metagRoot

F435610

General Info

Members	Datasets	Scaffolds	Average Seq Length
404	245	399	205

Family's Representative Sequence

Representative Sequence	3300005458\|Ga0070681_10075291\|Ga0070681_100752912
Length	234
Sequence	VTGPIPRRPRVAVVDYGAGNLVSMDQALDRVGAEVVFVRDAEAFRDVDAIVVPGVGAAGPAMERLRRRGLVDPILAWIAAGRPLLGICLGLQLLFEASDEDGAETLGVIPGRTRRLVDAPTLPHIGWNQVDRVRAHPVFDGIAPGADFYFVHSFAGVPDPTTAADVVLTRTTHGGTFVSAIARDNVLGVQFHPERSGADGLRLLANAVELVRSGGFDAPGAPDARARASEPVAV

Samples

	Sample ID	Description	Type	Environment
1	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
2	2881633906	Lactiplantibacillus garii FI11369	Isolate	Unclassified
3	2956897341	Ectobacillus funiculus W18-2	Isolate	Rhizosphere
4	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
5	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
6	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
7	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
8	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
21	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
24	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
25	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
28	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
29	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
30	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
31	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
32	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
33	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
36	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
37	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
38	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
39	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
42	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
43	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
44	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
48	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
49	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
50	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
51	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
54	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
55	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
56	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
57	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
58	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
59	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
60	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
62	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
64	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
65	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
66	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
67	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
68	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
69	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
70	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
71	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
72	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
73	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
74	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
75	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
76	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
77	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
78	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
79	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
80	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
81	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
82	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
83	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
84	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
85	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
86	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
87	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
88	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
127	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
129	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
130	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
131	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
132	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
133	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
134	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
135	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
136	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
137	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
138	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
139	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
140	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
141	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
142	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
143	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
144	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
145	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
146	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
147	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
148	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
149	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
150	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
151	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
152	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
153	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
154	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
155	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
156	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
157	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
158	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
159	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
160	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
161	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
162	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
163	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
164	3300042132	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133	Metagenome	Rhizosphere
165	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
166	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
167	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
168	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
169	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
170	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
171	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
172	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
173	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
174	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
175	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
176	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
177	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
178	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
179	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
180	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
181	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
182	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
183	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
184	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
185	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
186	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
187	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
188	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
189	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
190	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
191	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
192	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
193	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
194	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
195	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
196	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
197	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
198	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
199	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
200	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
201	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
202	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
203	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
204	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
205	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
206	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
207	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
208	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
215	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
217	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
218	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
219	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
229	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
230	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
231	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
232	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
233	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
234	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
235	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
236	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
237	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
238	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
239	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
240	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
241	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
242	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
243	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
244	646564506	Arcobacter nitrofigilis DSM 7299	Isolate	Unclassified
245	8054280661	Metabacillus kandeliae GX 13764	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.27
Metatranscriptomes	0.5
Isolates	1.24

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.2
Nodule	0
Rhizoplane	6.19
Rhizosphere	86.63
Stem	0
Stem Tuber	0
Unclassified	1.98

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0055526_1029300	3300003771	Bacteria	1638
2	Ga0055524_1001957	3300003775	Bacteria	11073
3	Ga0055536_1015795	3300003781	Bacteria	2561
4	Ga0055530_10002797	3300003791	Bacteria	10738
5	Ga0055531_10007143	3300003794	Bacteria	6159
6	Ga0070683_100063247	3300005329	Bacteria	3442
7	Ga0070683_100724411	3300005329	Bacteria	953
8	Ga0070690_100412845	3300005330	Bacteria	994
9	Ga0070680_100016707	3300005336	Bacteria	5777
10	Ga0070680_100072215	3300005336	Bacteria	2837
11	Ga0070682_100113741	3300005337	Bacteria	1808
12	Ga0068868_100720714	3300005338	Bacteria	894
13	Ga0070689_100192398	3300005340	Bacteria	1661
14	Ga0070689_100638758	3300005340	Bacteria	925
15	Ga0070691_10091045	3300005341	Bacteria	1504
16	Ga0070661_100472706	3300005344	Bacteria	1000
17	Ga0070669_100042251	3300005353	Bacteria	3317
18	Ga0070675_100396319	3300005354	Bacteria	1231
19	Ga0070659_100029407	3300005366	Bacteria	4246
20	Ga0070709_10675456	3300005434	Bacteria	802
21	Ga0070714_100099070	3300005435	Bacteria	2565
22	Ga0070711_100085248	3300005439	Bacteria	2262
23	Ga0070711_100202917	3300005439	Bacteria	1531
24	Ga0070705_100090064	3300005440	Bacteria	1909
25	Ga0070663_100334872	3300005455	Bacteria	1221
26	Ga0070681_10033622	3300005458	Bacteria	5147
27	Ga0070681_10075291	3300005458	Bacteria	3336
28	Ga0070685_10197489	3300005466	Bacteria	1306
29	Ga0070706_100006247	3300005467	Bacteria	11266
30	Ga0070706_100020056	3300005467	Bacteria	6160
31	Ga0070706_100030140	3300005467	Bacteria	4997
32	Ga0070706_100041146	3300005467	Bacteria	4267
33	Ga0070707_100008539	3300005468	Bacteria	9519
34	Ga0070707_100047859	3300005468	Bacteria	4094
35	Ga0070698_100002574	3300005471	Bacteria	19975
36	Ga0070698_100002902	3300005471	Bacteria	18872
37	Ga0070698_100025012	3300005471	Bacteria	6224
38	Ga0070698_100092088	3300005471	Bacteria	3013
39	Ga0070698_100173797	3300005471	Bacteria	2094
40	Ga0070698_100554314	3300005471	Bacteria	1089
41	Ga0070699_100062272	3300005518	Bacteria	3233
42	Ga0070699_100101763	3300005518	Bacteria	2519
43	Ga0070699_100724472	3300005518	Bacteria	909
44	Ga0070679_100077820	3300005530	Bacteria	3306
45	Ga0070679_100079492	3300005530	Bacteria	3268
46	Ga0070684_100034033	3300005535	Bacteria	4354
47	Ga0070684_100067127	3300005535	Bacteria	3149
48	Ga0070684_100414808	3300005535	Bacteria	1242
49	Ga0070697_100011916	3300005536	Bacteria	6807
50	Ga0070697_100089041	3300005536	Bacteria	2549
51	Ga0068853_100073172	3300005539	Bacteria	2987
52	Ga0070686_100000138	3300005544	Bacteria	50075
53	Ga0070695_100028528	3300005545	Bacteria	3464
54	Ga0070696_100000950	3300005546	Bacteria	18800
55	Ga0070696_100004166	3300005546	Bacteria	9634
56	Ga0070693_100089925	3300005547	Bacteria	1849
57	Ga0070693_100120447	3300005547	Bacteria	1627
58	Ga0070665_100000075	3300005548	Bacteria	189496
59	Ga0070665_100152192	3300005548	Bacteria	2316
60	Ga0068855_100001141	3300005563	Bacteria	32922
61	Ga0068855_100103492	3300005563	Bacteria	3275
62	Ga0070664_100350019	3300005564	Bacteria	1344
63	Ga0068857_100244124	3300005577	Bacteria	1645
64	Ga0068854_100203153	3300005578	Bacteria	1559
65	Ga0068856_100027472	3300005614	Bacteria	5552
66	Ga0068856_100087797	3300005614	Bacteria	3092
67	Ga0068856_100092794	3300005614	Bacteria	3004
68	Ga0070702_100037907	3300005615	Bacteria	2680
69	Ga0068852_100330109	3300005616	Bacteria	1484
70	Ga0068852_100486666	3300005616	Bacteria	1227
71	Ga0068861_100052328	3300005719	Bacteria	3103
72	Ga0068861_100437317	3300005719	Bacteria	1169
73	Ga0068861_100619509	3300005719	Bacteria	996
74	Ga0068870_10071039	3300005840	Bacteria	1899
75	Ga0068863_100123672	3300005841	Bacteria	2468
76	Ga0081455_10141361	3300005937	Bacteria	1869
77	Ga0081455_10147597	3300005937	Bacteria	1817
78	Ga0081538_10002073	3300005981	Bacteria	19976
79	Ga0081538_10006143	3300005981	Bacteria	10654
80	Ga0075365_10349560	3300006038	Bacteria	1042
81	Ga0070712_100052179	3300006175	Bacteria	2851
82	Ga0070712_100356123	3300006175	Bacteria	1199
83	Ga0070712_100373419	3300006175	Unclassified	1172
84	Ga0068871_100488298	3300006358	Bacteria	1109
85	Ga0075433_10000919	3300006852	Bacteria	20725
86	Ga0075434_100004446	3300006871	Bacteria	12639
87	Ga0075434_100022010	3300006871	Bacteria	6205
88	Ga0075434_100024699	3300006871	Bacteria	5877
89	Ga0075434_100051562	3300006871	Bacteria	4089
90	Ga0075434_100190502	3300006871	Bacteria	2071
91	Ga0075434_100555079	3300006871	Bacteria	1168
92	Ga0075434_100772966	3300006871	Bacteria	977
93	Ga0075436_100001318	3300006914	Bacteria	16857
94	Ga0075435_100065340	3300007076	Bacteria	2957
95	Ga0105240_10015070	3300009093	Bacteria	10522
96	Ga0105240_10032108	3300009093	Bacteria	6800
97	Ga0111539_10079139	3300009094	Bacteria	3867
98	Ga0111539_10311895	3300009094	Bacteria	1831
99	Ga0105245_10052822	3300009098	Bacteria	3646
100	Ga0105245_10479639	3300009098	Bacteria	1257
101	Ga0105245_10558633	3300009098	Bacteria	1167
102	Ga0105245_10700693	3300009098	Bacteria	1046
103	Ga0114129_10147921	3300009147	Bacteria	3217
104	Ga0105242_10344856	3300009176	Bacteria	1374
105	Ga0105248_10205689	3300009177	Bacteria	2218
106	Ga0105237_10493009	3300009545	Bacteria	1232
107	Ga0105238_10078864	3300009551	Bacteria	3283
108	Ga0105238_10186237	3300009551	Bacteria	2052
109	Ga0105239_10083471	3300010375	Bacteria	3518
110	Ga0105239_10610402	3300010375	Bacteria	1245
111	Ga0105246_10067308	3300011119	Bacteria	2509
112	Ga0157373_10052869	3300013100	Bacteria	2889
113	Ga0157370_10007271	3300013104	Bacteria	12086
114	Ga0157369_10020702	3300013105	Bacteria	7354
115	Ga0157369_10041413	3300013105	Bacteria	5028
116	Ga0157374_10035267	3300013296	Bacteria	4576
117	Ga0157374_10238167	3300013296	Bacteria	1789
118	Ga0157372_10224637	3300013307	Bacteria	2177
119	Ga0157372_10367466	3300013307	Bacteria	1676
120	Ga0157375_10683501	3300013308	Bacteria	1181
121	Ga0163163_10601208	3300014325	Bacteria	1163
122	Ga0157380_10004705	3300014326	Bacteria	9502
123	Ga0157380_10233297	3300014326	Bacteria	1654
124	Ga0157380_10624334	3300014326	Bacteria	1070
125	Ga0157380_10908627	3300014326	Bacteria	907
126	Ga0157380_10921369	3300014326	Bacteria	901
127	Ga0182008_10244846	3300014497	Bacteria	923
128	Ga0157377_10114015	3300014745	Bacteria	1629
129	Ga0157377_10251061	3300014745	Bacteria	1146
130	Ga0163161_10245572	3300017792	Bacteria	1394
131	Ga0209130_1002793	3300025284	Bacteria	8176
132	Ga0209676_1001097	3300025292	Bacteria	30146
133	Ga0209676_1002826	3300025292	Bacteria	11485
134	Ga0209025_1001408	3300025294	Bacteria	31877
135	Ga0209025_1047416	3300025294	Bacteria	1754
136	Ga0209564_1002248	3300025295	Bacteria	15843
137	Ga0209758_1051076	3300025297	Bacteria	1443
138	Ga0209050_1001060	3300025298	Bacteria	33818
139	Ga0209256_1002263	3300025299	Bacteria	16321
140	Ga0209051_1005499	3300025303	Bacteria	7388
141	Ga0209257_1000283	3300025304	Bacteria	113507
142	Ga0209257_1002547	3300025304	Bacteria	17837
143	Ga0207692_10137066	3300025898	Bacteria	1388
144	Ga0207642_10204096	3300025899	Bacteria	1094
145	Ga0207699_10216977	3300025906	Bacteria	1304
146	Ga0207684_10005345	3300025910	Bacteria	11869
147	Ga0207684_10009188	3300025910	Bacteria	8744
148	Ga0207684_10025396	3300025910	Bacteria	5048
149	Ga0207684_10113937	3300025910	Bacteria	2315
150	Ga0207707_10025768	3300025912	Bacteria	5143
151	Ga0207707_10130442	3300025912	Bacteria	2198
152	Ga0207707_10238927	3300025912	Bacteria	1580
153	Ga0207695_10011259	3300025913	Bacteria	10846
154	Ga0207695_10123843	3300025913	Bacteria	2550
155	Ga0207671_10219000	3300025914	Bacteria	1491
156	Ga0207693_10054225	3300025915	Bacteria	3145
157	Ga0207693_10455049	3300025915	Bacteria	1000
158	Ga0207693_10552653	3300025915	Bacteria	898
159	Ga0207660_10064932	3300025917	Bacteria	2636
160	Ga0207660_10303606	3300025917	Bacteria	1271
161	Ga0207662_10234439	3300025918	Bacteria	1199
162	Ga0207649_10322766	3300025920	Bacteria	1135
163	Ga0207649_10430517	3300025920	Bacteria	992
164	Ga0207652_10224288	3300025921	Bacteria	1693
165	Ga0207646_10001760	3300025922	Bacteria	26247
166	Ga0207646_10007230	3300025922	Bacteria	11322
167	Ga0207646_10099518	3300025922	Bacteria	2606
168	Ga0207646_10347341	3300025922	Bacteria	1341
169	Ga0207694_10116698	3300025924	Bacteria	2127
170	Ga0207694_10127059	3300025924	Bacteria	2041
171	Ga0207687_10058763	3300025927	Bacteria	2707
172	Ga0207687_10083111	3300025927	Bacteria	2317
173	Ga0207687_10433090	3300025927	Bacteria	1087
174	Ga0207700_10918174	3300025928	Bacteria	784
175	Ga0207664_10333240	3300025929	Bacteria	1341
176	Ga0207644_10262812	3300025931	Bacteria	1381
177	Ga0207706_10044244	3300025933	Bacteria	3946
178	Ga0207706_10368825	3300025933	Bacteria	1247
179	Ga0207686_10024692	3300025934	Bacteria	3486
180	Ga0207670_10637600	3300025936	Bacteria	878
181	Ga0207661_10006529	3300025944	Bacteria	8248
182	Ga0207661_10043205	3300025944	Bacteria	3556
183	Ga0207661_10053446	3300025944	Bacteria	3232
184	Ga0207661_10158934	3300025944	Archaea	1960
185	Ga0207679_10249036	3300025945	Bacteria	1509
186	Ga0207667_10001982	3300025949	Bacteria	25664
187	Ga0207640_10041546	3300025981	Bacteria	2926
188	Ga0207640_10094371	3300025981	Bacteria	2081
189	Ga0207658_10924179	3300025986	Bacteria	795
190	Ga0207639_10177030	3300026041	Bacteria	1811
191	Ga0207678_10356487	3300026067	Bacteria	1262
192	Ga0207708_10058874	3300026075	Bacteria	2932
193	Ga0207708_10123708	3300026075	Bacteria	2017
194	Ga0207708_10684943	3300026075	Bacteria	875
195	Ga0207702_10011945	3300026078	Bacteria	7224
196	Ga0207702_10172098	3300026078	Bacteria	1987
197	Ga0207641_10080687	3300026088	Bacteria	2823
198	Ga0207674_10128527	3300026116	Bacteria	2498
199	Ga0207674_10314070	3300026116	Bacteria	1516
200	Ga0207675_100793042	3300026118	Bacteria	960
201	Ga0207683_10383158	3300026121	Bacteria	1293
202	Ga0207698_10307473	3300026142	Bacteria	1479
203	Ga0209996_1006237	3300027395	Unclassified	1537
204	Ga0209974_10154384	3300027876	Bacteria	830
205	Ga0265354_1000744	3300028016	Bacteria	5316
206	Ga0268266_10000103	3300028379	Bacteria	179736
207	Ga0268266_10380252	3300028379	Bacteria	1332
208	Ga0265319_1002527	3300028563	Bacteria	9912
209	Ga0265334_10008569	3300028573	Bacteria	4344
210	Ga0265318_10030743	3300028577	Bacteria	2087
211	Ga0265318_10151281	3300028577	Bacteria	851
212	Ga0265336_10022539	3300028666	Bacteria	2004
213	Ga0265338_10013614	3300028800	Bacteria	9160
214	Ga0265338_10102582	3300028800	Bacteria	2326
215	Ga0265338_10126687	3300028800	Bacteria	2024
216	Ga0265324_10008140	3300029957	Bacteria	4191
217	Ga0265770_1000065	3300030878	Bacteria	11447
218	Ga0265760_10002521	3300031090	Bacteria	5341
219	Ga0265332_10049257	3300031238	Bacteria	1812
220	Ga0265328_10146401	3300031239	Bacteria	887
221	Ga0265320_10014560	3300031240	Bacteria	4471
222	Ga0265320_10180173	3300031240	Bacteria	947
223	Ga0265325_10016027	3300031241	Bacteria	4195
224	Ga0265329_10053781	3300031242	Bacteria	1279
225	Ga0265340_10015290	3300031247	Bacteria	3990
226	Ga0265339_10024550	3300031249	Bacteria	3472
227	Ga0265339_10025434	3300031249	Bacteria	3397
228	Ga0265327_10001367	3300031251	Bacteria	31397
229	Ga0265327_10064350	3300031251	Bacteria	1859
230	Ga0316579_10103304	3300031691	Bacteria	1366
231	Ga0265314_10006524	3300031711	Bacteria	10302
232	Ga0265342_10038028	3300031712	Bacteria	2933
233	Ga0316576_10048019	3300031727	Bacteria	3094
234	Ga0316576_10148262	3300031727	Bacteria	1768
235	Ga0316577_10091495	3300031733	Bacteria	1703
236	Ga0307409_100211862	3300031995	Bacteria	1742
237	Ga0373926_0011412	3300035083	Bacteria	2989
238	Ga0373923_0204493	3300035111	Bacteria	914
239	Ga0373936_0062104	3300035113	Bacteria	1527
240	Ga0373945_0156436	3300035116	Bacteria	927
241	Ga0373953_0065200	3300035117	Bacteria	1495
242	Ga0373956_0154803	3300035119	Bacteria	1079
243	Ga0316574_0031177	3300035398	Bacteria	3233
244	Ga0316574_0061807	3300035398	Bacteria	2353
245	Ga0373924_0059898	3300035410	Bacteria	1591
246	Ga0373924_0106298	3300035410	Bacteria	1210
247	Ga0373935_0064263	3300035692	Bacteria	2353
248	Ga0373935_0178648	3300035692	Bacteria	1456
249	Ga0373933_0278727	3300035724	Bacteria	1080
250	Ga0373947_0085789	3300035725	Bacteria	1956
251	Ga0373937_0232962	3300036401	Bacteria	1734
252	Ga0451837_1588227	3300041494	Bacteria	1993
253	Ga0451853_0511457	3300041512	Bacteria	1143
254	Ga0450895_001456	3300042132	Bacteria	1642
255	Ga0450896_002169	3300042133	Bacteria	2509
256	Ga0450907_023379	3300042146	Bacteria	1042
257	Ga0450908_000804	3300042184	Bacteria	6030
258	Ga0450918_007731	3300042531	Bacteria	1896
259	Ga0451577_0468533	3300042876	Bacteria	1144
260	Ga0466963_0008451	3300044694	Bacteria	6169
261	Ga0466963_0017206	3300044694	Bacteria	4503
262	Ga0466963_0022758	3300044694	Bacteria	3972
263	Ga0466963_0147516	3300044694	Bacteria	1633
264	Ga0466963_0211243	3300044694	Bacteria	1358
265	Ga0466964_0083118	3300044706	Bacteria	1378
266	Ga0466964_0104099	3300044706	Bacteria	1256
267	Ga0453684_0369058	3300044712	Bacteria	1614
268	Ga0466968_0057468	3300044735	Bacteria	1672
269	Ga0466957_0002559	3300044842	Bacteria	9787
270	Ga0466960_0088632	3300044901	Bacteria	1573
271	Ga0466960_0223500	3300044901	Bacteria	1037
272	Ga0451576_0109324	3300045051	Unclassified	2877
273	Ga0451576_0392892	3300045051	Bacteria	1454
274	Ga0466967_0000165	3300045976	Bacteria	26919
275	Ga0466967_0001994	3300045976	Bacteria	12407
276	Ga0466967_0047174	3300045976	Bacteria	3754
277	Ga0466967_0141263	3300045976	Bacteria	2243
278	Ga0466967_0145769	3300045976	Bacteria	2209
279	Ga0466967_0169173	3300045976	Bacteria	2055
280	Ga0466967_0198165	3300045976	Bacteria	1900
281	Ga0466967_0212961	3300045976	Bacteria	1833
282	Ga0466967_0846142	3300045976	Bacteria	909
283	Ga0466967_0907588	3300045976	Bacteria	876
284	Ga0466967_1092257	3300045976	Bacteria	795
285	Ga0495592_0134637	3300046454	Bacteria	1725
286	Ga0495603_0058721	3300046455	Bacteria	2274
287	Ga0495580_0364665	3300046472	Bacteria	977
288	Ga0495582_0225682	3300046473	Bacteria	1072
289	Ga0495662_0042138	3300046476	Bacteria	2203
290	Ga0495594_0218349	3300046499	Bacteria	1087
291	Ga0495630_0344279	3300046517	Bacteria	1141
292	Ga0495657_0074280	3300046675	Bacteria	2213
293	Ga0495647_0014228	3300046681	Bacteria	2769
294	Ga0495658_0383513	3300046683	Bacteria	895
295	Ga0495674_0519124	3300047319	Bacteria	951
296	Ga0495676_0384779	3300047321	Bacteria	933
297	Ga0495602_0179204	3300048088	Bacteria	1636
298	Ga0496100_0008507	3300048903	Bacteria	5725
299	Ga0496101_0044971	3300048904	Bacteria	3161
300	Ga0496101_0052598	3300048904	Bacteria	2937
301	Ga0496101_0175478	3300048904	Bacteria	1648
302	Ga0496101_0872570	3300048904	Bacteria	709
303	Ga0496102_0152291	3300048905	Bacteria	2174
304	Ga0496102_0216136	3300048905	Bacteria	1807
305	Ga0496102_1083878	3300048905	Bacteria	721
306	Ga0496104_0354431	3300048907	Bacteria	1380
307	Ga0496108_0025151	3300048911	Bacteria	4905
308	Ga0496108_0084452	3300048911	Bacteria	2694
309	Ga0496109_0078486	3300048912	Bacteria	3041
310	Ga0496109_0147200	3300048912	Bacteria	2204
311	Ga0496109_0230811	3300048912	Bacteria	1741
312	Ga0496110_0031523	3300048913	Bacteria	4574
313	Ga0496111_0018824	3300048914	Bacteria	4788
314	Ga0496111_0186784	3300048914	Bacteria	1541
315	Ga0496113_0308754	3300048916	Bacteria	1267
316	Ga0496114_0085240	3300048917	Bacteria	2676
317	Ga0496114_0192637	3300048917	Bacteria	1784
318	Ga0496114_0986043	3300048917	Bacteria	725
319	Ga0496115_0007421	3300048918	Bacteria	8067
320	Ga0496115_0123584	3300048918	Bacteria	2131
321	Ga0496115_0160290	3300048918	Bacteria	1859
322	Ga0496115_0391374	3300048918	Bacteria	1129
323	Ga0496116_0007563	3300048919	Bacteria	9604
324	Ga0496122_0000478	3300048925	Bacteria	83278
325	Ga0496126_0000576	3300048929	Bacteria	70081
326	Ga0501031_0171379	3300049568	Bacteria	1418
327	Ga0501031_0318302	3300049568	Bacteria	1008
328	Ga0501034_0003187	3300049571	Bacteria	18874
329	Ga0501034_0363797	3300049571	Bacteria	1373
330	Ga0501034_0529765	3300049571	Bacteria	1089
331	Ga0501036_0264811	3300049572	Bacteria	1440
332	Ga0501037_0107530	3300049573	Bacteria	2010
333	Ga0501038_0303644	3300049574	Bacteria	1252
334	Ga0501039_0215060	3300049575	Bacteria	1511
335	Ga0501040_0046962	3300049576	Bacteria	2948
336	Ga0501040_0198848	3300049576	Bacteria	1423
337	Ga0501040_0212765	3300049576	Bacteria	1375
338	Ga0501041_0025954	3300049577	Bacteria	3523
339	Ga0501047_0049307	3300049581	Bacteria	4066
340	Ga0501067_0015227	3300049583	Bacteria	4258
341	Ga0501067_0025443	3300049583	Bacteria	3280
342	Ga0501068_0006577	3300049584	Bacteria	6411
343	Ga0501068_0093685	3300049584	Bacteria	1856
344	Ga0501068_0153324	3300049584	Bacteria	1449
345	Ga0501069_0005243	3300049585	Bacteria	6729
346	Ga0501069_0098939	3300049585	Bacteria	1655
347	Ga0501069_0145714	3300049585	Bacteria	1359
348	Ga0501070_0348126	3300049586	Bacteria	1203
349	Ga0501071_0058589	3300049587	Bacteria	2785
350	Ga0501071_0417766	3300049587	Bacteria	1025
351	Ga0501071_0530958	3300049587	Bacteria	903
352	Ga0501072_0174722	3300049588	Bacteria	1714
353	Ga0501075_0021131	3300049591	Bacteria	4742
354	Ga0501075_0362517	3300049591	Bacteria	1105
355	Ga0501076_0006428	3300049592	Bacteria	8521
356	Ga0501076_0912244	3300049592	Bacteria	724
357	Ga0501077_0172990	3300049593	Bacteria	1372
358	Ga0501079_0234980	3300049741	Bacteria	1432
359	Ga0501080_0099055	3300049742	Bacteria	2705
360	Ga0501081_0091730	3300049743	Bacteria	2137
361	Ga0501081_0098499	3300049743	Bacteria	2065
362	Ga0501081_0249995	3300049743	Bacteria	1294
363	Ga0501035_0126297	3300049822	Bacteria	2233
364	Ga0501044_0099054	3300049823	Bacteria	2934
365	Ga0501045_0253721	3300049824	Bacteria	1309
366	Ga0501045_0283430	3300049824	Bacteria	1233
367	Ga0501045_0538278	3300049824	Bacteria	866
368	nmdc:mga0yw44_600730_c1	3300050492	Bacteria	747
369	nmdc:mga05p37_309896_c1	3300050507	Bacteria	1871
370	nmdc:mga05p37_841286_c1	3300050507	Bacteria	998
371	nmdc:mga09592_660339_c1	3300050508	Bacteria	892
372	nmdc:mga08y16_75953_c1	3300050511	Bacteria	1136
373	nmdc:mga0n895_1206497_c1	3300050512	Bacteria	730
374	nmdc:mga0n895_1358_c1	3300050512	Bacteria	18186
375	nmdc:mga0n895_308653_c1	3300050512	Bacteria	1603
376	nmdc:mga0n895_391113_c1	3300050512	Bacteria	1407
377	nmdc:mga0n895_43088_c1	3300050512	Bacteria	4396
378	nmdc:mga0n895_462560_c1	3300050512	Archaea	1280
379	nmdc:mga0n895_58349_c1	3300050512	Bacteria	3805
380	nmdc:mga0rr50_131077_c1	3300050513	Bacteria	2007
381	nmdc:mga0rr50_60319_c1	3300050513	Bacteria	2853
382	nmdc:mga08x19_465508_c1	3300050514	Bacteria	890
383	nmdc:mga08x19_88800_c1	3300050514	Bacteria	2038
384	nmdc:mga0a205_509462_c1	3300050515	Bacteria	1060
385	nmdc:mga0a205_9685_c1	3300050515	Bacteria	8823
386	Ga0495601_0070721	3300053077	Bacteria	2228
387	Ga0495601_0344310	3300053077	Bacteria	970
388	Ga0495595_0049320	3300053084	Bacteria	1947
389	Ga0500556_0001657	3300053104	Bacteria	8637
390	Ga0500637_0006868	3300053178	Bacteria	5651
391	Ga0501084_0065508	3300054114	Bacteria	3040
392	Ga0501084_0161154	3300054114	Bacteria	1892
393	Ga0466962_0019655	3300061719	Bacteria	3247
394	Ga0530510_0016435	3300061734	Bacteria	5238
395	Ga0530510_0026212	3300061734	Bacteria	4170
396	Ga0530510_0075035	3300061734	Bacteria	2456
397	Ga0530510_0174468	3300061734	Bacteria	1593
398	Ga0530510_0261631	3300061734	Bacteria	1290
399	Ga0530510_0785989	3300061734	Bacteria	726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044694	Ga0466963_0211243	Ga0466963_0211243_749_1348	163
2	3300045976	Ga0466967_0047174	Ga0466967_0047174_1355_1969	165
3	3300045976	Ga0466967_0212961	Ga0466967_0212961_277_891	171
4	3300044694	Ga0466963_0017206	Ga0466963_0017206_2154_2768	172
5	3300044706	Ga0466964_0083118	Ga0466964_0083118_461_1075	172
6	3300045976	Ga0466967_0000165	Ga0466967_0000165_10091_10705	172
7	3300061719	Ga0466962_0019655	Ga0466962_0019655_1671_2285	172
8	3300025931	Ga0207644_10262812	Ga0207644_102628122	173
9	3300035410	Ga0373924_0106298	Ga0373924_0106298_17_562	173
10	3300028577	Ga0265318_10151281	Ga0265318_101512812	174
11	3300028800	Ga0265338_10102582	Ga0265338_101025823	174
12	3300031240	Ga0265320_10180173	Ga0265320_101801732	174
13	3300031249	Ga0265339_10024550	Ga0265339_100245503	174
14	3300044901	Ga0466960_0223500	Ga0466960_0223500_372_1007	176
15	3300028563	Ga0265319_1002527	Ga0265319_10025273	177
16	3300028573	Ga0265334_10008569	Ga0265334_100085693	177
17	3300028577	Ga0265318_10030743	Ga0265318_100307433	177
18	3300028666	Ga0265336_10022539	Ga0265336_100225393	177
19	3300028800	Ga0265338_10126687	Ga0265338_101266872	177
20	3300029957	Ga0265324_10008140	Ga0265324_100081404	177
21	3300031238	Ga0265332_10049257	Ga0265332_100492572	177
22	3300031239	Ga0265328_10146401	Ga0265328_101464012	177
23	3300031240	Ga0265320_10014560	Ga0265320_100145603	177
24	3300031241	Ga0265325_10016027	Ga0265325_100160273	177
25	3300031242	Ga0265329_10053781	Ga0265329_100537812	177
26	3300031247	Ga0265340_10015290	Ga0265340_100152903	177
27	3300031249	Ga0265339_10025434	Ga0265339_100254343	177
28	3300031711	Ga0265314_10006524	Ga0265314_100065244	177
29	3300031712	Ga0265342_10038028	Ga0265342_100380282	177
30	3300006871	Ga0075434_100051562	Ga0075434_1000515622	178
31	3300006871	Ga0075434_100190502	Ga0075434_1001905023	178
32	3300050512	nmdc:mga0n895_308653_c1	nmdc:mga0n895_308653_c1_650_1330	178
33	3300006175	Ga0070712_100356123	Ga0070712_1003561232	179
34	3300025915	Ga0207693_10455049	Ga0207693_104550492	179
35	3300025928	Ga0207700_10918174	Ga0207700_109181741	179
36	3300048918	Ga0496115_0123584	Ga0496115_0123584_83_697	179
37	3300026116	Ga0207674_10314070	Ga0207674_103140702	180
38	3300045051	Ga0451576_0109324	Ga0451576_0109324_1987_2562	181
39	3300049576	Ga0501040_0198848	Ga0501040_0198848_802_1413	181
40	3300049591	Ga0501075_0362517	Ga0501075_0362517_484_1095	181
41	3300014326	Ga0157380_10233297	Ga0157380_102332973	183
42	3300025933	Ga0207706_10044244	Ga0207706_100442443	183
43	3300061734	Ga0530510_0785989	Ga0530510_0785989_83_664	183
44	3300005340	Ga0070689_100638758	Ga0070689_1006387581	184
45	3300005471	Ga0070698_100092088	Ga0070698_1000920882	185
46	3300006871	Ga0075434_100772966	Ga0075434_1007729662	185
47	3300025910	Ga0207684_10025396	Ga0207684_100253962	185
48	3300035398	Ga0316574_0031177	Ga0316574_0031177_1970_2569	185
49	3300050512	nmdc:mga0n895_462560_c1	nmdc:mga0n895_462560_c1_537_1151	185
50	3300005467	Ga0070706_100030140	Ga0070706_1000301401	186
51	3300006175	Ga0070712_100373419	Ga0070712_1003734192	186
52	3300025915	Ga0207693_10552653	Ga0207693_105526532	186
53	3300035692	Ga0373935_0178648	Ga0373935_0178648_852_1436	186
54	3300044694	Ga0466963_0022758	Ga0466963_0022758_2449_3036	186
55	3300045976	Ga0466967_0141263	Ga0466967_0141263_810_1397	186
56	3300045976	Ga0466967_0907588	Ga0466967_0907588_234_821	186
57	3300045976	Ga0466967_1092257	Ga0466967_1092257_79_666	186
58	3300006852	Ga0075433_10000919	Ga0075433_1000091910	187
59	3300006871	Ga0075434_100004446	Ga0075434_1000044468	187
60	3300006871	Ga0075434_100555079	Ga0075434_1005550792	187
61	3300045051	Ga0451576_0392892	Ga0451576_0392892_187_792	187
62	3300050512	nmdc:mga0n895_1206497_c1	nmdc:mga0n895_1206497_c1_80_685	187
63	3300050512	nmdc:mga0n895_1358_c1	nmdc:mga0n895_1358_c1_5939_6544	187
64	3300050515	nmdc:mga0a205_9685_c1	nmdc:mga0a205_9685_c1_2229_2834	187
65	iso_pu_bacteria	646564506	646812918	187
66	3300005981	Ga0081538_10006143	Ga0081538_1000614315	188
67	3300044694	Ga0466963_0147516	Ga0466963_0147516_811_1407	188
68	3300045976	Ga0466967_0145769	Ga0466967_0145769_246_839	188
69	3300045976	Ga0466967_0198165	Ga0466967_0198165_270_866	188
70	3300049743	Ga0501081_0098499	Ga0501081_0098499_837_1430	188
71	3300005471	Ga0070698_100025012	Ga0070698_1000250123	189
72	3300005981	Ga0081538_10002073	Ga0081538_100020736	189
73	3300048911	Ga0496108_0084452	Ga0496108_0084452_782_1381	189
74	3300048912	Ga0496109_0078486	Ga0496109_0078486_586_1185	189
75	3300048914	Ga0496111_0018824	Ga0496111_0018824_3440_4039	189
76	3300048918	Ga0496115_0007421	Ga0496115_0007421_4379_4957	189
77	3300048918	Ga0496115_0391374	Ga0496115_0391374_478_1074	189
78	iso_pu_bacteria	2643221599	2644007264	189
79	3300005329	Ga0070683_100724411	Ga0070683_1007244112	190
80	3300005336	Ga0070680_100072215	Ga0070680_1000722153	190
81	3300005458	Ga0070681_10033622	Ga0070681_100336224	190
82	3300005530	Ga0070679_100079492	Ga0070679_1000794923	190
83	3300005614	Ga0068856_100087797	Ga0068856_1000877972	190
84	3300009093	Ga0105240_10032108	Ga0105240_100321082	190
85	3300013100	Ga0157373_10052869	Ga0157373_100528694	190
86	3300013104	Ga0157370_10007271	Ga0157370_1000727110	190
87	3300013105	Ga0157369_10020702	Ga0157369_100207026	190
88	3300025912	Ga0207707_10130442	Ga0207707_101304422	190
89	3300025913	Ga0207695_10123843	Ga0207695_101238433	190
90	3300025917	Ga0207660_10303606	Ga0207660_103036062	190
91	3300025944	Ga0207661_10158934	Ga0207661_101589342	190
92	3300026078	Ga0207702_10172098	Ga0207702_101720982	190
93	3300048905	Ga0496102_1083878	Ga0496102_1083878_92_700	190
94	3300048912	Ga0496109_0147200	Ga0496109_0147200_747_1358	190
95	3300048916	Ga0496113_0308754	Ga0496113_0308754_276_887	190
96	3300005329	Ga0070683_100063247	Ga0070683_1000632473	191
97	3300005336	Ga0070680_100016707	Ga0070680_1000167077	191
98	3300005337	Ga0070682_100113741	Ga0070682_1001137412	191
99	3300005340	Ga0070689_100192398	Ga0070689_1001923982	191
100	3300005341	Ga0070691_10091045	Ga0070691_100910452	191
101	3300005344	Ga0070661_100472706	Ga0070661_1004727062	191
102	3300005366	Ga0070659_100029407	Ga0070659_1000294074	191
103	3300005434	Ga0070709_10675456	Ga0070709_106754562	191
104	3300005435	Ga0070714_100099070	Ga0070714_1000990702	191
105	3300005439	Ga0070711_100085248	Ga0070711_1000852483	191
106	3300005439	Ga0070711_100202917	Ga0070711_1002029172	191
107	3300005440	Ga0070705_100090064	Ga0070705_1000900642	191
108	3300005455	Ga0070663_100334872	Ga0070663_1003348722	191
109	3300005466	Ga0070685_10197489	Ga0070685_101974892	191
110	3300005535	Ga0070684_100034033	Ga0070684_1000340335	191
111	3300005535	Ga0070684_100067127	Ga0070684_1000671273	191
112	3300005535	Ga0070684_100414808	Ga0070684_1004148082	191
113	3300005547	Ga0070693_100089925	Ga0070693_1000899252	191
114	3300005547	Ga0070693_100120447	Ga0070693_1001204472	191
115	3300005548	Ga0070665_100152192	Ga0070665_1001521922	191
116	3300005563	Ga0068855_100103492	Ga0068855_1001034924	191
117	3300005564	Ga0070664_100350019	Ga0070664_1003500192	191
118	3300005577	Ga0068857_100244124	Ga0068857_1002441242	191
119	3300005578	Ga0068854_100203153	Ga0068854_1002031532	191
120	3300005614	Ga0068856_100027472	Ga0068856_1000274726	191
121	3300005614	Ga0068856_100092794	Ga0068856_1000927943	191
122	3300005615	Ga0070702_100037907	Ga0070702_1000379072	191
123	3300005616	Ga0068852_100330109	Ga0068852_1003301092	191
124	3300005616	Ga0068852_100486666	Ga0068852_1004866662	191
125	3300006038	Ga0075365_10349560	Ga0075365_103495602	191
126	3300006175	Ga0070712_100052179	Ga0070712_1000521792	191
127	3300006358	Ga0068871_100488298	Ga0068871_1004882982	191
128	3300006871	Ga0075434_100022010	Ga0075434_1000220106	191
129	3300006914	Ga0075436_100001318	Ga0075436_10000131814	191
130	3300007076	Ga0075435_100065340	Ga0075435_1000653402	191
131	3300009093	Ga0105240_10015070	Ga0105240_1001507012	191
132	3300009098	Ga0105245_10052822	Ga0105245_100528224	191
133	3300009098	Ga0105245_10558633	Ga0105245_105586332	191
134	3300009176	Ga0105242_10344856	Ga0105242_103448562	191
135	3300009177	Ga0105248_10205689	Ga0105248_102056892	191
136	3300009545	Ga0105237_10493009	Ga0105237_104930092	191
137	3300009551	Ga0105238_10078864	Ga0105238_100788643	191
138	3300009551	Ga0105238_10186237	Ga0105238_101862372	191
139	3300010375	Ga0105239_10083471	Ga0105239_100834712	191
140	3300010375	Ga0105239_10610402	Ga0105239_106104022	191
141	3300011119	Ga0105246_10067308	Ga0105246_100673083	191
142	3300013105	Ga0157369_10041413	Ga0157369_100414135	191
143	3300013296	Ga0157374_10035267	Ga0157374_100352672	191
144	3300013296	Ga0157374_10238167	Ga0157374_102381672	191
145	3300013307	Ga0157372_10367466	Ga0157372_103674662	191
146	3300013308	Ga0157375_10683501	Ga0157375_106835012	191
147	3300014325	Ga0163163_10601208	Ga0163163_106012082	191
148	3300014326	Ga0157380_10624334	Ga0157380_106243342	191
149	3300014497	Ga0182008_10244846	Ga0182008_102448461	191
150	3300014745	Ga0157377_10114015	Ga0157377_101140152	191
151	3300014745	Ga0157377_10251061	Ga0157377_102510612	191
152	3300025898	Ga0207692_10137066	Ga0207692_101370662	191
153	3300025899	Ga0207642_10204096	Ga0207642_102040962	191
154	3300025906	Ga0207699_10216977	Ga0207699_102169772	191
155	3300025912	Ga0207707_10025768	Ga0207707_100257682	191
156	3300025913	Ga0207695_10011259	Ga0207695_1001125911	191
157	3300025914	Ga0207671_10219000	Ga0207671_102190002	191
158	3300025915	Ga0207693_10054225	Ga0207693_100542253	191
159	3300025917	Ga0207660_10064932	Ga0207660_100649322	191
160	3300025918	Ga0207662_10234439	Ga0207662_102344392	191
161	3300025920	Ga0207649_10322766	Ga0207649_103227662	191
162	3300025924	Ga0207694_10116698	Ga0207694_101166982	191
163	3300025924	Ga0207694_10127059	Ga0207694_101270592	191
164	3300025927	Ga0207687_10058763	Ga0207687_100587632	191
165	3300025927	Ga0207687_10433090	Ga0207687_104330902	191
166	3300025929	Ga0207664_10333240	Ga0207664_103332402	191
167	3300025933	Ga0207706_10368825	Ga0207706_103688252	191
168	3300025934	Ga0207686_10024692	Ga0207686_100246923	191
169	3300025944	Ga0207661_10006529	Ga0207661_100065298	191
170	3300025944	Ga0207661_10043205	Ga0207661_100432054	191
171	3300025944	Ga0207661_10053446	Ga0207661_100534463	191
172	3300025945	Ga0207679_10249036	Ga0207679_102490362	191
173	3300025981	Ga0207640_10041546	Ga0207640_100415464	191
174	3300025981	Ga0207640_10094371	Ga0207640_100943712	191
175	3300025986	Ga0207658_10924179	Ga0207658_109241792	191
176	3300026067	Ga0207678_10356487	Ga0207678_103564872	191
177	3300026075	Ga0207708_10058874	Ga0207708_100588743	191
178	3300026078	Ga0207702_10011945	Ga0207702_100119458	191
179	3300026116	Ga0207674_10128527	Ga0207674_101285272	191
180	3300026121	Ga0207683_10383158	Ga0207683_103831582	191
181	3300026142	Ga0207698_10307473	Ga0207698_103074732	191
182	3300028379	Ga0268266_10380252	Ga0268266_103802521	191
183	3300028800	Ga0265338_10013614	Ga0265338_100136146	191
184	3300031251	Ga0265327_10001367	Ga0265327_1000136713	191
185	3300044694	Ga0466963_0008451	Ga0466963_0008451_4630_5244	191
186	3300044706	Ga0466964_0104099	Ga0466964_0104099_186_800	191
187	3300044735	Ga0466968_0057468	Ga0466968_0057468_583_1197	191
188	3300044842	Ga0466957_0002559	Ga0466957_0002559_3376_3990	191
189	3300044901	Ga0466960_0088632	Ga0466960_0088632_279_893	191
190	3300045976	Ga0466967_0001994	Ga0466967_0001994_4379_4993	191
191	3300045976	Ga0466967_0169173	Ga0466967_0169173_658_1272	191
192	3300045976	Ga0466967_0846142	Ga0466967_0846142_264_878	191
193	3300046455	Ga0495603_0058721	Ga0495603_0058721_245_859	191
194	3300046473	Ga0495582_0225682	Ga0495582_0225682_111_725	191
195	3300046499	Ga0495594_0218349	Ga0495594_0218349_245_859	191
196	3300046683	Ga0495658_0383513	Ga0495658_0383513_195_809	191
197	3300047321	Ga0495676_0384779	Ga0495676_0384779_91_705	191
198	3300048904	Ga0496101_0052598	Ga0496101_0052598_1569_2183	191
199	3300048904	Ga0496101_0175478	Ga0496101_0175478_939_1553	191
200	3300048904	Ga0496101_0872570	Ga0496101_0872570_61_675	191
201	3300048905	Ga0496102_0152291	Ga0496102_0152291_545_1159	191
202	3300048905	Ga0496102_0216136	Ga0496102_0216136_951_1565	191
203	3300048917	Ga0496114_0192637	Ga0496114_0192637_54_668	191
204	3300048917	Ga0496114_0986043	Ga0496114_0986043_18_632	191
205	3300048918	Ga0496115_0160290	Ga0496115_0160290_346_960	191
206	3300049583	Ga0501067_0015227	Ga0501067_0015227_116_730	191
207	3300049583	Ga0501067_0025443	Ga0501067_0025443_448_1062	191
208	3300049584	Ga0501068_0006577	Ga0501068_0006577_677_1291	191
209	3300049585	Ga0501069_0005243	Ga0501069_0005243_4582_5196	191
210	3300049585	Ga0501069_0145714	Ga0501069_0145714_469_1083	191
211	3300050492	nmdc:mga0yw44_600730_c1	nmdc:mga0yw44_600730_c1_50_649	191
212	3300050512	nmdc:mga0n895_391113_c1	nmdc:mga0n895_391113_c1_450_1064	191
213	3300050512	nmdc:mga0n895_43088_c1	nmdc:mga0n895_43088_c1_3166_3780	191
214	3300050513	nmdc:mga0rr50_131077_c1	nmdc:mga0rr50_131077_c1_461_1075	191
215	3300050513	nmdc:mga0rr50_60319_c1	nmdc:mga0rr50_60319_c1_1484_2098	191
216	3300050514	nmdc:mga08x19_465508_c1	nmdc:mga08x19_465508_c1_129_743	191
217	3300050514	nmdc:mga08x19_88800_c1	nmdc:mga08x19_88800_c1_756_1370	191
218	3300050515	nmdc:mga0a205_509462_c1	nmdc:mga0a205_509462_c1_31_645	191
219	3300061734	Ga0530510_0016435	Ga0530510_0016435_303_917	191
220	3300061734	Ga0530510_0075035	Ga0530510_0075035_1651_2265	191
221	iso_pu_bacteria	2881633906	2881636004	191
222	iso_pu_bacteria	8054280661	8054282129	191
223	3300005518	Ga0070699_100724472	Ga0070699_1007244722	192
224	3300041494	Ga0451837_1588227	Ga0451837_1588227_347_994	192
225	3300042132	Ga0450895_001456	Ga0450895_001456_1036_1614	192
226	3300042133	Ga0450896_002169	Ga0450896_002169_1267_1845	192
227	3300042146	Ga0450907_023379	Ga0450907_023379_343_921	192
228	3300042184	Ga0450908_000804	Ga0450908_000804_1395_1973	192
229	3300042531	Ga0450918_007731	Ga0450918_007731_216_794	192
230	3300044712	Ga0453684_0369058	Ga0453684_0369058_251_835	192
231	3300049585	Ga0501069_0098939	Ga0501069_0098939_836_1513	192
232	3300005330	Ga0070690_100412845	Ga0070690_1004128451	193
233	3300005338	Ga0068868_100720714	Ga0068868_1007207142	193
234	3300005539	Ga0068853_100073172	Ga0068853_1000731722	193
235	3300005544	Ga0070686_100000138	Ga0070686_10000013815	193
236	3300005548	Ga0070665_100000075	Ga0070665_100000075130	193
237	3300005719	Ga0068861_100619509	Ga0068861_1006195092	193
238	3300005841	Ga0068863_100123672	Ga0068863_1001236722	193
239	3300006871	Ga0075434_100024699	Ga0075434_1000246996	193
240	3300009098	Ga0105245_10479639	Ga0105245_104796392	193
241	3300009098	Ga0105245_10700693	Ga0105245_107006932	193
242	3300013307	Ga0157372_10224637	Ga0157372_102246372	193
243	3300025920	Ga0207649_10430517	Ga0207649_104305172	193
244	3300025927	Ga0207687_10083111	Ga0207687_100831113	193
245	3300026041	Ga0207639_10177030	Ga0207639_101770302	193
246	3300026088	Ga0207641_10080687	Ga0207641_100806872	193
247	3300028379	Ga0268266_10000103	Ga0268266_10000103105	193
248	3300048919	Ga0496116_0007563	Ga0496116_0007563_2912_3517	193
249	3300048925	Ga0496122_0000478	Ga0496122_0000478_2891_3523	193
250	3300048929	Ga0496126_0000576	Ga0496126_0000576_2891_3523	193
251	3300050512	nmdc:mga0n895_58349_c1	nmdc:mga0n895_58349_c1_1068_1649	193
252	3300005467	Ga0070706_100006247	Ga0070706_1000062477	194
253	3300005467	Ga0070706_100020056	Ga0070706_1000200564	194
254	3300005468	Ga0070707_100047859	Ga0070707_1000478592	194
255	3300005471	Ga0070698_100002574	Ga0070698_1000025743	194
256	3300005471	Ga0070698_100173797	Ga0070698_1001737973	194
257	3300005518	Ga0070699_100101763	Ga0070699_1001017632	194
258	3300005536	Ga0070697_100089041	Ga0070697_1000890413	194
259	3300005719	Ga0068861_100052328	Ga0068861_1000523283	194
260	3300009094	Ga0111539_10079139	Ga0111539_100791392	194
261	3300009147	Ga0114129_10147921	Ga0114129_101479215	194
262	3300025910	Ga0207684_10005345	Ga0207684_100053459	194
263	3300025922	Ga0207646_10007230	Ga0207646_1000723010	194
264	3300025922	Ga0207646_10347341	Ga0207646_103473412	194
265	3300026075	Ga0207708_10123708	Ga0207708_101237082	194
266	3300031733	Ga0316577_10091495	Ga0316577_100914952	194
267	3300035117	Ga0373953_0065200	Ga0373953_0065200_236_844	194
268	3300035119	Ga0373956_0154803	Ga0373956_0154803_439_1047	194
269	3300035724	Ga0373933_0278727	Ga0373933_0278727_339_959	194
270	3300036401	Ga0373937_0232962	Ga0373937_0232962_891_1499	194
271	3300042876	Ga0451577_0468533	Ga0451577_0468533_333_953	194
272	3300046517	Ga0495630_0344279	Ga0495630_0344279_342_950	194
273	3300046675	Ga0495657_0074280	Ga0495657_0074280_1444_2064	194
274	3300048088	Ga0495602_0179204	Ga0495602_0179204_727_1347	194
275	3300049571	Ga0501034_0363797	Ga0501034_0363797_166_786	194
276	3300049571	Ga0501034_0529765	Ga0501034_0529765_52_672	194
277	3300049572	Ga0501036_0264811	Ga0501036_0264811_60_680	194
278	3300049586	Ga0501070_0348126	Ga0501070_0348126_93_713	194
279	3300050507	nmdc:mga05p37_309896_c1	nmdc:mga05p37_309896_c1_532_1182	194
280	3300050508	nmdc:mga09592_660339_c1	nmdc:mga09592_660339_c1_139_789	194
281	3300050511	nmdc:mga08y16_75953_c1	nmdc:mga08y16_75953_c1_330_980	194
282	3300053084	Ga0495595_0049320	Ga0495595_0049320_1263_1871	194
283	3300005354	Ga0070675_100396319	Ga0070675_1003963192	195
284	3300005467	Ga0070706_100041146	Ga0070706_1000411464	195
285	3300005468	Ga0070707_100008539	Ga0070707_1000085394	195
286	3300005471	Ga0070698_100002902	Ga0070698_10000290219	195
287	3300005471	Ga0070698_100554314	Ga0070698_1005543141	195
288	3300005518	Ga0070699_100062272	Ga0070699_1000622723	195
289	3300005536	Ga0070697_100011916	Ga0070697_1000119164	195
290	3300005719	Ga0068861_100437317	Ga0068861_1004373172	195
291	3300005937	Ga0081455_10141361	Ga0081455_101413612	195
292	3300005937	Ga0081455_10147597	Ga0081455_101475972	195
293	3300009094	Ga0111539_10311895	Ga0111539_103118953	195
294	3300014326	Ga0157380_10908627	Ga0157380_109086272	195
295	3300014326	Ga0157380_10921369	Ga0157380_109213691	195
296	3300017792	Ga0163161_10245572	Ga0163161_102455722	195
297	3300025910	Ga0207684_10009188	Ga0207684_100091888	195
298	3300025910	Ga0207684_10113937	Ga0207684_101139373	195
299	3300025922	Ga0207646_10001760	Ga0207646_1000176017	195
300	3300025922	Ga0207646_10099518	Ga0207646_100995182	195
301	3300025936	Ga0207670_10637600	Ga0207670_106376002	195
302	3300026075	Ga0207708_10684943	Ga0207708_106849432	195
303	3300026118	Ga0207675_100793042	Ga0207675_1007930422	195
304	3300031727	Ga0316576_10048019	Ga0316576_100480193	195
305	3300031995	Ga0307409_100211862	Ga0307409_1002118622	195
306	3300035113	Ga0373936_0062104	Ga0373936_0062104_750_1376	195
307	3300035116	Ga0373945_0156436	Ga0373945_0156436_287_913	195
308	3300035410	Ga0373924_0059898	Ga0373924_0059898_184_810	195
309	3300035692	Ga0373935_0064263	Ga0373935_0064263_955_1581	195
310	3300035725	Ga0373947_0085789	Ga0373947_0085789_952_1578	195
311	3300041512	Ga0451853_0511457	Ga0451853_0511457_497_1132	195
312	3300046454	Ga0495592_0134637	Ga0495592_0134637_799_1452	195
313	3300046472	Ga0495580_0364665	Ga0495580_0364665_235_861	195
314	3300046476	Ga0495662_0042138	Ga0495662_0042138_1095_1721	195
315	3300046681	Ga0495647_0014228	Ga0495647_0014228_2042_2668	195
316	3300047319	Ga0495674_0519124	Ga0495674_0519124_76_759	195
317	3300048903	Ga0496100_0008507	Ga0496100_0008507_3337_3969	195
318	3300048904	Ga0496101_0044971	Ga0496101_0044971_164_796	195
319	3300048907	Ga0496104_0354431	Ga0496104_0354431_282_965	195
320	3300048911	Ga0496108_0025151	Ga0496108_0025151_3028_3660	195
321	3300048912	Ga0496109_0230811	Ga0496109_0230811_712_1344	195
322	3300048913	Ga0496110_0031523	Ga0496110_0031523_42_674	195
323	3300048914	Ga0496111_0186784	Ga0496111_0186784_267_899	195
324	3300048917	Ga0496114_0085240	Ga0496114_0085240_2014_2643	195
325	3300049568	Ga0501031_0171379	Ga0501031_0171379_529_1188	195
326	3300049568	Ga0501031_0318302	Ga0501031_0318302_163_795	195
327	3300049571	Ga0501034_0003187	Ga0501034_0003187_718_1350	195
328	3300049573	Ga0501037_0107530	Ga0501037_0107530_420_1079	195
329	3300049574	Ga0501038_0303644	Ga0501038_0303644_236_868	195
330	3300049575	Ga0501039_0215060	Ga0501039_0215060_831_1490	195
331	3300049576	Ga0501040_0046962	Ga0501040_0046962_1609_2277	195
332	3300049577	Ga0501041_0025954	Ga0501041_0025954_592_1260	195
333	3300049581	Ga0501047_0049307	Ga0501047_0049307_548_1180	195
334	3300049584	Ga0501068_0093685	Ga0501068_0093685_244_903	195
335	3300049584	Ga0501068_0153324	Ga0501068_0153324_61_729	195
336	3300049587	Ga0501071_0058589	Ga0501071_0058589_1490_2149	195
337	3300049587	Ga0501071_0417766	Ga0501071_0417766_288_956	195
338	3300049587	Ga0501071_0530958	Ga0501071_0530958_225_893	195
339	3300049588	Ga0501072_0174722	Ga0501072_0174722_129_797	195
340	3300049591	Ga0501075_0021131	Ga0501075_0021131_2923_3591	195
341	3300049592	Ga0501076_0006428	Ga0501076_0006428_7108_7776	195
342	3300049592	Ga0501076_0912244	Ga0501076_0912244_34_702	195
343	3300049593	Ga0501077_0172990	Ga0501077_0172990_468_1127	195
344	3300049742	Ga0501080_0099055	Ga0501080_0099055_1477_2136	195
345	3300049743	Ga0501081_0249995	Ga0501081_0249995_209_868	195
346	3300049822	Ga0501035_0126297	Ga0501035_0126297_253_885	195
347	3300049823	Ga0501044_0099054	Ga0501044_0099054_1936_2568	195
348	3300049824	Ga0501045_0253721	Ga0501045_0253721_354_1022	195
349	3300049824	Ga0501045_0283430	Ga0501045_0283430_270_938	195
350	3300049824	Ga0501045_0538278	Ga0501045_0538278_122_781	195
351	3300050507	nmdc:mga05p37_841286_c1	nmdc:mga05p37_841286_c1_187_846	195
352	3300053077	Ga0495601_0070721	Ga0495601_0070721_426_1109	195
353	3300053077	Ga0495601_0344310	Ga0495601_0344310_98_736	195
354	3300054114	Ga0501084_0065508	Ga0501084_0065508_1662_2330	195
355	3300054114	Ga0501084_0161154	Ga0501084_0161154_784_1443	195
356	3300061734	Ga0530510_0026212	Ga0530510_0026212_2225_2893	195
357	3300061734	Ga0530510_0261631	Ga0530510_0261631_324_983	195
358	iso_pu_bacteria	2956897341	2956899449	195
359	3300005458	Ga0070681_10075291	Ga0070681_100752912	196
360	3300005530	Ga0070679_100077820	Ga0070679_1000778203	196
361	3300005545	Ga0070695_100028528	Ga0070695_1000285281	196
362	3300005546	Ga0070696_100004166	Ga0070696_1000041664	196
363	3300025912	Ga0207707_10238927	Ga0207707_102389272	196
364	3300025921	Ga0207652_10224288	Ga0207652_102242883	196
365	3300027395	Ga0209996_1006237	Ga0209996_10062372	196
366	3300031251	Ga0265327_10064350	Ga0265327_100643502	196
367	3300031691	Ga0316579_10103304	Ga0316579_101033042	196
368	3300031727	Ga0316576_10148262	Ga0316576_101482622	196
369	3300035083	Ga0373926_0011412	Ga0373926_0011412_2290_2949	196
370	3300035111	Ga0373923_0204493	Ga0373923_0204493_98_757	196
371	3300035398	Ga0316574_0061807	Ga0316574_0061807_410_1069	196
372	3300049743	Ga0501081_0091730	Ga0501081_0091730_1258_1914	196
373	3300053104	Ga0500556_0001657	Ga0500556_0001657_1316_1945	196
374	3300053178	Ga0500637_0006868	Ga0500637_0006868_3183_3773	196
375	3300061734	Ga0530510_0174468	Ga0530510_0174468_725_1381	196
376	3300005353	Ga0070669_100042251	Ga0070669_1000422513	197
377	3300005563	Ga0068855_100001141	Ga0068855_10000114117	197
378	3300005840	Ga0068870_10071039	Ga0068870_100710392	197
379	3300025949	Ga0207667_10001982	Ga0207667_1000198217	197
380	3300028016	Ga0265354_1000744	Ga0265354_10007447	197
381	3300030878	Ga0265770_1000065	Ga0265770_100006510	197
382	3300031090	Ga0265760_10002521	Ga0265760_100025213	197
383	3300005546	Ga0070696_100000950	Ga0070696_1000009505	198
384	3300014326	Ga0157380_10004705	Ga0157380_1000470511	198
385	3300027876	Ga0209974_10154384	Ga0209974_101543841	198
386	3300049576	Ga0501040_0212765	Ga0501040_0212765_400_996	198
387	3300049741	Ga0501079_0234980	Ga0501079_0234980_166_762	198
388	3300003771	Ga0055526_1029300	Ga0055526_10293001	200
389	3300003775	Ga0055524_1001957	Ga0055524_10019575	200
390	3300003781	Ga0055536_1015795	Ga0055536_10157953	200
391	3300003791	Ga0055530_10002797	Ga0055530_100027972	200
392	3300003794	Ga0055531_10007143	Ga0055531_100071437	200
393	3300025284	Ga0209130_1002793	Ga0209130_10027937	200
394	3300025292	Ga0209676_1001097	Ga0209676_100109728	200
395	3300025292	Ga0209676_1002826	Ga0209676_10028266	200
396	3300025294	Ga0209025_1001408	Ga0209025_100140810	200
397	3300025294	Ga0209025_1047416	Ga0209025_10474162	200
398	3300025295	Ga0209564_1002248	Ga0209564_10022485	200
399	3300025297	Ga0209758_1051076	Ga0209758_10510762	200
400	3300025298	Ga0209050_1001060	Ga0209050_10010602	200
401	3300025299	Ga0209256_1002263	Ga0209256_100226311	200
402	3300025303	Ga0209051_1005499	Ga0209051_10054995	200
403	3300025304	Ga0209257_1000283	Ga0209257_100028323	200
404	3300025304	Ga0209257_1002547	Ga0209257_10025479	200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

11

119

0.84 PF01174

SNO

SNO glutamine amidotransferase family

17

212

0.83 PF00117

GATase

Glutamine amidotransferase class-I

12

211

0.81 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4gud-assembly1.cif.gz_A	crystal structure of amidotransferase hish from vibrio cholerae	0.9552	2	197
4gud-assembly2.cif.gz_B	crystal structure of amidotransferase hish from vibrio cholerae	0.9551	1	196
4gud-assembly1.cif.gz_A	crystal structure of amidotransferase hish from vibrio cholerae	0.9459	2	197
4gud-assembly2.cif.gz_B	crystal structure of amidotransferase hish from vibrio cholerae	0.932	1	196
1ka9-assembly1.cif.gz_H	imidazole glycerol phosphate synthase	0.8851	4	196

ID	Description	Score	Start	End	Superfamily
4gudA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9492	2	197	3.40.50.880
af_A0A1D6L7F2_93_266_3.40.50.880	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9462	33	184	3.40.50.880
af_Q9SZ30_59_284_3.40.50.880	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9447	1	196	3.40.50.880
4gudA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9445	2	197	3.40.50.880
af_A0A1D6H537_1_181_3.40.50.880	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain	0.9391	55	197	3.40.50.880

ID	Description	Score	Start	End	GO Terms
AF-A0A2W4U150-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH)	0.9936	1	195	GO:0000105 GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829
AF-A0A0S2G5I1-F1-model_v4	deleted	0.9934	18	198
AF-A0A1G0QUI8-F1-model_v4	Imidazole glycerol phosphate synthase, glutamine amidotransferase subunit	0.9931	112	197	GO:0000105 GO:0000107 GO:0004359 GO:0016829
AF-A0A848QA24-F1-model_v4	deleted	0.9924	44	197
AF-A0A160MYQ5-F1-model_v4	Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH)	0.9916	1	197	GO:0000105 GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829

Feature Viewer

pLDDT	pTM	Quality
96.11	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F435610

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

11

119

0.84

PF01174

SNO

SNO glutamine amidotransferase family

17

212

0.83

PF00117

GATase

Glutamine amidotransferase class-I

12

211

0.81

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map