F435354

General Info

Members Datasets Scaffolds Average Seq Length
403 210 806 72

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10128733|Ga0075366_101287332
Length 86
Sequence MSFGTKGGGNRREPTWRIPVGILTLLAGLGAYGLVIANVIAPLIAGWPALAQAPLYLVLGVIWLLPLRRFLIWMETGRWSPPSRDI

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
209 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
210 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 0.99
Rhizoplane 7.2
Rhizosphere 71.71
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10128733 3300006195 Bacteria 1527
2 SwRhRL2b_contig_504496 2162886007 Bacteria 817
3 JGI24751J29686_10001145 3300002459 Bacteria 5684
4 Ga0065704_10034390 3300005289 Bacteria 1713
5 Ga0065704_10373646 3300005289 Bacteria 782
6 Ga0065704_10717488 3300005289 Bacteria 554
7 Ga0065707_10587059 3300005295 Bacteria 698
8 Ga0070658_10001215 3300005327 Bacteria 22095
9 Ga0070658_10069113 3300005327 Bacteria 2889
10 Ga0070658_10153605 3300005327 Bacteria 1928
11 Ga0070658_10994628 3300005327 Bacteria 729
12 Ga0070690_100118348 3300005330 Bacteria 1776
13 Ga0070670_100174659 3300005331 Bacteria 1864
14 Ga0070670_100381015 3300005331 Bacteria 1242
15 Ga0070666_10012449 3300005335 Bacteria 5366
16 Ga0070666_10133844 3300005335 Bacteria 1724
17 Ga0070666_10257012 3300005335 Bacteria 1238
18 Ga0070666_10575525 3300005335 Bacteria 821
19 Ga0070682_100155795 3300005337 Bacteria 1572
20 Ga0070668_100083216 3300005347 Bacteria 2512
21 Ga0070668_100092479 3300005347 Bacteria 2386
22 Ga0070668_100126620 3300005347 Bacteria 2046
23 Ga0070668_100817530 3300005347 Bacteria 829
24 Ga0070668_101098872 3300005347 Bacteria 718
25 Ga0070669_100000083 3300005353 Bacteria 91096
26 Ga0070669_100004990 3300005353 Bacteria 9590
27 Ga0070671_100000107 3300005355 Bacteria 52884
28 Ga0070671_100000821 3300005355 Bacteria 22505
29 Ga0070671_100103298 3300005355 Bacteria 2391
30 Ga0070671_100414683 3300005355 Bacteria 1153
31 Ga0070671_100434095 3300005355 Bacteria 1126
32 Ga0070659_100526498 3300005366 Bacteria 1010
33 Ga0070667_100003794 3300005367 Bacteria 12854
34 Ga0070667_100080410 3300005367 Bacteria 2788
35 Ga0070667_100092348 3300005367 Bacteria 2604
36 Ga0070667_101112325 3300005367 Bacteria 739
37 Ga0070700_100428389 3300005441 Bacteria 1001
38 Ga0070700_100662316 3300005441 Bacteria 826
39 Ga0070663_100840448 3300005455 Bacteria 790
40 Ga0070685_10172578 3300005466 Bacteria 1387
41 Ga0070686_101478897 3300005544 Bacteria 572
42 Ga0070665_100001304 3300005548 Bacteria 29776
43 Ga0070665_100078639 3300005548 Bacteria 3304
44 Ga0070665_100086872 3300005548 Bacteria 3133
45 Ga0070665_102092785 3300005548 Bacteria 571
46 Ga0070704_102058201 3300005549 Bacteria 530
47 Ga0068855_100041020 3300005563 Bacteria 5488
48 Ga0068855_100576723 3300005563 Bacteria 1215
49 Ga0068855_102004917 3300005563 Bacteria 584
50 Ga0068857_101184402 3300005577 Bacteria 739
51 Ga0068857_101853690 3300005577 Bacteria 590
52 Ga0068854_100001198 3300005578 Bacteria 15548
53 Ga0068854_100639338 3300005578 Bacteria 912
54 Ga0068856_100380675 3300005614 Bacteria 1430
55 Ga0068856_100649641 3300005614 Bacteria 1075
56 Ga0068852_100000556 3300005616 Bacteria 24518
57 Ga0068852_100400852 3300005616 Bacteria 1349
58 Ga0068852_100417130 3300005616 Bacteria 1323
59 Ga0068852_100611152 3300005616 Bacteria 1095
60 Ga0068852_100946139 3300005616 Bacteria 879
61 Ga0068859_100014815 3300005617 Bacteria 7831
62 Ga0068859_100837166 3300005617 Bacteria 1006
63 Ga0068859_101182106 3300005617 Bacteria 842
64 Ga0068864_100003590 3300005618 Bacteria 12826
65 Ga0068864_100095481 3300005618 Bacteria 2629
66 Ga0068864_100153803 3300005618 Bacteria 2086
67 Ga0068851_10420130 3300005834 Bacteria 789
68 Ga0068851_10455939 3300005834 Bacteria 760
69 Ga0068851_10499023 3300005834 Bacteria 729
70 Ga0068863_100000058 3300005841 Bacteria 123096
71 Ga0068863_100018452 3300005841 Bacteria 6676
72 Ga0068858_100000686 3300005842 Bacteria 35340
73 Ga0068858_100018582 3300005842 Bacteria 6510
74 Ga0068858_101980467 3300005842 Bacteria 576
75 Ga0068860_100000057 3300005843 Bacteria 201847
76 Ga0068860_100024439 3300005843 Bacteria 5838
77 Ga0068860_100062115 3300005843 Bacteria 3550
78 Ga0068860_100120191 3300005843 Bacteria 2515
79 Ga0068862_100447901 3300005844 Bacteria 1217
80 Ga0068862_101069126 3300005844 Bacteria 801
81 Ga0068862_101508845 3300005844 Bacteria 677
82 Ga0075365_10282812 3300006038 Bacteria 1167
83 Ga0075368_10001747 3300006042 Bacteria 6990
84 Ga0075363_100009725 3300006048 Bacteria 4529
85 Ga0075367_10071107 3300006178 Bacteria 2093
86 Ga0075369_10378737 3300006186 Bacteria 666
87 Ga0075366_10024584 3300006195 Bacteria 3513
88 Ga0075366_10085729 3300006195 Bacteria 1884
89 Ga0075366_10137966 3300006195 Bacteria 1473
90 Ga0075366_10800050 3300006195 Bacteria 586
91 Ga0075370_10000017 3300006353 Bacteria 60451
92 Ga0075370_10005269 3300006353 Bacteria 6404
93 Ga0075370_11047495 3300006353 Bacteria 500
94 Ga0097620_100014815 3300006931 Bacteria 7831
95 Ga0097620_100837167 3300006931 Bacteria 1006
96 Ga0097620_101182132 3300006931 Bacteria 842
97 Ga0079104_1027530 3300006946 Bacteria 1457
98 Ga0079104_1059687 3300006946 Bacteria 825
99 Ga0079104_1103862 3300006946 Bacteria 567
100 Ga0075435_101178212 3300007076 Bacteria 670
101 Ga0105251_10050812 3300009011 Bacteria 1979
102 Ga0105251_10262656 3300009011 Bacteria 779
103 Ga0105240_10004857 3300009093 Bacteria 20241
104 Ga0105240_11912550 3300009093 Bacteria 617
105 Ga0105240_11954140 3300009093 Bacteria 610
106 Ga0105247_10321740 3300009101 Bacteria 1079
107 Ga0105247_10902544 3300009101 Bacteria 682
108 Ga0105243_10562519 3300009148 Bacteria 1091
109 Ga0105241_11057230 3300009174 Bacteria 762
110 Ga0105248_10033989 3300009177 Bacteria 5700
111 Ga0105248_10140142 3300009177 Bacteria 2728
112 Ga0105248_10643488 3300009177 Bacteria 1196
113 Ga0105248_13011842 3300009177 Bacteria 537
114 Ga0105237_10792166 3300009545 Bacteria 955
115 Ga0105238_10650898 3300009551 Bacteria 1064
116 Ga0105249_10086485 3300009553 Bacteria 2924
117 Ga0105249_12037179 3300009553 Bacteria 647
118 Ga0105239_10820405 3300010375 Bacteria 1066
119 Ga0157371_10291666 3300013102 Bacteria 1180
120 Ga0157370_11432307 3300013104 Bacteria 621
121 Ga0163162_10039741 3300013306 Bacteria 4702
122 Ga0163162_10519621 3300013306 Bacteria 1320
123 Ga0157372_11837312 3300013307 Bacteria 697
124 Ga0163163_12034490 3300014325 Bacteria 634
125 Ga0157380_10360253 3300014326 Bacteria 1364
126 Ga0157380_11255568 3300014326 Bacteria 786
127 Ga0157380_12954668 3300014326 Bacteria 541
128 Ga0163161_10021318 3300017792 Bacteria 4555
129 Ga0207697_10017034 3300025315 Bacteria 2989
130 Ga0207697_10170930 3300025315 Bacteria 950
131 Ga0207697_10279041 3300025315 Bacteria 741
132 Ga0207656_10056706 3300025321 Bacteria 1708
133 Ga0207713_1023614 3300025735 Bacteria 2889
134 Ga0207713_1124988 3300025735 Bacteria 858
135 Ga0207682_10019984 3300025893 Bacteria 2626
136 Ga0207710_10687893 3300025900 Bacteria 536
137 Ga0207688_10174827 3300025901 Bacteria 1278
138 Ga0207680_10086931 3300025903 Bacteria 1978
139 Ga0207680_10105810 3300025903 Bacteria 1816
140 Ga0207680_11039913 3300025903 Bacteria 586
141 Ga0207647_10002412 3300025904 Bacteria 14168
142 Ga0207705_10000023 3300025909 Bacteria 301755
143 Ga0207705_10305795 3300025909 Bacteria 1220
144 Ga0207705_10455706 3300025909 Bacteria 992
145 Ga0207654_10772136 3300025911 Bacteria 693
146 Ga0207695_10880011 3300025913 Bacteria 775
147 Ga0207695_11363290 3300025913 Bacteria 589
148 Ga0207671_10825582 3300025914 Bacteria 734
149 Ga0207681_10000060 3300025923 Bacteria 102672
150 Ga0207681_10002166 3300025923 Bacteria 12517
151 Ga0207650_10212744 3300025925 Bacteria 1553
152 Ga0207650_10318594 3300025925 Bacteria 1273
153 Ga0207650_10870418 3300025925 Bacteria 765
154 Ga0207644_10000004 3300025931 Bacteria 566613
155 Ga0207644_10003893 3300025931 Bacteria 9673
156 Ga0207644_10204386 3300025931 Bacteria 1559
157 Ga0207644_10524259 3300025931 Bacteria 979
158 Ga0207690_11154707 3300025932 Bacteria 646
159 Ga0207706_11321451 3300025933 Bacteria 595
160 Ga0207709_10255541 3300025935 Bacteria 1282
161 Ga0207711_10029820 3300025941 Bacteria 4602
162 Ga0207711_10178072 3300025941 Bacteria 1932
163 Ga0207711_10301371 3300025941 Bacteria 1478
164 Ga0207711_11330787 3300025941 Bacteria 661
165 Ga0207667_10010304 3300025949 Bacteria 10935
166 Ga0207667_10029580 3300025949 Bacteria 5939
167 Ga0207667_10070608 3300025949 Bacteria 3634
168 Ga0207667_10476501 3300025949 Bacteria 1267
169 Ga0207712_10821555 3300025961 Bacteria 818
170 Ga0207712_11395672 3300025961 Bacteria 627
171 Ga0207712_11712409 3300025961 Bacteria 563
172 Ga0207668_10074189 3300025972 Bacteria 2441
173 Ga0207668_10319640 3300025972 Bacteria 1287
174 Ga0207668_10363153 3300025972 Bacteria 1214
175 Ga0207640_10015155 3300025981 Bacteria 4456
176 Ga0207640_11298943 3300025981 Bacteria 649
177 Ga0207658_10004438 3300025986 Bacteria 9757
178 Ga0207658_11022263 3300025986 Bacteria 754
179 Ga0207658_11429678 3300025986 Bacteria 632
180 Ga0207703_10002816 3300026035 Bacteria 14836
181 Ga0207703_10031630 3300026035 Bacteria 4186
182 Ga0207703_10275043 3300026035 Bacteria 1527
183 Ga0207678_10325581 3300026067 Bacteria 1323
184 Ga0207702_10292713 3300026078 Bacteria 1543
185 Ga0207702_10941363 3300026078 Bacteria 856
186 Ga0207641_10001760 3300026088 Bacteria 20872
187 Ga0207641_10002342 3300026088 Bacteria 17531
188 Ga0207676_10001559 3300026095 Bacteria 16906
189 Ga0207676_10155266 3300026095 Bacteria 1976
190 Ga0207676_11071168 3300026095 Bacteria 796
191 Ga0207674_10090947 3300026116 Bacteria 3043
192 Ga0207674_10275606 3300026116 Bacteria 1630
193 Ga0207674_10424767 3300026116 Bacteria 1284
194 Ga0207674_11832654 3300026116 Bacteria 573
195 Ga0207698_10000148 3300026142 Bacteria 44847
196 Ga0207698_10058300 3300026142 Bacteria 2992
197 Ga0207698_10379657 3300026142 Bacteria 1344
198 Ga0207698_10462459 3300026142 Bacteria 1227
199 Ga0207698_10600727 3300026142 Bacteria 1085
200 Ga0207698_11108009 3300026142 Bacteria 804
201 Ga0207698_12536073 3300026142 Bacteria 523
202 Ga0209281_1029052 3300027111 Bacteria 1000
203 Ga0209813_10000290 3300027866 Bacteria 14003
204 Ga0209974_10174799 3300027876 Bacteria 784
205 Ga0209974_10440968 3300027876 Unclassified 516
206 Ga0207428_10101587 3300027907 Bacteria 2222
207 Ga0268266_10001026 3300028379 Bacteria 35190
208 Ga0268266_10025645 3300028379 Bacteria 5014
209 Ga0268265_10004067 3300028380 Bacteria 10281
210 Ga0268265_10058820 3300028380 Bacteria 2937
211 Ga0268265_10106809 3300028380 Bacteria 2275
212 Ga0268265_10562316 3300028380 Bacteria 1084
213 Ga0268264_10000078 3300028381 Bacteria 249595
214 Ga0268264_10014237 3300028381 Bacteria 6539
215 Ga0268264_10018792 3300028381 Bacteria 5650
216 Ga0268264_10160836 3300028381 Bacteria 2023
217 Ga0307508_10039219 3300031616 Bacteria 4256
218 Ga0307516_10282345 3300031730 Bacteria 1342
219 Ga0307405_10263876 3300031731 Bacteria 1288
220 Ga0307405_10677176 3300031731 Bacteria 851
221 Ga0307405_12151370 3300031731 Bacteria 501
222 Ga0307413_10059012 3300031824 Bacteria 2355
223 Ga0307413_10182137 3300031824 Bacteria 1499
224 Ga0307413_10860305 3300031824 Bacteria 767
225 Ga0307413_11306991 3300031824 Bacteria 635
226 Ga0307410_10044042 3300031852 Bacteria 2962
227 Ga0307410_10589211 3300031852 Bacteria 926
228 Ga0307410_10660622 3300031852 Bacteria 878
229 Ga0307406_11960522 3300031901 Bacteria 523
230 Ga0307406_12058477 3300031901 Bacteria 511
231 Ga0307407_10492376 3300031903 Bacteria 897
232 Ga0307412_10085706 3300031911 Bacteria 2190
233 Ga0307412_10415234 3300031911 Bacteria 1099
234 Ga0307412_10554519 3300031911 Bacteria 966
235 Ga0307409_100208905 3300031995 Bacteria 1753
236 Ga0307409_102474275 3300031995 Bacteria 548
237 Ga0307416_100525429 3300032002 Bacteria 1252
238 Ga0307416_102774541 3300032002 Bacteria 586
239 Ga0307414_10086276 3300032004 Bacteria 2315
240 Ga0307414_10200971 3300032004 Bacteria 1621
241 Ga0307414_10683373 3300032004 Bacteria 928
242 Ga0307414_10911569 3300032004 Bacteria 806
243 Ga0307414_11380205 3300032004 Bacteria 654
244 Ga0307411_10146193 3300032005 Bacteria 1750
245 Ga0307411_10445120 3300032005 Bacteria 1082
246 Ga0307411_12023990 3300032005 Bacteria 538
247 Ga0307415_101102773 3300032126 Bacteria 743
248 Ga0307415_101525933 3300032126 Bacteria 640
249 Ga0373948_0009089 3300034817 Bacteria 1707
250 Ga0373928_0006646 3300035084 Bacteria 2224
251 Ga0373962_0012492 3300035242 Bacteria 2142
252 Ga0316574_0366868 3300035398 Bacteria 910
253 Ga0373931_0011483 3300035691 Bacteria 4281
254 Ga0316584_0130197 3300036712 Bacteria 1880
255 Ga0451793_1181673 3300041452 Bacteria 617
256 Ga0451800_0096163 3300041459 Bacteria 577
257 Ga0451833_0737400 3300041491 Bacteria 650
258 Ga0451835_0998910 3300041492 Bacteria 765
259 Ga0451837_1117150 3300041494 Bacteria 759
260 Ga0451841_0309541 3300041498 Bacteria 1083
261 Ga0451841_0556154 3300041498 Bacteria 568
262 Ga0451843_0901313 3300041509 Bacteria 1058
263 Ga0451853_2341657 3300041512 Bacteria 677
264 Ga0451577_0714537 3300042876 Bacteria 907
265 Ga0453684_0337987 3300044712 Bacteria 1701
266 Ga0451576_0092308 3300045051 Bacteria 3149
267 Ga0495627_000905 3300046453 Bacteria 20645
268 Ga0495638_0200584 3300046460 Bacteria 1126
269 Ga0495650_0001649 3300046471 Bacteria 20636
270 Ga0495650_0101358 3300046471 Bacteria 1081
271 Ga0495596_0000212 3300046500 Bacteria 40024
272 Ga0495596_0006909 3300046500 Bacteria 5171
273 Ga0495607_0007356 3300046501 Bacteria 7628
274 Ga0495607_0013607 3300046501 Bacteria 5327
275 Ga0495583_0031604 3300046506 Bacteria 2565
276 Ga0495606_0011167 3300046507 Bacteria 7352
277 Ga0495610_0000018 3300046512 Bacteria 355044
278 Ga0495610_0160601 3300046512 Bacteria 950
279 Ga0495620_0008354 3300046515 Bacteria 5563
280 Ga0495620_0072126 3300046515 Bacteria 1410
281 Ga0495631_0367879 3300046518 Bacteria 612
282 Ga0495632_0000758 3300046519 Bacteria 29015
283 Ga0495632_0011531 3300046519 Bacteria 5152
284 Ga0495637_0322578 3300046520 Bacteria 545
285 Ga0495643_0012821 3300046522 Bacteria 5043
286 Ga0495643_0015084 3300046522 Bacteria 4579
287 Ga0495643_0024821 3300046522 Bacteria 3397
288 Ga0495663_0229638 3300046525 Bacteria 654
289 Ga0495654_0098342 3300046530 Bacteria 1350
290 Ga0495654_0231515 3300046530 Bacteria 777
291 Ga0495609_0056265 3300046538 Bacteria 1743
292 Ga0495633_0465769 3300046558 Bacteria 570
293 Ga0495668_0162506 3300046616 Bacteria 1223
294 Ga0495668_0229806 3300046616 Bacteria 1016
295 Ga0495668_0745137 3300046616 Bacteria 542
296 Ga0495625_0071282 3300046660 Bacteria 2439
297 Ga0495625_0109193 3300046660 Bacteria 1892
298 Ga0495661_0251432 3300046665 Bacteria 902
299 Ga0495671_0066504 3300046692 Bacteria 1774
300 Ga0495681_0000020 3300047470 Bacteria 170007
301 Ga0495681_0130152 3300047470 Bacteria 1072
302 Ga0495626_0002004 3300048091 Bacteria 15016
303 Ga0496101_0014017 3300048904 Bacteria 5384
304 Ga0496102_0350419 3300048905 Bacteria 1390
305 Ga0496102_0408180 3300048905 Bacteria 1276
306 Ga0496103_0022253 3300048906 Bacteria 3815
307 Ga0496103_0108976 3300048906 Bacteria 1758
308 Ga0496103_0343157 3300048906 Bacteria 960
309 Ga0496103_0644442 3300048906 Bacteria 673
310 Ga0496104_0006692 3300048907 Bacteria 10143
311 Ga0496104_0165217 3300048907 Bacteria 2122
312 Ga0496105_0010029 3300048908 Bacteria 7434
313 Ga0496105_0981937 3300048908 Bacteria 632
314 Ga0496106_0014441 3300048909 Bacteria 5835
315 Ga0496106_1176596 3300048909 Bacteria 599
316 Ga0496107_0129781 3300048910 Bacteria 1860
317 Ga0496108_0081968 3300048911 Bacteria 2734
318 Ga0496109_0257344 3300048912 Bacteria 1644
319 Ga0496109_0507477 3300048912 Bacteria 1138
320 Ga0496110_0038631 3300048913 Bacteria 4154
321 Ga0496110_0512753 3300048913 Bacteria 1091
322 Ga0496110_1586872 3300048913 Bacteria 564
323 Ga0496111_0050658 3300048914 Bacteria 2996
324 Ga0496111_0542406 3300048914 Bacteria 854
325 Ga0496112_0145252 3300048915 Bacteria 2340
326 Ga0496113_0013821 3300048916 Bacteria 5484
327 Ga0496113_0751999 3300048916 Bacteria 776
328 Ga0496114_0115920 3300048917 Bacteria 2299
329 Ga0496115_1152444 3300048918 Bacteria 585
330 Ga0496116_0000017 3300048919 Bacteria 554463
331 Ga0496116_0057337 3300048919 Bacteria 2547
332 Ga0496117_0055108 3300048920 Bacteria 2780
333 Ga0496117_0321605 3300048920 Bacteria 810
334 Ga0496118_0026768 3300048921 Bacteria 4903
335 Ga0496118_0028750 3300048921 Bacteria 4675
336 Ga0496118_0054567 3300048921 Bacteria 3025
337 Ga0496119_0051833 3300048922 Bacteria 2518
338 Ga0496119_0554651 3300048922 Bacteria 528
339 Ga0496121_0000022 3300048924 Bacteria 472849
340 Ga0496121_0000517 3300048924 Bacteria 73561
341 Ga0496121_0001845 3300048924 Bacteria 34131
342 Ga0496121_0133862 3300048924 Bacteria 1850
343 Ga0496122_0004569 3300048925 Bacteria 17058
344 Ga0496122_0017245 3300048925 Bacteria 6767
345 Ga0496123_0001873 3300048926 Bacteria 27552
346 Ga0496123_0003746 3300048926 Bacteria 16672
347 Ga0496123_0506656 3300048926 Bacteria 526
348 Ga0496124_0114794 3300048927 Bacteria 2162
349 Ga0496124_0193315 3300048927 Bacteria 1555
350 Ga0496125_0035140 3300048928 Bacteria 4403
351 Ga0496126_0000359 3300048929 Bacteria 94946
352 Ga0496126_0025110 3300048929 Bacteria 5740
353 Ga0496126_0108182 3300048929 Bacteria 2424
354 Ga0501034_0134154 3300049571 Bacteria 2457
355 Ga0501034_0397260 3300049571 Bacteria 1302
356 Ga0501034_1101610 3300049571 Bacteria 675
357 Ga0501038_0616404 3300049574 Bacteria 820
358 Ga0501039_0422164 3300049575 Bacteria 1047
359 Ga0501042_0405847 3300049578 Bacteria 987
360 Ga0501043_0756023 3300049579 Bacteria 706
361 Ga0501047_0402831 3300049581 Bacteria 1201
362 Ga0501224_022186 3300049664 Bacteria 947
363 Ga0501249_006704 3300049679 Bacteria 2372
364 Ga0501044_0000053 3300049823 Bacteria 141732
365 Ga0501044_0167851 3300049823 Bacteria 2168
366 Ga0501044_0672144 3300049823 Bacteria 923
367 nmdc:mga03683_366_c1 3300050489 Bacteria 13036
368 nmdc:mga03n38_708560_c1 3300050490 Bacteria 581
369 nmdc:mga00v17_22642_c1 3300050491 Bacteria 3628
370 nmdc:mga0yw44_72278_c1 3300050492 Bacteria 2144
371 nmdc:mga0k408_10882_c1 3300050493 Bacteria 4935
372 nmdc:mga0k408_3237_c1 3300050493 Bacteria 8619
373 nmdc:mga0k408_84659_c1 3300050493 Bacteria 1860
374 nmdc:mga0k408_99278_c1 3300050493 Bacteria 1716
375 nmdc:mga06z11_4631_c1 3300050494 Bacteria 5427
376 nmdc:mga04h51_486_c1 3300050495 Bacteria 9497
377 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
378 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
379 nmdc:mga07m45_632214_c1 3300050496 Bacteria 617
380 nmdc:mga07m45_7275_c1 3300050496 Bacteria 5647
381 nmdc:mga0sz30_582_c1 3300050516 Bacteria 13763
382 Ga0500643_021486 3300053087 Bacteria 2091
383 Ga0500643_103508 3300053087 Bacteria 771
384 Ga0500641_0116891 3300053096 Bacteria 1148
385 Ga0500555_024401 3300053103 Bacteria 1733
386 Ga0500595_043691 3300053119 Bacteria 1425
387 Ga0500595_064154 3300053119 Bacteria 1102
388 Ga0500607_000048 3300053121 Bacteria 82363
389 Ga0500642_0482802 3300053130 Bacteria 526
390 Ga0500559_0000473 3300053136 Bacteria 28659
391 Ga0500559_0001130 3300053136 Bacteria 16070
392 Ga0500564_208221 3300053138 Bacteria 799
393 Ga0500568_0219140 3300053139 Bacteria 695
394 Ga0500590_000337 3300053148 Bacteria 15301
395 Ga0500590_022401 3300053148 Bacteria 3280
396 Ga0500622_0002066 3300053156 Bacteria 14958
397 Ga0500637_0033643 3300053178 Bacteria 2864
398 Ga0500625_128371 3300053729 Bacteria 1003
399 Ga0500645_003479 3300053730 Bacteria 6368
400 Ga0500645_006732 3300053730 Bacteria 4070
401 2511128119 2510917021 Bacteria 5705459
402 3000866276 3000865235 Bacteria 3106258
403 8054307095 8054302542 Bacteria 5698134
404 Ga0075366_10128733
405 SwRhRL2b_contig_504496
406 JGI24751J29686_10001145
407 Ga0065704_10034390
408 Ga0065704_10373646
409 Ga0065704_10717488
410 Ga0065707_10587059
411 Ga0070658_10001215
412 Ga0070658_10069113
413 Ga0070658_10153605
414 Ga0070658_10994628
415 Ga0070690_100118348
416 Ga0070670_100174659
417 Ga0070670_100381015
418 Ga0070666_10012449
419 Ga0070666_10133844
420 Ga0070666_10257012
421 Ga0070666_10575525
422 Ga0070682_100155795
423 Ga0070668_100083216
424 Ga0070668_100092479
425 Ga0070668_100126620
426 Ga0070668_100817530
427 Ga0070668_101098872
428 Ga0070669_100000083
429 Ga0070669_100004990
430 Ga0070671_100000107
431 Ga0070671_100000821
432 Ga0070671_100103298
433 Ga0070671_100414683
434 Ga0070671_100434095
435 Ga0070659_100526498
436 Ga0070667_100003794
437 Ga0070667_100080410
438 Ga0070667_100092348
439 Ga0070667_101112325
440 Ga0070700_100428389
441 Ga0070700_100662316
442 Ga0070663_100840448
443 Ga0070685_10172578
444 Ga0070686_101478897
445 Ga0070665_100001304
446 Ga0070665_100078639
447 Ga0070665_100086872
448 Ga0070665_102092785
449 Ga0070704_102058201
450 Ga0068855_100041020
451 Ga0068855_100576723
452 Ga0068855_102004917
453 Ga0068857_101184402
454 Ga0068857_101853690
455 Ga0068854_100001198
456 Ga0068854_100639338
457 Ga0068856_100380675
458 Ga0068856_100649641
459 Ga0068852_100000556
460 Ga0068852_100400852
461 Ga0068852_100417130
462 Ga0068852_100611152
463 Ga0068852_100946139
464 Ga0068859_100014815
465 Ga0068859_100837166
466 Ga0068859_101182106
467 Ga0068864_100003590
468 Ga0068864_100095481
469 Ga0068864_100153803
470 Ga0068851_10420130
471 Ga0068851_10455939
472 Ga0068851_10499023
473 Ga0068863_100000058
474 Ga0068863_100018452
475 Ga0068858_100000686
476 Ga0068858_100018582
477 Ga0068858_101980467
478 Ga0068860_100000057
479 Ga0068860_100024439
480 Ga0068860_100062115
481 Ga0068860_100120191
482 Ga0068862_100447901
483 Ga0068862_101069126
484 Ga0068862_101508845
485 Ga0075365_10282812
486 Ga0075368_10001747
487 Ga0075363_100009725
488 Ga0075367_10071107
489 Ga0075369_10378737
490 Ga0075366_10024584
491 Ga0075366_10085729
492 Ga0075366_10137966
493 Ga0075366_10800050
494 Ga0075370_10000017
495 Ga0075370_10005269
496 Ga0075370_11047495
497 Ga0097620_100014815
498 Ga0097620_100837167
499 Ga0097620_101182132
500 Ga0079104_1027530
501 Ga0079104_1059687
502 Ga0079104_1103862
503 Ga0075435_101178212
504 Ga0105251_10050812
505 Ga0105251_10262656
506 Ga0105240_10004857
507 Ga0105240_11912550
508 Ga0105240_11954140
509 Ga0105247_10321740
510 Ga0105247_10902544
511 Ga0105243_10562519
512 Ga0105241_11057230
513 Ga0105248_10033989
514 Ga0105248_10140142
515 Ga0105248_10643488
516 Ga0105248_13011842
517 Ga0105237_10792166
518 Ga0105238_10650898
519 Ga0105249_10086485
520 Ga0105249_12037179
521 Ga0105239_10820405
522 Ga0157371_10291666
523 Ga0157370_11432307
524 Ga0163162_10039741
525 Ga0163162_10519621
526 Ga0157372_11837312
527 Ga0163163_12034490
528 Ga0157380_10360253
529 Ga0157380_11255568
530 Ga0157380_12954668
531 Ga0163161_10021318
532 Ga0207697_10017034
533 Ga0207697_10170930
534 Ga0207697_10279041
535 Ga0207656_10056706
536 Ga0207713_1023614
537 Ga0207713_1124988
538 Ga0207682_10019984
539 Ga0207710_10687893
540 Ga0207688_10174827
541 Ga0207680_10086931
542 Ga0207680_10105810
543 Ga0207680_11039913
544 Ga0207647_10002412
545 Ga0207705_10000023
546 Ga0207705_10305795
547 Ga0207705_10455706
548 Ga0207654_10772136
549 Ga0207695_10880011
550 Ga0207695_11363290
551 Ga0207671_10825582
552 Ga0207681_10000060
553 Ga0207681_10002166
554 Ga0207650_10212744
555 Ga0207650_10318594
556 Ga0207650_10870418
557 Ga0207644_10000004
558 Ga0207644_10003893
559 Ga0207644_10204386
560 Ga0207644_10524259
561 Ga0207690_11154707
562 Ga0207706_11321451
563 Ga0207709_10255541
564 Ga0207711_10029820
565 Ga0207711_10178072
566 Ga0207711_10301371
567 Ga0207711_11330787
568 Ga0207667_10010304
569 Ga0207667_10029580
570 Ga0207667_10070608
571 Ga0207667_10476501
572 Ga0207712_10821555
573 Ga0207712_11395672
574 Ga0207712_11712409
575 Ga0207668_10074189
576 Ga0207668_10319640
577 Ga0207668_10363153
578 Ga0207640_10015155
579 Ga0207640_11298943
580 Ga0207658_10004438
581 Ga0207658_11022263
582 Ga0207658_11429678
583 Ga0207703_10002816
584 Ga0207703_10031630
585 Ga0207703_10275043
586 Ga0207678_10325581
587 Ga0207702_10292713
588 Ga0207702_10941363
589 Ga0207641_10001760
590 Ga0207641_10002342
591 Ga0207676_10001559
592 Ga0207676_10155266
593 Ga0207676_11071168
594 Ga0207674_10090947
595 Ga0207674_10275606
596 Ga0207674_10424767
597 Ga0207674_11832654
598 Ga0207698_10000148
599 Ga0207698_10058300
600 Ga0207698_10379657
601 Ga0207698_10462459
602 Ga0207698_10600727
603 Ga0207698_11108009
604 Ga0207698_12536073
605 Ga0209281_1029052
606 Ga0209813_10000290
607 Ga0209974_10174799
608 Ga0209974_10440968
609 Ga0207428_10101587
610 Ga0268266_10001026
611 Ga0268266_10025645
612 Ga0268265_10004067
613 Ga0268265_10058820
614 Ga0268265_10106809
615 Ga0268265_10562316
616 Ga0268264_10000078
617 Ga0268264_10014237
618 Ga0268264_10018792
619 Ga0268264_10160836
620 Ga0307508_10039219
621 Ga0307516_10282345
622 Ga0307405_10263876
623 Ga0307405_10677176
624 Ga0307405_12151370
625 Ga0307413_10059012
626 Ga0307413_10182137
627 Ga0307413_10860305
628 Ga0307413_11306991
629 Ga0307410_10044042
630 Ga0307410_10589211
631 Ga0307410_10660622
632 Ga0307406_11960522
633 Ga0307406_12058477
634 Ga0307407_10492376
635 Ga0307412_10085706
636 Ga0307412_10415234
637 Ga0307412_10554519
638 Ga0307409_100208905
639 Ga0307409_102474275
640 Ga0307416_100525429
641 Ga0307416_102774541
642 Ga0307414_10086276
643 Ga0307414_10200971
644 Ga0307414_10683373
645 Ga0307414_10911569
646 Ga0307414_11380205
647 Ga0307411_10146193
648 Ga0307411_10445120
649 Ga0307411_12023990
650 Ga0307415_101102773
651 Ga0307415_101525933
652 Ga0373948_0009089
653 Ga0373928_0006646
654 Ga0373962_0012492
655 Ga0316574_0366868
656 Ga0373931_0011483
657 Ga0316584_0130197
658 Ga0451793_1181673
659 Ga0451800_0096163
660 Ga0451833_0737400
661 Ga0451835_0998910
662 Ga0451837_1117150
663 Ga0451841_0309541
664 Ga0451841_0556154
665 Ga0451843_0901313
666 Ga0451853_2341657
667 Ga0451577_0714537
668 Ga0453684_0337987
669 Ga0451576_0092308
670 Ga0495627_000905
671 Ga0495638_0200584
672 Ga0495650_0001649
673 Ga0495650_0101358
674 Ga0495596_0000212
675 Ga0495596_0006909
676 Ga0495607_0007356
677 Ga0495607_0013607
678 Ga0495583_0031604
679 Ga0495606_0011167
680 Ga0495610_0000018
681 Ga0495610_0160601
682 Ga0495620_0008354
683 Ga0495620_0072126
684 Ga0495631_0367879
685 Ga0495632_0000758
686 Ga0495632_0011531
687 Ga0495637_0322578
688 Ga0495643_0012821
689 Ga0495643_0015084
690 Ga0495643_0024821
691 Ga0495663_0229638
692 Ga0495654_0098342
693 Ga0495654_0231515
694 Ga0495609_0056265
695 Ga0495633_0465769
696 Ga0495668_0162506
697 Ga0495668_0229806
698 Ga0495668_0745137
699 Ga0495625_0071282
700 Ga0495625_0109193
701 Ga0495661_0251432
702 Ga0495671_0066504
703 Ga0495681_0000020
704 Ga0495681_0130152
705 Ga0495626_0002004
706 Ga0496101_0014017
707 Ga0496102_0350419
708 Ga0496102_0408180
709 Ga0496103_0022253
710 Ga0496103_0108976
711 Ga0496103_0343157
712 Ga0496103_0644442
713 Ga0496104_0006692
714 Ga0496104_0165217
715 Ga0496105_0010029
716 Ga0496105_0981937
717 Ga0496106_0014441
718 Ga0496106_1176596
719 Ga0496107_0129781
720 Ga0496108_0081968
721 Ga0496109_0257344
722 Ga0496109_0507477
723 Ga0496110_0038631
724 Ga0496110_0512753
725 Ga0496110_1586872
726 Ga0496111_0050658
727 Ga0496111_0542406
728 Ga0496112_0145252
729 Ga0496113_0013821
730 Ga0496113_0751999
731 Ga0496114_0115920
732 Ga0496115_1152444
733 Ga0496116_0000017
734 Ga0496116_0057337
735 Ga0496117_0055108
736 Ga0496117_0321605
737 Ga0496118_0026768
738 Ga0496118_0028750
739 Ga0496118_0054567
740 Ga0496119_0051833
741 Ga0496119_0554651
742 Ga0496121_0000022
743 Ga0496121_0000517
744 Ga0496121_0001845
745 Ga0496121_0133862
746 Ga0496122_0004569
747 Ga0496122_0017245
748 Ga0496123_0001873
749 Ga0496123_0003746
750 Ga0496123_0506656
751 Ga0496124_0114794
752 Ga0496124_0193315
753 Ga0496125_0035140
754 Ga0496126_0000359
755 Ga0496126_0025110
756 Ga0496126_0108182
757 Ga0501034_0134154
758 Ga0501034_0397260
759 Ga0501034_1101610
760 Ga0501038_0616404
761 Ga0501039_0422164
762 Ga0501042_0405847
763 Ga0501043_0756023
764 Ga0501047_0402831
765 Ga0501224_022186
766 Ga0501249_006704
767 Ga0501044_0000053
768 Ga0501044_0167851
769 Ga0501044_0672144
770 nmdc:mga03683_366_c1
771 nmdc:mga03n38_708560_c1
772 nmdc:mga00v17_22642_c1
773 nmdc:mga0yw44_72278_c1
774 nmdc:mga0k408_10882_c1
775 nmdc:mga0k408_3237_c1
776 nmdc:mga0k408_84659_c1
777 nmdc:mga0k408_99278_c1
778 nmdc:mga06z11_4631_c1
779 nmdc:mga04h51_486_c1
780 nmdc:mga07m45_3_c1
781 nmdc:mga07m45_4_c1
782 nmdc:mga07m45_632214_c1
783 nmdc:mga07m45_7275_c1
784 nmdc:mga0sz30_582_c1
785 Ga0500643_021486
786 Ga0500643_103508
787 Ga0500641_0116891
788 Ga0500555_024401
789 Ga0500595_043691
790 Ga0500595_064154
791 Ga0500607_000048
792 Ga0500642_0482802
793 Ga0500559_0000473
794 Ga0500559_0001130
795 Ga0500564_208221
796 Ga0500568_0219140
797 Ga0500590_000337
798 Ga0500590_022401
799 Ga0500622_0002066
800 Ga0500637_0033643
801 Ga0500625_128371
802 Ga0500645_003479
803 Ga0500645_006732
804 2511128119
805 3000866276
806 8054307095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11003

DUF2842

Protein of unknown function (DUF2842)

17

77

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End GO Terms
AF-A0A838MLX1-F1-model_v4 DUF2842 domain-containing protein 0.9572 1 70 GO:0016020
AF-A0A838MLX1-F1-model_v4 DUF2842 domain-containing protein 0.9443 1 70 GO:0016020
AF-A0A4Y6VXP0-F1-model_v4 deleted 0.9387 1 70
AF-A0A4Y6VXP0-F1-model_v4 deleted 0.9262 1 70
AF-A0A1E4AYU9-F1-model_v4 DUF2842 domain-containing protein 0.9217 1 70 GO:0016020

Map