923 Bacteria 2989
302 Ga0496121_0000022 3300048924 Bacteria 472849
303 Ga0496121_0000136 3300048924 Bacteria 165350
304 Ga0496121_0001923 3300048924 Bacteria 33167
305 Ga0496121_0006668 3300048924 Bacteria 14201
306 Ga0496122_0000083 3300048925 Bacteria 208744
307 Ga0496122_0001043 3300048925 Bacteria 48546
308 Ga0496122_0006036 3300048925 Bacteria 14129
309 Ga0496122_0043301 3300048925 Bacteria 3528
310 Ga0496123_0000097 3300048926 Bacteria 173894
311 Ga0496123_0000785 3300048926 Bacteria 51254
312 Ga0496123_0000952 3300048926 Bacteria 45010
313 Ga0496123_0002132 3300048926 Bacteria 25323
314 Ga0496123_0156082 3300048926 Bacteria 1223
315 Ga0496124_0032837 3300048927 Bacteria 4577
316 Ga0496124_0057240 3300048927 Bacteria 3286
317 Ga0496124_0142987 3300048927 Bacteria 1885
318 Ga0496125_0001024 3300048928 Bacteria 43453
319 Ga0496125_0010033 3300048928 Bacteria 9620
320 Ga0496126_0000367 3300048929 Bacteria 93102
321 Ga0496126_0002845 3300048929 Bacteria 22641
322 Ga0496126_0010216 3300048929 Bacteria 9869
323 Ga0496126_0115372 3300048929 Bacteria 2335
324 Ga0496126_0185338 3300048929 Bacteria 1765
325 Ga0501034_0021955 3300049571 Bacteria 6504
326 Ga0501034_0057984 3300049571 Bacteria 3893
327 Ga0501042_0229049 3300049578 Bacteria 1340
328 Ga0501047_0437490 3300049581 Bacteria 1138
329 Ga0501223_000086 3300049663 Bacteria 27446
330 Ga0501223_000528 3300049663 Bacteria 9203
331 Ga0501224_000024 3300049664 Bacteria 61321
332 Ga0501233_000098 3300049668 Bacteria 11743
333 Ga0501225_0000017 3300049705 Bacteria 61517
334 Ga0501225_0000034 3300049705 Bacteria 46629
335 Ga0501044_0000826 3300049823 Bacteria 37298
336 Ga0501226_000074 3300049853 Bacteria 30380
337 nmdc:mga03683_10235_c1 3300050489 Bacteria 3359
338 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
339 nmdc:mga03n38_1684_c1 3300050490 Bacteria 6502
340 nmdc:mga03n38_26325_c1 3300050490 Bacteria 2401
341 nmdc:mga00v17_13633_c2 3300050491 Bacteria 2758
342 nmdc:mga00v17_282276_c1 3300050491 Bacteria 1078
343 nmdc:mga00v17_687_c1 3300050491 Bacteria 18636
344 nmdc:mga0yw44_13652_c1 3300050492 Bacteria 4284
345 nmdc:mga0k408_14662_c1 3300050493 Bacteria 4323
346 nmdc:mga0k408_50018_c1 3300050493 Bacteria 2419
347 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
348 nmdc:mga06z11_4111_c1 3300050494 Bacteria 5686
349 nmdc:mga04h51_269_c1 3300050495 Bacteria 13325
350 nmdc:mga07m45_1567_c1 3300050496 Bacteria 10524
351 nmdc:mga07m45_35992_c1 3300050496 Bacteria 2755
352 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
353 nmdc:mga07m45_90_c1 3300050496 Bacteria 34935
354 nmdc:mga05p37_482165_c1 3300050507 Bacteria 1428
355 nmdc:mga0sz30_111_c1 3300050516 Bacteria 15885
356 nmdc:mga0sz30_7486_c1 3300050516 Bacteria 4096
357 Ga0500643_000001 3300053087 Bacteria 1440111
358 Ga0500643_000550 3300053087 Bacteria 26088
359 Ga0500643_013655 3300053087 Bacteria 2859
360 Ga0500647_0042720 3300053091 Bacteria 2177
361 Ga0500556_0000088 3300053104 Bacteria 86055
362 Ga0500562_029692 3300053108 Bacteria 1439
363 Ga0500594_0000471 3300053118 Bacteria 8858
364 Ga0500594_0061658 3300053118 Bacteria 1083
365 Ga0500595_025639 3300053119 Bacteria 2041
366 Ga0500607_000107 3300053121 Bacteria 64565
367 Ga0500607_010436 3300053121 Bacteria 5525
368 Ga0500608_000157 3300053122 Bacteria 28193
369 Ga0500618_003314 3300053125 Bacteria 5580
370 Ga0500642_0000001 3300053130 Bacteria 1468402
371 Ga0500559_0001127 3300053136 Bacteria 16082
372 Ga0500559_0009527 3300053136 Bacteria 4197
373 Ga0500559_0011113 3300053136 Bacteria 3854
374 Ga0500559_0027410 3300053136 Bacteria 2431
375 Ga0500564_001472 3300053138 Bacteria 8150
376 Ga0500588_0028228 3300053146 Bacteria 1589
377 Ga0500590_000969 3300053148 Bacteria 11080
378 Ga0500604_0010825 3300053151 Bacteria 2443
379 Ga0500616_0010975 3300053153 Bacteria 5392
380 Ga0500622_0000136 3300053156 Bacteria 78059
381 Ga0500627_0012993 3300053158 Bacteria 3140
382 Ga0500637_0001771 3300053178 Bacteria 9325
383 Ga0500567_010202 3300053723 Bacteria 4489
384 Ga0500625_000019 3300053729 Bacteria 93445
385 Ga0500645_000724 3300053730 Bacteria 20390
386 Ga0500645_004057 3300053730 Bacteria 5743
387 Ga0500645_008661 3300053730 Bacteria 3454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0000083 Ga0495610_0000083_74209_75087 242
2 3300046665 Ga0495661_0100030 Ga0495661_0100030_68_946 242
3 3300047470 Ga0495681_0000279 Ga0495681_0000279_21339_22217 242
4 3300047472 Ga0495686_0049097 Ga0495686_0049097_1500_2378 242
5 3300049663 Ga0501223_000086 Ga0501223_000086_14473_15354 253
6 3300049705 Ga0501225_0000034 Ga0501225_0000034_14785_15666 253
7 3300005353 Ga0070669_100254893 Ga0070669_1002548932 256
8 3300014326 Ga0157380_10095054 Ga0157380_100950541 256
9 3300025923 Ga0207681_10237504 Ga0207681_102375042 256
10 3300046692 Ga0495671_0081161 Ga0495671_0081161_16_789 257
11 3300005289 Ga0065704_10002033 Ga0065704_100020334 259
12 3300005616 Ga0068852_100545479 Ga0068852_1005454792 259
13 3300006177 Ga0075362_10000119 Ga0075362_1000011920 259
14 3300006186 Ga0075369_10000252 Ga0075369_1000025214 259
15 3300006195 Ga0075366_10000014 Ga0075366_1000001446 259
16 3300006353 Ga0075370_10000141 Ga0075370_1000014115 259
17 3300031548 Ga0307408_100071846 Ga0307408_1000718462 259
18 3300031731 Ga0307405_10003241 Ga0307405_1000324110 259
19 3300031852 Ga0307410_10025917 Ga0307410_100259173 259
20 3300031901 Ga0307406_10012814 Ga0307406_100128142 259
21 3300031903 Ga0307407_10041460 Ga0307407_100414601 259
22 3300031911 Ga0307412_10043728 Ga0307412_100437282 259
23 3300031995 Ga0307409_100102026 Ga0307409_1001020261 259
24 3300032002 Ga0307416_100491420 Ga0307416_1004914202 259
25 3300032004 Ga0307414_10046979 Ga0307414_100469792 259
26 3300032005 Ga0307411_10031760 Ga0307411_100317604 259
27 3300050489 nmdc:mga03683_32_c1 nmdc:mga03683_32_c1_17825_18709 259
28 3300050490 nmdc:mga03n38_1684_c1 nmdc:mga03n38_1684_c1_4143_5027 259
29 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_103079_103963 259
30 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_96540_97424 259
31 3300050516 nmdc:mga0sz30_111_c1 nmdc:mga0sz30_111_c1_1693_2577 259
32 3300025903 Ga0207680_10262507 Ga0207680_102625072 265
33 3300049571 Ga0501034_0057984 Ga0501034_0057984_2999_3859 265
34 iso_pu_bacteria 2896184354 2896185310 272
35 3300005331 Ga0070670_100008621 Ga0070670_1000086217 274
36 3300005335 Ga0070666_10002955 Ga0070666_1000295510 274
37 3300005335 Ga0070666_10004087 Ga0070666_100040874 274
38 3300005347 Ga0070668_100009943 Ga0070668_1000099436 274
39 3300005347 Ga0070668_100010875 Ga0070668_1000108752 274
40 3300005353 Ga0070669_100000008 Ga0070669_100000008128 274
41 3300005353 Ga0070669_100001462 Ga0070669_1000014628 274
42 3300005355 Ga0070671_100000010 Ga0070671_100000010143 274
43 3300005367 Ga0070667_100000690 Ga0070667_10000069012 274
44 3300005367 Ga0070667_100012385 Ga0070667_1000123852 274
45 3300005440 Ga0070705_100083318 Ga0070705_1000833182 274
46 3300005445 Ga0070708_100039546 Ga0070708_1000395464 274
47 3300005548 Ga0070665_100302856 Ga0070665_1003028562 274
48 3300005617 Ga0068859_100000396 Ga0068859_10000039616 274
49 3300005618 Ga0068864_100000851 Ga0068864_1000008514 274
50 3300005719 Ga0068861_100006849 Ga0068861_1000068494 274
51 3300005841 Ga0068863_100000379 Ga0068863_10000037911 274
52 3300005841 Ga0068863_100029590 Ga0068863_1000295904 274
53 3300005842 Ga0068858_100004631 Ga0068858_1000046313 274
54 3300005843 Ga0068860_100001052 Ga0068860_10000105212 274
55 3300005843 Ga0068860_100068926 Ga0068860_1000689262 274
56 3300005844 Ga0068862_100000334 Ga0068862_10000033425 274
57 3300005844 Ga0068862_100061546 Ga0068862_1000615462 274
58 3300006353 Ga0075370_10040213 Ga0075370_100402132 274
59 3300006931 Ga0097620_100000396 Ga0097620_10000039625 274
60 3300009101 Ga0105247_10001991 Ga0105247_100019918 274
61 3300009177 Ga0105248_10015716 Ga0105248_100157168 274
62 3300009553 Ga0105249_10001016 Ga0105249_1000101610 274
63 3300013306 Ga0163162_10015630 Ga0163162_100156305 274
64 3300014325 Ga0163163_10079458 Ga0163163_100794584 274
65 3300014968 Ga0157379_10034960 Ga0157379_100349604 274
66 3300025315 Ga0207697_10002363 Ga0207697_100023634 274
67 3300025900 Ga0207710_10002592 Ga0207710_100025922 274
68 3300025903 Ga0207680_10000044 Ga0207680_1000004417 274
69 3300025903 Ga0207680_10001705 Ga0207680_1000170510 274
70 3300025923 Ga0207681_10000002 Ga0207681_10000002221 274
71 3300025923 Ga0207681_10003505 Ga0207681_100035058 274
72 3300025925 Ga0207650_10023046 Ga0207650_100230461 274
73 3300025925 Ga0207650_10164322 Ga0207650_101643221 274
74 3300025931 Ga0207644_10000002 Ga0207644_10000002220 274
75 3300025941 Ga0207711_10037445 Ga0207711_100374452 274
76 3300025961 Ga0207712_10004295 Ga0207712_100042955 274
77 3300025972 Ga0207668_10001408 Ga0207668_100014088 274
78 3300025972 Ga0207668_10001703 Ga0207668_1000170310 274
79 3300025986 Ga0207658_10000292 Ga0207658_1000029216 274
80 3300025986 Ga0207658_10000526 Ga0207658_100005267 274
81 3300026035 Ga0207703_10005695 Ga0207703_100056954 274
82 3300026088 Ga0207641_10000438 Ga0207641_1000043811 274
83 3300026088 Ga0207641_10001778 Ga0207641_100017784 274
84 3300026095 Ga0207676_10012126 Ga0207676_100121264 274
85 3300026118 Ga0207675_100001688 Ga0207675_10000168819 274
86 3300028379 Ga0268266_10443285 Ga0268266_104432851 274
87 3300028380 Ga0268265_10003908 Ga0268265_100039087 274
88 3300028380 Ga0268265_10098286 Ga0268265_100982862 274
89 3300028381 Ga0268264_10000010 Ga0268264_10000010438 274
90 3300028381 Ga0268264_10016039 Ga0268264_100160396 274
91 3300031548 Ga0307408_100018312 Ga0307408_1000183122 274
92 3300031911 Ga0307412_10000511 Ga0307412_1000051111 274
93 3300032002 Ga0307416_100010697 Ga0307416_1000106972 274
94 3300032004 Ga0307414_10000068 Ga0307414_1000006870 274
95 3300032004 Ga0307414_10001771 Ga0307414_1000177112 274
96 3300037471 Ga0395905_0376033 Ga0395905_0376033_416_1294 274
97 3300037853 Ga0436364_0735490 Ga0436364_0735490_428_1315 274
98 3300045051 Ga0451576_0000023 Ga0451576_0000023_427261_428100 274
99 3300046460 Ga0495638_0053047 Ga0495638_0053047_613_1491 274
100 3300046471 Ga0495650_0102713 Ga0495650_0102713_27_905 274
101 3300046513 Ga0495616_0000640 Ga0495616_0000640_13031_13909 274
102 3300046557 Ga0495622_0030983 Ga0495622_0030983_79_1002 274
103 3300046616 Ga0495668_0005854 Ga0495668_0005854_4194_5072 274
104 3300046616 Ga0495668_0030518 Ga0495668_0030518_405_1283 274
105 3300046660 Ga0495625_0029402 Ga0495625_0029402_2715_3593 274
106 3300046692 Ga0495671_0033775 Ga0495671_0033775_440_1363 274
107 3300048906 Ga0496103_0048457 Ga0496103_0048457_737_1615 274
108 3300048925 Ga0496122_0000083 Ga0496122_0000083_160545_161423 274
109 3300048926 Ga0496123_0000097 Ga0496123_0000097_74738_75616 274
110 3300048929 Ga0496126_0185338 Ga0496126_0185338_350_1228 274
111 3300049571 Ga0501034_0021955 Ga0501034_0021955_1392_2270 274
112 3300049663 Ga0501223_000528 Ga0501223_000528_1491_2369 274
113 3300049664 Ga0501224_000024 Ga0501224_000024_35721_36599 274
114 3300049668 Ga0501233_000098 Ga0501233_000098_1359_2237 274
115 3300049705 Ga0501225_0000017 Ga0501225_0000017_35945_36823 274
116 3300049853 Ga0501226_000074 Ga0501226_000074_24702_25580 274
117 3300053087 Ga0500643_000550 Ga0500643_000550_20725_21603 274
118 3300053104 Ga0500556_0000088 Ga0500556_0000088_32711_33589 274
119 3300053118 Ga0500594_0000471 Ga0500594_0000471_3838_4761 274
120 3300053130 Ga0500642_0000001 Ga0500642_0000001_1418041_1418919 274
121 3300053136 Ga0500559_0009527 Ga0500559_0009527_2507_3385 274
122 3300053151 Ga0500604_0010825 Ga0500604_0010825_1192_2070 274
123 3300053158 Ga0500627_0012993 Ga0500627_0012993_209_1087 274
124 3300053730 Ga0500645_000724 Ga0500645_000724_10620_11498 274
125 3300025931 Ga0207644_10125636 Ga0207644_101256362 275
126 3300050491 nmdc:mga00v17_282276_c1 nmdc:mga00v17_282276_c1_44_925 275
127 iso_pu_bacteria 2510917021 2511130841 275
128 iso_pu_bacteria 8054302542 8054307405 275
129 2162886007 SwRhRL2b_contig_1584582 SwRhRL2b_0526.00003950 276
130 2162886007 SwRhRL2b_contig_3436808 SwRhRL2b_0200.00004640 276
131 3300002239 JGI24034J26672_10018358 JGI24034J26672_100183581 276
132 3300005289 Ga0065704_10000204 Ga0065704_10000204205 276
133 3300005289 Ga0065704_10003890 Ga0065704_100038905 276
134 3300005289 Ga0065704_10148997 Ga0065704_101489971 276
135 3300005295 Ga0065707_10085682 Ga0065707_100856825 276
136 3300005327 Ga0070658_10086342 Ga0070658_100863423 276
137 3300005331 Ga0070670_100036706 Ga0070670_1000367064 276
138 3300005331 Ga0070670_100052945 Ga0070670_1000529452 276
139 3300005335 Ga0070666_10024376 Ga0070666_100243764 276
140 3300005347 Ga0070668_100013611 Ga0070668_1000136112 276
141 3300005347 Ga0070668_100015512 Ga0070668_1000155122 276
142 3300005347 Ga0070668_100143234 Ga0070668_1001432341 276
143 3300005353 Ga0070669_100000620 Ga0070669_10000062023 276
144 3300005353 Ga0070669_100001027 Ga0070669_10000102713 276
145 3300005353 Ga0070669_100005271 Ga0070669_1000052715 276
146 3300005355 Ga0070671_100000062 Ga0070671_10000006265 276
147 3300005355 Ga0070671_100002834 Ga0070671_1000028342 276
148 3300005355 Ga0070671_100202072 Ga0070671_1002020722 276
149 3300005367 Ga0070667_100001088 Ga0070667_1000010889 276
150 3300005367 Ga0070667_100003291 Ga0070667_10000329113 276
151 3300005367 Ga0070667_100005409 Ga0070667_1000054092 276
152 3300005367 Ga0070667_100030692 Ga0070667_1000306923 276
153 3300005367 Ga0070667_100034934 Ga0070667_1000349342 276
154 3300005548 Ga0070665_100006357 Ga0070665_10000635713 276
155 3300005548 Ga0070665_100015502 Ga0070665_1000155024 276
156 3300005548 Ga0070665_100016546 Ga0070665_1000165465 276
157 3300005563 Ga0068855_100035032 Ga0068855_1000350325 276
158 3300005577 Ga0068857_100060958 Ga0068857_1000609584 276
159 3300005578 Ga0068854_100001444 Ga0068854_10000144411 276
160 3300005578 Ga0068854_100002421 Ga0068854_10000242112 276
161 3300005614 Ga0068856_100047956 Ga0068856_1000479564 276
162 3300005616 Ga0068852_100000930 Ga0068852_10000093020 276
163 3300005616 Ga0068852_100082969 Ga0068852_1000829692 276
164 3300005616 Ga0068852_100104701 Ga0068852_1001047014 276
165 3300005616 Ga0068852_100374390 Ga0068852_1003743902 276
166 3300005617 Ga0068859_100633207 Ga0068859_1006332072 276
167 3300005618 Ga0068864_100040114 Ga0068864_1000401145 276
168 3300005841 Ga0068863_100004185 Ga0068863_1000041854 276
169 3300005841 Ga0068863_100005928 Ga0068863_1000059288 276
170 3300005841 Ga0068863_100058938 Ga0068863_1000589384 276
171 3300005841 Ga0068863_100153032 Ga0068863_1001530322 276
172 3300005842 Ga0068858_100034203 Ga0068858_1000342032 276
173 3300005842 Ga0068858_100058614 Ga0068858_1000586145 276
174 3300005842 Ga0068858_100139334 Ga0068858_1001393342 276
175 3300005843 Ga0068860_100008925 Ga0068860_10000892510 276
176 3300005843 Ga0068860_100013792 Ga0068860_1000137923 276
177 3300005843 Ga0068860_100056345 Ga0068860_1000563454 276
178 3300005843 Ga0068860_100076591 Ga0068860_1000765914 276
179 3300005843 Ga0068860_100082088 Ga0068860_1000820881 276
180 3300005843 Ga0068860_100231774 Ga0068860_1002317741 276
181 3300005844 Ga0068862_100004394 Ga0068862_1000043943 276
182 3300005844 Ga0068862_100021666 Ga0068862_1000216664 276
183 3300005844 Ga0068862_100030947 Ga0068862_1000309472 276
184 3300005844 Ga0068862_100163232 Ga0068862_1001632323 276
185 3300006038 Ga0075365_10014828 Ga0075365_100148284 276
186 3300006042 Ga0075368_10000517 Ga0075368_100005172 276
187 3300006051 Ga0075364_10001169 Ga0075364_100011691 276
188 3300006058 Ga0075432_10000204 Ga0075432_100002047 276
189 3300006177 Ga0075362_10001592 Ga0075362_100015926 276
190 3300006177 Ga0075362_10059809 Ga0075362_100598093 276
191 3300006195 Ga0075366_10009771 Ga0075366_100097716 276
192 3300006353 Ga0075370_10002146 Ga0075370_100021469 276
193 3300006931 Ga0097620_100633101 Ga0097620_1006331012 276
194 3300009011 Ga0105251_10007884 Ga0105251_100078843 276
195 3300009011 Ga0105251_10025111 Ga0105251_100251113 276
196 3300009011 Ga0105251_10072684 Ga0105251_100726842 276
197 3300009092 Ga0105250_10011967 Ga0105250_100119672 276
198 3300009093 Ga0105240_10004776 Ga0105240_1000477618 276
199 3300009101 Ga0105247_10033171 Ga0105247_100331715 276
200 3300009101 Ga0105247_10057092 Ga0105247_100570922 276
201 3300009101 Ga0105247_10230802 Ga0105247_102308022 276
202 3300009147 Ga0114129_10623015 Ga0114129_106230152 276
203 3300009174 Ga0105241_10391686 Ga0105241_103916861 276
204 3300009177 Ga0105248_10063939 Ga0105248_100639393 276
205 3300009177 Ga0105248_10089847 Ga0105248_100898474 276
206 3300009177 Ga0105248_10100358 Ga0105248_101003584 276
207 3300009177 Ga0105248_10127757 Ga0105248_101277574 276
208 3300009177 Ga0105248_10372422 Ga0105248_103724222 276
209 3300009551 Ga0105238_10314466 Ga0105238_103144661 276
210 3300013306 Ga0163162_10011201 Ga0163162_100112012 276
211 3300013306 Ga0163162_10035897 Ga0163162_100358973 276
212 3300017792 Ga0163161_10003037 Ga0163161_100030377 276
213 3300025298 Ga0209050_1000254 Ga0209050_100025498 276
214 3300025711 Ga0207696_1015530 Ga0207696_10155302 276
215 3300025735 Ga0207713_1002311 Ga0207713_10023115 276
216 3300025735 Ga0207713_1004651 Ga0207713_10046515 276
217 3300025900 Ga0207710_10106313 Ga0207710_101063132 276
218 3300025909 Ga0207705_10000621 Ga0207705_100006217 276
219 3300025913 Ga0207695_10003649 Ga0207695_1000364915 276
220 3300025923 Ga0207681_10000147 Ga0207681_100001472 276
221 3300025923 Ga0207681_10000558 Ga0207681_1000055822 276
222 3300025923 Ga0207681_10001210 Ga0207681_100012107 276
223 3300025924 Ga0207694_10212053 Ga0207694_102120531 276
224 3300025925 Ga0207650_10027366 Ga0207650_100273664 276
225 3300025931 Ga0207644_10000005 Ga0207644_1000000590 276
226 3300025931 Ga0207644_10002420 Ga0207644_100024201 276
227 3300025931 Ga0207644_10013194 Ga0207644_100131945 276
228 3300025941 Ga0207711_10189633 Ga0207711_101896332 276
229 3300025941 Ga0207711_10286695 Ga0207711_102866952 276
230 3300025941 Ga0207711_10681518 Ga0207711_106815181 276
231 3300025949 Ga0207667_10002049 Ga0207667_1000204912 276
232 3300025949 Ga0207667_10010539 Ga0207667_100105394 276
233 3300025972 Ga0207668_10093767 Ga0207668_100937671 276
234 3300025972 Ga0207668_10401655 Ga0207668_104016552 276
235 3300025981 Ga0207640_10000775 Ga0207640_1000077517 276
236 3300025981 Ga0207640_10005493 Ga0207640_100054935 276
237 3300025986 Ga0207658_10002344 Ga0207658_100023448 276
238 3300025986 Ga0207658_10002362 Ga0207658_1000236213 276
239 3300025986 Ga0207658_10005292 Ga0207658_100052925 276
240 3300025986 Ga0207658_10005863 Ga0207658_100058636 276
241 3300025986 Ga0207658_10362853 Ga0207658_103628531 276
242 3300026035 Ga0207703_10002142 Ga0207703_1000214214 276
243 3300026078 Ga0207702_10023174 Ga0207702_100231744 276
244 3300026088 Ga0207641_10003799 Ga0207641_100037994 276
245 3300026088 Ga0207641_10004367 Ga0207641_100043678 276
246 3300026088 Ga0207641_10005156 Ga0207641_100051563 276
247 3300026088 Ga0207641_10060794 Ga0207641_100607943 276
248 3300026116 Ga0207674_10067682 Ga0207674_100676823 276
249 3300026116 Ga0207674_10076709 Ga0207674_100767092 276
250 3300026116 Ga0207674_10274407 Ga0207674_102744072 276
251 3300026142 Ga0207698_10000005 Ga0207698_10000005271 276
252 3300026142 Ga0207698_10061701 Ga0207698_100617013 276
253 3300026142 Ga0207698_10230851 Ga0207698_102308512 276
254 3300027866 Ga0209813_10000130 Ga0209813_1000013028 276
255 3300027907 Ga0207428_10011309 Ga0207428_100113097 276
256 3300028379 Ga0268266_10000479 Ga0268266_1000047950 276
257 3300028379 Ga0268266_10009632 Ga0268266_100096326 276
258 3300028379 Ga0268266_10041830 Ga0268266_100418303 276
259 3300028380 Ga0268265_10023199 Ga0268265_100231992 276
260 3300028380 Ga0268265_10163018 Ga0268265_101630182 276
261 3300028380 Ga0268265_10259287 Ga0268265_102592872 276
262 3300028381 Ga0268264_10000253 Ga0268264_10000253122 276
263 3300028381 Ga0268264_10028521 Ga0268264_100285212 276
264 3300028381 Ga0268264_10034395 Ga0268264_100343952 276
265 3300028381 Ga0268264_10051533 Ga0268264_100515332 276
266 3300028381 Ga0268264_10055121 Ga0268264_100551212 276
267 3300028381 Ga0268264_10057413 Ga0268264_100574132 276
268 3300031731 Ga0307405_10011894 Ga0307405_100118945 276
269 3300031731 Ga0307405_10164928 Ga0307405_101649282 276
270 3300031824 Ga0307413_10101905 Ga0307413_101019052 276
271 3300031901 Ga0307406_10071073 Ga0307406_100710732 276
272 3300031903 Ga0307407_10361215 Ga0307407_103612151 276
273 3300031911 Ga0307412_10013557 Ga0307412_100135574 276
274 3300032002 Ga0307416_100056215 Ga0307416_1000562152 276
275 3300032004 Ga0307414_10034789 Ga0307414_100347895 276
276 3300032126 Ga0307415_100073658 Ga0307415_1000736582 276
277 3300044712 Ga0453684_0115209 Ga0453684_0115209_1173_2057 276
278 3300045051 Ga0451576_0043465 Ga0451576_0043465_282_1166 276
279 3300046453 Ga0495627_000230 Ga0495627_000230_14214_15044 276
280 3300046460 Ga0495638_0039930 Ga0495638_0039930_1983_2816 276
281 3300046471 Ga0495650_0000926 Ga0495650_0000926_32913_33743 276
282 3300046500 Ga0495596_0000314 Ga0495596_0000314_12091_12975 276
283 3300046506 Ga0495583_0014344 Ga0495583_0014344_1131_1961 276
284 3300046506 Ga0495583_0078505 Ga0495583_0078505_82_921 276
285 3300046507 Ga0495606_0014049 Ga0495606_0014049_2676_3515 276
286 3300046507 Ga0495606_0028439 Ga0495606_0028439_2020_2904 276
287 3300046512 Ga0495610_0000031 Ga0495610_0000031_121614_122444 276
288 3300046512 Ga0495610_0002416 Ga0495610_0002416_9337_10221 276
289 3300046512 Ga0495610_0005332 Ga0495610_0005332_4275_5159 276
290 3300046515 Ga0495620_0026428 Ga0495620_0026428_1663_2493 276
291 3300046519 Ga0495632_0001835 Ga0495632_0001835_15342_16226 276
292 3300046522 Ga0495643_0000080 Ga0495643_0000080_36635_37519 276
293 3300046522 Ga0495643_0007996 Ga0495643_0007996_3820_4659 276
294 3300046522 Ga0495643_0078546 Ga0495643_0078546_211_1041 276
295 3300046522 Ga0495643_0088461 Ga0495643_0088461_666_1526 276
296 3300046530 Ga0495654_0060968 Ga0495654_0060968_635_1519 276
297 3300046530 Ga0495654_0066698 Ga0495654_0066698_699_1580 276
298 3300046537 Ga0495598_0005468 Ga0495598_0005468_1134_2012 276
299 3300046660 Ga0495625_0030330 Ga0495625_0030330_1786_2619 276
300 3300046660 Ga0495625_0035498 Ga0495625_0035498_1409_2239 276
301 3300047470 Ga0495681_0000211 Ga0495681_0000211_14863_15693 276
302 3300048090 Ga0495615_0000156 Ga0495615_0000156_312_1151 276
303 3300048091 Ga0495626_0000139 Ga0495626_0000139_17611_18495 276
304 3300048904 Ga0496101_0077652 Ga0496101_0077652_383_1261 276
305 3300048905 Ga0496102_0000445 Ga0496102_0000445_36216_37097 276
306 3300048905 Ga0496102_0096607 Ga0496102_0096607_1589_2467 276
307 3300048906 Ga0496103_0000021 Ga0496103_0000021_45450_46331 276
308 3300048906 Ga0496103_0011806 Ga0496103_0011806_489_1373 276
309 3300048906 Ga0496103_0047954 Ga0496103_0047954_1624_2502 276
310 3300048907 Ga0496104_0011573 Ga0496104_0011573_6609_7490 276
311 3300048907 Ga0496104_0049835 Ga0496104_0049835_2239_3117 276
312 3300048907 Ga0496104_0074856 Ga0496104_0074856_518_1357 276
313 3300048908 Ga0496105_0000913 Ga0496105_0000913_1793_2632 276
314 3300048908 Ga0496105_0061591 Ga0496105_0061591_2084_2965 276
315 3300048910 Ga0496107_0034325 Ga0496107_0034325_1109_1990 276
316 3300048911 Ga0496108_0115627 Ga0496108_0115627_16_894 276
317 3300048912 Ga0496109_0484788 Ga0496109_0484788_270_1148 276
318 3300048913 Ga0496110_0034645 Ga0496110_0034645_2991_3869 276
319 3300048915 Ga0496112_0014171 Ga0496112_0014171_4274_5155 276
320 3300048915 Ga0496112_0186635 Ga0496112_0186635_16_894 276
321 3300048916 Ga0496113_0000070 Ga0496113_0000070_6109_6990 276
322 3300048916 Ga0496113_0033734 Ga0496113_0033734_1861_2739 276
323 3300048916 Ga0496113_0250221 Ga0496113_0250221_230_1108 276
324 3300048919 Ga0496116_0000045 Ga0496116_0000045_226957_227841 276
325 3300048920 Ga0496117_0000642 Ga0496117_0000642_6072_6953 276
326 3300048921 Ga0496118_0013955 Ga0496118_0013955_3199_4080 276
327 3300048921 Ga0496118_0016614 Ga0496118_0016614_353_1213 276
328 3300048921 Ga0496118_0037393 Ga0496118_0037393_2964_3848 276
329 3300048922 Ga0496119_0007406 Ga0496119_0007406_7504_8385 276
330 3300048923 Ga0496120_0035285 Ga0496120_0035285_940_1824 276
331 3300048924 Ga0496121_0000022 Ga0496121_0000022_44045_44932 276
332 3300048924 Ga0496121_0000136 Ga0496121_0000136_44406_45266 276
333 3300048924 Ga0496121_0001923 Ga0496121_0001923_31870_32754 276
334 3300048924 Ga0496121_0006668 Ga0496121_0006668_10806_11690 276
335 3300048925 Ga0496122_0001043 Ga0496122_0001043_37337_38218 276
336 3300048925 Ga0496122_0006036 Ga0496122_0006036_13220_14059 276
337 3300048925 Ga0496122_0043301 Ga0496122_0043301_48_932 276
338 3300048926 Ga0496123_0000785 Ga0496123_0000785_20800_21684 276
339 3300048926 Ga0496123_0000952 Ga0496123_0000952_38896_39777 276
340 3300048926 Ga0496123_0002132 Ga0496123_0002132_9786_10625 276
341 3300048926 Ga0496123_0156082 Ga0496123_0156082_225_1109 276
342 3300048927 Ga0496124_0032837 Ga0496124_0032837_2595_3479 276
343 3300048927 Ga0496124_0057240 Ga0496124_0057240_384_1268 276
344 3300048927 Ga0496124_0142987 Ga0496124_0142987_781_1665 276
345 3300048928 Ga0496125_0001024 Ga0496125_0001024_37339_38220 276
346 3300048928 Ga0496125_0010033 Ga0496125_0010033_1603_2487 276
347 3300048929 Ga0496126_0000367 Ga0496126_0000367_36240_37121 276
348 3300048929 Ga0496126_0002845 Ga0496126_0002845_17730_18608 276
349 3300048929 Ga0496126_0010216 Ga0496126_0010216_1221_2105 276
350 3300048929 Ga0496126_0115372 Ga0496126_0115372_168_1052 276
351 3300049578 Ga0501042_0229049 Ga0501042_0229049_238_1122 276
352 3300049581 Ga0501047_0437490 Ga0501047_0437490_151_1035 276
353 3300049823 Ga0501044_0000826 Ga0501044_0000826_21316_22200 276
354 3300050489 nmdc:mga03683_10235_c1 nmdc:mga03683_10235_c1_1729_2610 276
355 3300050490 nmdc:mga03n38_26325_c1 nmdc:mga03n38_26325_c1_296_1135 276
356 3300050491 nmdc:mga00v17_13633_c2 nmdc:mga00v17_13633_c2_1425_2264 276
357 3300050491 nmdc:mga00v17_687_c1 nmdc:mga00v17_687_c1_17655_18539 276
358 3300050492 nmdc:mga0yw44_13652_c1 nmdc:mga0yw44_13652_c1_2991_3830 276
359 3300050493 nmdc:mga0k408_14662_c1 nmdc:mga0k408_14662_c1_537_1376 276
360 3300050493 nmdc:mga0k408_50018_c1 nmdc:mga0k408_50018_c1_793_1680 276
361 3300050494 nmdc:mga06z11_4111_c1 nmdc:mga06z11_4111_c1_805_1644 276
362 3300050495 nmdc:mga04h51_269_c1 nmdc:mga04h51_269_c1_11777_12616 276
363 3300050496 nmdc:mga07m45_1567_c1 nmdc:mga07m45_1567_c1_9002_9952 276
364 3300050496 nmdc:mga07m45_35992_c1 nmdc:mga07m45_35992_c1_1217_2095 276
365 3300050496 nmdc:mga07m45_90_c1 nmdc:mga07m45_90_c1_495_1334 276
366 3300050507 nmdc:mga05p37_482165_c1 nmdc:mga05p37_482165_c1_518_1396 276
367 3300050516 nmdc:mga0sz30_7486_c1 nmdc:mga0sz30_7486_c1_2877_3716 276
368 3300053087 Ga0500643_000001 Ga0500643_000001_598040_598900 276
369 3300053087 Ga0500643_013655 Ga0500643_013655_1780_2613 276
370 3300053091 Ga0500647_0042720 Ga0500647_0042720_428_1309 276
371 3300053108 Ga0500562_029692 Ga0500562_029692_301_1185 276
372 3300053118 Ga0500594_0061658 Ga0500594_0061658_52_933 276
373 3300053119 Ga0500595_025639 Ga0500595_025639_1058_1891 276
374 3300053121 Ga0500607_000107 Ga0500607_000107_14634_15518 276
375 3300053121 Ga0500607_010436 Ga0500607_010436_1441_2325 276
376 3300053122 Ga0500608_000157 Ga0500608_000157_18232_19113 276
377 3300053125 Ga0500618_003314 Ga0500618_003314_3178_4065 276
378 3300053136 Ga0500559_0001127 Ga0500559_0001127_13326_14210 276
379 3300053136 Ga0500559_0011113 Ga0500559_0011113_112_993 276
380 3300053136 Ga0500559_0027410 Ga0500559_0027410_761_1645 276
381 3300053138 Ga0500564_001472 Ga0500564_001472_1871_2752 276
382 3300053146 Ga0500588_0028228 Ga0500588_0028228_352_1236 276
383 3300053148 Ga0500590_000969 Ga0500590_000969_1794_2654 276
384 3300053153 Ga0500616_0010975 Ga0500616_0010975_2980_3840 276
385 3300053156 Ga0500622_0000136 Ga0500622_0000136_31877_32710 276
386 3300053178 Ga0500637_0001771 Ga0500637_0001771_758_1642 276
387 3300053723 Ga0500567_010202 Ga0500567_010202_308_1189 276
388 3300053729 Ga0500625_000019 Ga0500625_000019_89226_90107 276
389 3300053730 Ga0500645_004057 Ga0500645_004057_2064_2948 276
390 3300053730 Ga0500645_008661 Ga0500645_008661_869_1753 276
391 iso_pu_bacteria 2738541275 2738711592 276
392 iso_pu_bacteria 2738541301 2738850017 276
393 iso_pu_bacteria 2738541304 2738865746 276
394 iso_pu_bacteria 2738543022 2739298264 276
395 iso_pu_bacteria 2738543033 2739359942 276
396 iso_pu_bacteria 2739367664 2739649253 276
397 iso_pu_bacteria 2739367865 2740027726 276
398 iso_pu_bacteria 2818991438 2819551343 276
399 iso_pu_bacteria 2882806704 2882807293 276
400 iso_pu_bacteria 2895880812 2895885986 276
401 iso_pu_bacteria 2896253425 2896255701 276
402 iso_pu_bacteria 2928100450 2928103747 276
403 iso_pu_bacteria 2928959182 2928961675 276
404 iso_pu_bacteria 3000865235 3000867716 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

31

90

0.98

PF03466

LysR_substrate

LysR substrate binding domain

114

315

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.8821 1 70
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.8626 1 70
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.8436 2 57
5mmh-assembly3.cif.gz_A the x-ray structure of the effector domain of the transcriptional regulator ampr of pseudomonas aeruginosa 0.8389 77 275
5z4z-assembly2.cif.gz_C-2 crystal structure of pacysb ntd domain with space group c2 0.8321 6 70
ID Description Score Start End Superfamily
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9125 2 68 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8993 2 69 1.10.10.10
af_P76250_6_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8963 2 72 1.10.10.10
af_Q2FVT4_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8933 2 70 1.10.10.10
af_Q2G1Q8_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8916 2 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0J7Y4G2-F1-model_v4 LysR substrate-binding domain-containing protein 0.8163 97 275 GO:0003700
GO:0006351
GO:0043565
AF-A0A655A4N6-F1-model_v4 LysR family transcriptional regulator 0.7905 128 275 GO:0003700
AF-A0A351U318-F1-model_v4 deleted 0.7779 59 275
AF-A0A3E3ED02-F1-model_v4 LysR substrate-binding domain-containing protein 0.7646 79 272 GO:0000976
GO:0006355
AF-A0A5T3RIK7-F1-model_v4 LysR family transcriptional regulator 0.7583 79 276 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
91.11 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map