F435316

General Info

Members Datasets Scaffolds Average Seq Length
403 220 806 240

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100210904|Ga0070705_1002109041
Length 276
Sequence MKQNESKQSRLWPAIRRPMTLTLALAFIAGSVVSVGATVSKTNNSKKPNIVLVHGAWADGSCWSGVIQRLQEDGYNVIAPQFPLTSLADDVARLREVLAVQDGPTIMVGHSYGGQIITALGTDAPNVVGLVYIAAFALDEGESIGGLLQQGPPPPAIANLRIDAQGFAWLPQSDFVNYFAADVDRQQANVMYAVQQPLKVSALGEVMGTPAWKTLPSWYLVATNDQAIPPDAERFFAQRMGATTVEVKSSHVAMVSHPKDVTKLIETAAQAVKVTP

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
145 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
146 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
147 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 7.2
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 7.69
Rhizosphere 91.56
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100210904 3300005440 Unclassified 1339
2 JGI25407J50210_10007478 3300003373 Bacteria 2738
3 JGI25407J50210_10013022 3300003373 Bacteria 2136
4 JGI25407J50210_10015163 3300003373 Bacteria 1988
5 JGI25407J50210_10062816 3300003373 Bacteria 931
6 Ga0058861_10093557 3300004800 Bacteria 1055
7 Ga0058862_12627551 3300004803 Unclassified 1054
8 Ga0065707_10086114 3300005295 Bacteria 5656
9 Ga0070658_10655124 3300005327 Bacteria 911
10 Ga0070683_100034911 3300005329 Bacteria 4596
11 Ga0070683_100255330 3300005329 Bacteria 1667
12 Ga0070683_100266230 3300005329 Bacteria 1630
13 Ga0070682_100072175 3300005337 Bacteria 2211
14 Ga0070682_100129654 3300005337 Bacteria 1705
15 Ga0070682_100174079 3300005337 Unclassified 1498
16 Ga0068868_100039495 3300005338 Bacteria 3667
17 Ga0070660_100012692 3300005339 Bacteria 6023
18 Ga0070691_10014128 3300005341 Bacteria 3660
19 Ga0070691_10078787 3300005341 Bacteria 1610
20 Ga0070661_100029604 3300005344 Bacteria 3953
21 Ga0070692_10059434 3300005345 Bacteria 2009
22 Ga0070674_100389739 3300005356 Bacteria 1135
23 Ga0070659_100011845 3300005366 Bacteria 6455
24 Ga0070659_100125463 3300005366 Bacteria 2082
25 Ga0070659_100198985 3300005366 Bacteria 1649
26 Ga0070714_100001881 3300005435 Bacteria 15313
27 Ga0070714_100003305 3300005435 Bacteria 12023
28 Ga0070714_100004622 3300005435 Bacteria 10388
29 Ga0070714_100076200 3300005435 Bacteria 2911
30 Ga0070714_100251608 3300005435 Bacteria 1634
31 Ga0070713_100002947 3300005436 Bacteria 11160
32 Ga0070713_100080521 3300005436 Bacteria 2777
33 Ga0070713_100174872 3300005436 Bacteria 1926
34 Ga0070710_10037557 3300005437 Bacteria 2655
35 Ga0070710_10081999 3300005437 Bacteria 1885
36 Ga0070705_100013718 3300005440 Bacteria 4149
37 Ga0070705_100113250 3300005440 Bacteria 1737
38 Ga0070708_100750631 3300005445 Bacteria 918
39 Ga0070708_101149882 3300005445 Bacteria 726
40 Ga0070663_100265981 3300005455 Bacteria 1362
41 Ga0070678_100371129 3300005456 Bacteria 1235
42 Ga0070681_10578627 3300005458 Unclassified 1037
43 Ga0070681_10605626 3300005458 Bacteria 1010
44 Ga0068867_100305148 3300005459 Bacteria 1314
45 Ga0070706_100000306 3300005467 Bacteria 59517
46 Ga0070706_100024051 3300005467 Bacteria 5609
47 Ga0070706_100079581 3300005467 Bacteria 3033
48 Ga0070706_100214142 3300005467 Bacteria 1798
49 Ga0070706_100562405 3300005467 Bacteria 1060
50 Ga0070707_100001769 3300005468 Bacteria 20770
51 Ga0070707_100034029 3300005468 Bacteria 4861
52 Ga0070707_100037785 3300005468 Bacteria 4610
53 Ga0070707_100070543 3300005468 Bacteria 3366
54 Ga0070707_100214674 3300005468 Unclassified 1875
55 Ga0070707_100276466 3300005468 Bacteria 1632
56 Ga0070698_100056901 3300005471 Bacteria 3959
57 Ga0070698_100576965 3300005471 Unclassified 1065
58 Ga0070698_100618808 3300005471 Bacteria 1023
59 Ga0070699_100072460 3300005518 Bacteria 2996
60 Ga0070699_100165865 3300005518 Bacteria 1956
61 Ga0070699_100301364 3300005518 Unclassified 1438
62 Ga0070679_100020290 3300005530 Bacteria 6477
63 Ga0070679_100020304 3300005530 Bacteria 6474
64 Ga0070684_100002125 3300005535 Bacteria 14620
65 Ga0070684_100046291 3300005535 Bacteria 3769
66 Ga0070684_100082252 3300005535 Bacteria 2851
67 Ga0070697_100020450 3300005536 Bacteria 5236
68 Ga0070665_100209356 3300005548 Bacteria 1950
69 Ga0070704_100124267 3300005549 Bacteria 1988
70 Ga0070704_100560439 3300005549 Bacteria 999
71 Ga0070664_100356199 3300005564 Bacteria 1332
72 Ga0068857_100000377 3300005577 Bacteria 31241
73 Ga0068857_100131427 3300005577 Bacteria 2258
74 Ga0068857_100256290 3300005577 Bacteria 1605
75 Ga0068854_100039074 3300005578 Bacteria 3341
76 Ga0068856_100001262 3300005614 Bacteria 26636
77 Ga0068856_100018135 3300005614 Bacteria 6824
78 Ga0068856_100055038 3300005614 Bacteria 3926
79 Ga0068856_100149187 3300005614 Bacteria 2346
80 Ga0070702_100067401 3300005615 Bacteria 2102
81 Ga0068852_100027909 3300005616 Bacteria 4609
82 Ga0068866_10059266 3300005718 Bacteria 1980
83 Ga0068861_100179889 3300005719 Bacteria 1759
84 Ga0068851_10102258 3300005834 Bacteria 1522
85 Ga0081538_10000339 3300005981 Bacteria 53160
86 Ga0081538_10000884 3300005981 Bacteria 32396
87 Ga0081538_10004022 3300005981 Bacteria 13690
88 Ga0081538_10004440 3300005981 Bacteria 12934
89 Ga0081538_10007648 3300005981 Bacteria 9316
90 Ga0081540_1032326 3300005983 Bacteria 2859
91 Ga0081540_1034749 3300005983 Bacteria 2712
92 Ga0081539_10031219 3300005985 Bacteria 3289
93 Ga0070717_10001006 3300006028 Bacteria 18895
94 Ga0070717_10246226 3300006028 Bacteria 1578
95 Ga0075365_10224919 3300006038 Bacteria 1317
96 Ga0070715_10051371 3300006163 Bacteria 1774
97 Ga0070712_100040185 3300006175 Bacteria 3205
98 Ga0070712_100043177 3300006175 Bacteria 3103
99 Ga0070712_100076876 3300006175 Bacteria 2404
100 Ga0070712_100287554 3300006175 Bacteria 1326
101 Ga0075428_100593511 3300006844 Bacteria 1183
102 Ga0075428_100858455 3300006844 Bacteria 964
103 Ga0075430_100524502 3300006846 Unclassified 977
104 Ga0075430_100710440 3300006846 Bacteria 829
105 Ga0075431_100014539 3300006847 Bacteria 7963
106 Ga0075431_100020448 3300006847 Bacteria 6762
107 Ga0075433_10034226 3300006852 Bacteria 4361
108 Ga0075433_10096798 3300006852 Bacteria 2612
109 Ga0075433_10118749 3300006852 Unclassified 2347
110 Ga0075433_10150175 3300006852 Bacteria 2072
111 Ga0075433_10355434 3300006852 Bacteria 1294
112 Ga0075434_100631556 3300006871 Bacteria 1090
113 Ga0075429_100327054 3300006880 Unclassified 1342
114 Ga0075435_100027111 3300007076 Bacteria 4478
115 Ga0075435_100609619 3300007076 Bacteria 947
116 Ga0105240_10028260 3300009093 Bacteria 7327
117 Ga0105240_10903471 3300009093 Bacteria 950
118 Ga0111539_10014036 3300009094 Bacteria 10010
119 Ga0105245_10063713 3300009098 Bacteria 3330
120 Ga0105245_10067132 3300009098 Bacteria 3248
121 Ga0105245_10191710 3300009098 Bacteria 1958
122 Ga0105245_10239807 3300009098 Bacteria 1757
123 Ga0105247_10463494 3300009101 Bacteria 916
124 Ga0114129_10106042 3300009147 Bacteria 3883
125 Ga0114129_10124167 3300009147 Bacteria 3551
126 Ga0114129_10329768 3300009147 Bacteria 2027
127 Ga0114129_10438055 3300009147 Unclassified 1716
128 Ga0114129_10448408 3300009147 Bacteria 1692
129 Ga0105243_10067492 3300009148 Bacteria 2879
130 Ga0105243_10083840 3300009148 Bacteria 2608
131 Ga0105243_10314236 3300009148 Unclassified 1425
132 Ga0105243_10642553 3300009148 Unclassified 1027
133 Ga0105248_10247813 3300009177 Bacteria 2005
134 Ga0105237_10048862 3300009545 Bacteria 4253
135 Ga0105237_10066446 3300009545 Bacteria 3601
136 Ga0105237_10119560 3300009545 Bacteria 2628
137 Ga0105237_10363527 3300009545 Bacteria 1451
138 Ga0105238_10204535 3300009551 Bacteria 1950
139 Ga0105238_11100696 3300009551 Bacteria 817
140 Ga0105249_10034301 3300009553 Bacteria 4599
141 Ga0105249_10448422 3300009553 Bacteria 1329
142 Ga0105239_10230309 3300010375 Bacteria 2079
143 Ga0105246_10045920 3300011119 Bacteria 2978
144 Ga0154019_117967 3300013044 Unclassified 800
145 Ga0154016_123438 3300013045 Unclassified 809
146 Ga0154012_104654 3300013059 Unclassified 967
147 Ga0157370_10011417 3300013104 Bacteria 9290
148 Ga0157369_10027802 3300013105 Bacteria 6265
149 Ga0157369_10104322 3300013105 Bacteria 3019
150 Ga0157369_10583200 3300013105 Bacteria 1155
151 Ga0157374_10047933 3300013296 Bacteria 3963
152 Ga0157374_10427201 3300013296 Bacteria 1324
153 Ga0157372_10064096 3300013307 Bacteria 4123
154 Ga0157372_10102949 3300013307 Bacteria 3262
155 Ga0157372_10111310 3300013307 Bacteria 3137
156 Ga0157372_10289744 3300013307 Bacteria 1904
157 Ga0157372_10290387 3300013307 Bacteria 1902
158 Ga0157380_10062467 3300014326 Bacteria 2984
159 Ga0197907_11048632 3300020069 Unclassified 1267
160 Ga0197907_11099417 3300020069 Bacteria 951
161 Ga0197907_11375205 3300020069 Bacteria 1165
162 Ga0206356_10303716 3300020070 Bacteria 1523
163 Ga0206356_10756835 3300020070 Bacteria 1162
164 Ga0206349_1186408 3300020075 Unclassified 1395
165 Ga0206349_1359079 3300020075 Bacteria 1142
166 Ga0206355_1145119 3300020076 Bacteria 814
167 Ga0206355_1446909 3300020076 Unclassified 1148
168 Ga0206351_10606084 3300020077 Unclassified 1150
169 Ga0206352_10873254 3300020078 Bacteria 1171
170 Ga0206352_11069980 3300020078 Bacteria 781
171 Ga0206350_10035949 3300020080 Unclassified 1194
172 Ga0206354_10678748 3300020081 Unclassified 1148
173 Ga0206354_10752524 3300020081 Bacteria 974
174 Ga0206354_10889618 3300020081 Bacteria 1054
175 Ga0206353_10354406 3300020082 Bacteria 4061
176 Ga0206353_11032603 3300020082 Unclassified 1298
177 Ga0206353_11814465 3300020082 Bacteria 786
178 Ga0154015_1321447 3300020610 Unclassified 1043
179 Ga0213876_10223856 3300021384 Bacteria 1000
180 Ga0224712_10077098 3300022467 Unclassified 1367
181 Ga0224712_10119529 3300022467 Bacteria 1139
182 Ga0224712_10202519 3300022467 Bacteria 903
183 Ga0207656_10110172 3300025321 Bacteria 1271
184 Ga0207692_10036063 3300025898 Bacteria 2408
185 Ga0207692_10322490 3300025898 Bacteria 946
186 Ga0207688_10033957 3300025901 Bacteria 2823
187 Ga0207685_10033559 3300025905 Bacteria 1856
188 Ga0207699_10209007 3300025906 Bacteria 1326
189 Ga0207699_10441231 3300025906 Bacteria 932
190 Ga0207705_10622299 3300025909 Bacteria 839
191 Ga0207684_10000418 3300025910 Bacteria 56722
192 Ga0207684_10003801 3300025910 Bacteria 14564
193 Ga0207684_10194765 3300025910 Bacteria 1748
194 Ga0207684_10230151 3300025910 Bacteria 1599
195 Ga0207707_10027055 3300025912 Bacteria 5013
196 Ga0207707_10168196 3300025912 Bacteria 1916
197 Ga0207695_10029613 3300025913 Bacteria 6043
198 Ga0207671_10073519 3300025914 Bacteria 2553
199 Ga0207671_10312724 3300025914 Bacteria 1242
200 Ga0207693_10047387 3300025915 Bacteria 3377
201 Ga0207693_10128341 3300025915 Bacteria 1993
202 Ga0207693_10146184 3300025915 Bacteria 1859
203 Ga0207693_10264105 3300025915 Bacteria 1349
204 Ga0207663_10280237 3300025916 Bacteria 1238
205 Ga0207660_10015533 3300025917 Bacteria 5026
206 Ga0207660_10153110 3300025917 Bacteria 1773
207 Ga0207657_10016659 3300025919 Bacteria 7082
208 Ga0207649_10505781 3300025920 Unclassified 919
209 Ga0207652_10062710 3300025921 Bacteria 3212
210 Ga0207646_10000431 3300025922 Bacteria 55919
211 Ga0207646_10006509 3300025922 Bacteria 12057
212 Ga0207646_10017734 3300025922 Bacteria 6651
213 Ga0207646_10025465 3300025922 Bacteria 5412
214 Ga0207646_10034230 3300025922 Bacteria 4592
215 Ga0207681_10097451 3300025923 Bacteria 2114
216 Ga0207694_10031715 3300025924 Bacteria 4040
217 Ga0207687_10118651 3300025927 Bacteria 1975
218 Ga0207700_10001121 3300025928 Bacteria 15366
219 Ga0207664_10003899 3300025929 Bacteria 10019
220 Ga0207664_10007906 3300025929 Bacteria 7387
221 Ga0207664_10063873 3300025929 Bacteria 2943
222 Ga0207664_10092891 3300025929 Bacteria 2477
223 Ga0207644_10144183 3300025931 Bacteria 1837
224 Ga0207690_10007648 3300025932 Bacteria 6410
225 Ga0207690_10213019 3300025932 Bacteria 1474
226 Ga0207709_10014003 3300025935 Bacteria 4427
227 Ga0207709_10140487 3300025935 Bacteria 1659
228 Ga0207709_10156743 3300025935 Bacteria 1583
229 Ga0207669_10105278 3300025937 Bacteria 1876
230 Ga0207711_10198418 3300025941 Bacteria 1830
231 Ga0207661_10004228 3300025944 Bacteria 10051
232 Ga0207661_10004329 3300025944 Bacteria 9934
233 Ga0207661_10011974 3300025944 Bacteria 6300
234 Ga0207661_10074258 3300025944 Bacteria 2787
235 Ga0207661_10291343 3300025944 Bacteria 1461
236 Ga0207679_10267536 3300025945 Bacteria 1460
237 Ga0207679_10319108 3300025945 Bacteria 1345
238 Ga0207712_10222105 3300025961 Bacteria 1511
239 Ga0207712_10574732 3300025961 Unclassified 972
240 Ga0207712_10665968 3300025961 Bacteria 906
241 Ga0207677_10101648 3300026023 Bacteria 2117
242 Ga0207708_10002314 3300026075 Bacteria 14007
243 Ga0207702_10000489 3300026078 Bacteria 44584
244 Ga0207702_10018778 3300026078 Bacteria 5718
245 Ga0207702_10121117 3300026078 Bacteria 2342
246 Ga0207648_10252704 3300026089 Bacteria 1572
247 Ga0207674_10000612 3300026116 Bacteria 46825
248 Ga0207674_10032076 3300026116 Bacteria 5511
249 Ga0207674_10202675 3300026116 Bacteria 1933
250 Ga0207675_100024832 3300026118 Bacteria 5577
251 Ga0207683_10174221 3300026121 Bacteria 1949
252 Ga0207683_10179504 3300026121 Bacteria 1919
253 Ga0207698_10342488 3300026142 Bacteria 1409
254 Ga0265332_10118927 3300031238 Unclassified 1110
255 Ga0307410_10407552 3300031852 Bacteria 1100
256 Ga0307415_100899775 3300032126 Bacteria 816
257 Ga0373934_0144187 3300035086 Bacteria 974
258 Ga0373953_0015379 3300035117 Bacteria 2772
259 Ga0373954_0043181 3300035118 Bacteria 2102
260 Ga0373956_0009673 3300035119 Bacteria 3925
261 Ga0373955_0044100 3300035172 Bacteria 2400
262 Ga0373924_0020898 3300035410 Bacteria 2549
263 Ga0373933_0245327 3300035724 Bacteria 1152
264 Ga0265778_011870 3300036457 Bacteria 1008
265 Ga0395899_0111450 3300037312 Bacteria 1967
266 Ga0395900_0040750 3300037418 Bacteria 4786
267 Ga0395900_0375825 3300037418 Bacteria 1390
268 Ga0395898_0009529 3300037466 Bacteria 10196
269 Ga0395905_0056562 3300037471 Bacteria 3669
270 Ga0395901_0220080 3300038443 Bacteria 1985
271 Ga0395901_0365228 3300038443 Bacteria 1488
272 Ga0436361_0257771 3300039447 Bacteria 1160
273 Ga0439448_0013583 3300042005 Bacteria 2449
274 Ga0439454_007928 3300042011 Bacteria 1343
275 Ga0439463_008105 3300042016 Bacteria 2591
276 Ga0450900_013302 3300042136 Bacteria 1085
277 Ga0450902_007014 3300042137 Bacteria 1736
278 Ga0450902_018299 3300042137 Bacteria 1148
279 Ga0439464_0063935 3300042439 Bacteria 1080
280 Ga0450916_008238 3300042530 Bacteria 1265
281 Ga0451577_0250944 3300042876 Unclassified 1602
282 Ga0453683_0105994 3300044673 Bacteria 1766
283 Ga0451576_0284496 3300045051 Unclassified 1729
284 Ga0495592_0297966 3300046454 Bacteria 1049
285 Ga0495629_0073638 3300046459 Bacteria 2385
286 Ga0495629_0093208 3300046459 Bacteria 2102
287 Ga0495629_0169332 3300046459 Bacteria 1516
288 Ga0495651_0121428 3300046462 Bacteria 1919
289 Ga0495594_0018265 3300046499 Bacteria 3713
290 Ga0495596_0030214 3300046500 Bacteria 2170
291 Ga0495608_0051889 3300046511 Bacteria 2716
292 Ga0495640_0097702 3300046533 Bacteria 1931
293 Ga0495622_0000039 3300046557 Bacteria 119003
294 Ga0495667_0108038 3300046559 Bacteria 1798
295 Ga0495667_0128974 3300046559 Bacteria 1631
296 Ga0495657_0186504 3300046675 Bacteria 1269
297 Ga0495623_0137592 3300046679 Bacteria 1456
298 Ga0495646_0077999 3300046680 Bacteria 1937
299 Ga0495624_0010395 3300046690 Bacteria 6415
300 Ga0495674_0025921 3300047319 Bacteria 5367
301 Ga0495680_0063553 3300047322 Bacteria 2834
302 Ga0495679_046759 3300047446 Bacteria 1315
303 Ga0495684_0281890 3300047471 Bacteria 1199
304 Ga0496102_0015530 3300048905 Bacteria 6634
305 Ga0496102_0299842 3300048905 Bacteria 1514
306 Ga0496104_0080413 3300048907 Bacteria 3107
307 Ga0496104_0394163 3300048907 Bacteria 1297
308 Ga0496104_0407113 3300048907 Bacteria 1273
309 Ga0496104_0428259 3300048907 Bacteria 1235
310 Ga0496104_0999124 3300048907 Bacteria 741
311 Ga0496105_0096695 3300048908 Unclassified 2439
312 Ga0496105_0290989 3300048908 Bacteria 1315
313 Ga0496108_0039388 3300048911 Bacteria 3939
314 Ga0496108_0040057 3300048911 Bacteria 3904
315 Ga0496109_0040836 3300048912 Bacteria 4202
316 Ga0496109_0042025 3300048912 Bacteria 4140
317 Ga0496110_0021481 3300048913 Bacteria 5466
318 Ga0496110_0025598 3300048913 Bacteria 5044
319 Ga0496110_0058623 3300048913 Bacteria 3391
320 Ga0496110_0677737 3300048913 Bacteria 932
321 Ga0496111_0036312 3300048914 Bacteria 3523
322 Ga0496111_0202024 3300048914 Bacteria 1477
323 Ga0496111_0294281 3300048914 Bacteria 1204
324 Ga0496112_0080958 3300048915 Bacteria 3211
325 Ga0496112_0094798 3300048915 Bacteria 2955
326 Ga0496112_0095829 3300048915 Bacteria 2938
327 Ga0496112_0175721 3300048915 Bacteria 2106
328 Ga0496112_0239894 3300048915 Bacteria 1766
329 Ga0496112_0362746 3300048915 Bacteria 1391
330 Ga0496112_0769721 3300048915 Bacteria 888
331 Ga0496113_0151365 3300048916 Bacteria 1830
332 Ga0496114_0867879 3300048917 Bacteria 783
333 Ga0496115_0250941 3300048918 Bacteria 1457
334 Ga0496115_0324738 3300048918 Bacteria 1258
335 Ga0501031_0028653 3300049568 Bacteria 3631
336 Ga0501033_0015043 3300049570 Bacteria 5872
337 Ga0501033_0092392 3300049570 Bacteria 2213
338 Ga0501036_0044181 3300049572 Bacteria 3774
339 Ga0501036_0094612 3300049572 Bacteria 2525
340 Ga0501037_0149873 3300049573 Bacteria 1667
341 Ga0501037_0260234 3300049573 Bacteria 1212
342 Ga0501038_0317922 3300049574 Bacteria 1219
343 Ga0501038_0454816 3300049574 Unclassified 984
344 Ga0501039_0024204 3300049575 Bacteria 4663
345 Ga0501039_0066207 3300049575 Bacteria 2804
346 Ga0501040_0000516 3300049576 Bacteria 23123
347 Ga0501040_0187932 3300049576 Bacteria 1465
348 Ga0501041_0013763 3300049577 Bacteria 4797
349 Ga0501041_0017345 3300049577 Bacteria 4284
350 Ga0501042_0018199 3300049578 Bacteria 4861
351 Ga0501043_0045635 3300049579 Bacteria 3446
352 Ga0501043_0056161 3300049579 Bacteria 3093
353 Ga0501046_0024207 3300049580 Bacteria 4984
354 Ga0501046_0054188 3300049580 Bacteria 3156
355 Ga0501047_0170089 3300049581 Bacteria 2048
356 Ga0501048_0017451 3300049582 Bacteria 5285
357 Ga0501048_0274925 3300049582 Bacteria 1197
358 Ga0501068_0010985 3300049584 Bacteria 5096
359 Ga0501069_0009093 3300049585 Bacteria 5242
360 Ga0501069_0133565 3300049585 Bacteria 1422
361 Ga0501070_0172531 3300049586 Bacteria 1781
362 Ga0501071_0007698 3300049587 Bacteria 7098
363 Ga0501071_0051575 3300049587 Bacteria 2965
364 Ga0501072_0006087 3300049588 Bacteria 9207
365 Ga0501072_0055871 3300049588 Bacteria 3111
366 Ga0501073_0211580 3300049589 Bacteria 1340
367 Ga0501074_0016123 3300049590 Bacteria 5430
368 Ga0501075_0016087 3300049591 Bacteria 5382
369 Ga0501075_0233856 3300049591 Bacteria 1401
370 Ga0501076_0025512 3300049592 Bacteria 4574
371 Ga0501076_0161094 3300049592 Bacteria 1827
372 Ga0501077_0016173 3300049593 Bacteria 4700
373 Ga0501077_0031683 3300049593 Bacteria 3364
374 Ga0501079_0006141 3300049741 Bacteria 9007
375 Ga0501079_0024669 3300049741 Bacteria 4614
376 Ga0501080_0092378 3300049742 Bacteria 2811
377 Ga0501081_0001932 3300049743 Bacteria 12870
378 Ga0501081_0111394 3300049743 Bacteria 1942
379 Ga0501035_0064332 3300049822 Bacteria 3260
380 Ga0501044_0346547 3300049823 Bacteria 1406
381 Ga0501045_0019463 3300049824 Bacteria 4839
382 Ga0501045_0021779 3300049824 Bacteria 4588
383 nmdc:mga05p37_230943_c1 3300050507 Bacteria 2229
384 nmdc:mga05p37_292466_c1 3300050507 Bacteria 1938
385 nmdc:mga05p37_504342_c1 3300050507 Bacteria 1388
386 nmdc:mga05p37_96972_c1 3300050507 Bacteria 3633
387 nmdc:mga09592_483258_c1 3300050508 Unclassified 1067
388 nmdc:mga09592_91309_c1 3300050508 Bacteria 2602
389 nmdc:mga06r32_20837_c1 3300050510 Bacteria 6041
390 nmdc:mga06r32_36934_c1 3300050510 Bacteria 4621
391 nmdc:mga08y16_42338_c1 3300050511 Bacteria 4769
392 nmdc:mga0n895_603268_c1 3300050512 Bacteria 1100
393 nmdc:mga0rr50_14602_c1 3300050513 Bacteria 5158
394 nmdc:mga0rr50_256208_c1 3300050513 Unclassified 1454
395 nmdc:mga0rr50_522116_c1 3300050513 Bacteria 1010
396 nmdc:mga0a205_610254_c1 3300050515 Bacteria 944
397 Ga0501084_0021514 3300054114 Bacteria 5376
398 Ga0501084_0021794 3300054114 Bacteria 5343
399 Ga0501082_0055329 3300060353 Bacteria 3418
400 Ga0501082_0079446 3300060353 Bacteria 2830
401 Ga0530510_0020396 3300061734 Bacteria 4712
402 Ga0530510_0041784 3300061734 Bacteria 3311
403 2831940694 2831935698 Bacteria 5963223
404 Ga0070705_100210904
405 JGI25407J50210_10007478
406 JGI25407J50210_10013022
407 JGI25407J50210_10015163
408 JGI25407J50210_10062816
409 Ga0058861_10093557
410 Ga0058862_12627551
411 Ga0065707_10086114
412 Ga0070658_10655124
413 Ga0070683_100034911
414 Ga0070683_100255330
415 Ga0070683_100266230
416 Ga0070682_100072175
417 Ga0070682_100129654
418 Ga0070682_100174079
419 Ga0068868_100039495
420 Ga0070660_100012692
421 Ga0070691_10014128
422 Ga0070691_10078787
423 Ga0070661_100029604
424 Ga0070692_10059434
425 Ga0070674_100389739
426 Ga0070659_100011845
427 Ga0070659_100125463
428 Ga0070659_100198985
429 Ga0070714_100001881
430 Ga0070714_100003305
431 Ga0070714_100004622
432 Ga0070714_100076200
433 Ga0070714_100251608
434 Ga0070713_100002947
435 Ga0070713_100080521
436 Ga0070713_100174872
437 Ga0070710_10037557
438 Ga0070710_10081999
439 Ga0070705_100013718
440 Ga0070705_100113250
441 Ga0070708_100750631
442 Ga0070708_101149882
443 Ga0070663_100265981
444 Ga0070678_100371129
445 Ga0070681_10578627
446 Ga0070681_10605626
447 Ga0068867_100305148
448 Ga0070706_100000306
449 Ga0070706_100024051
450 Ga0070706_100079581
451 Ga0070706_100214142
452 Ga0070706_100562405
453 Ga0070707_100001769
454 Ga0070707_100034029
455 Ga0070707_100037785
456 Ga0070707_100070543
457 Ga0070707_100214674
458 Ga0070707_100276466
459 Ga0070698_100056901
460 Ga0070698_100576965
461 Ga0070698_100618808
462 Ga0070699_100072460
463 Ga0070699_100165865
464 Ga0070699_100301364
465 Ga0070679_100020290
466 Ga0070679_100020304
467 Ga0070684_100002125
468 Ga0070684_100046291
469 Ga0070684_100082252
470 Ga0070697_100020450
471 Ga0070665_100209356
472 Ga0070704_100124267
473 Ga0070704_100560439
474 Ga0070664_100356199
475 Ga0068857_100000377
476 Ga0068857_100131427
477 Ga0068857_100256290
478 Ga0068854_100039074
479 Ga0068856_100001262
480 Ga0068856_100018135
481 Ga0068856_100055038
482 Ga0068856_100149187
483 Ga0070702_100067401
484 Ga0068852_100027909
485 Ga0068866_10059266
486 Ga0068861_100179889
487 Ga0068851_10102258
488 Ga0081538_10000339
489 Ga0081538_10000884
490 Ga0081538_10004022
491 Ga0081538_10004440
492 Ga0081538_10007648
493 Ga0081540_1032326
494 Ga0081540_1034749
495 Ga0081539_10031219
496 Ga0070717_10001006
497 Ga0070717_10246226
498 Ga0075365_10224919
499 Ga0070715_10051371
500 Ga0070712_100040185
501 Ga0070712_100043177
502 Ga0070712_100076876
503 Ga0070712_100287554
504 Ga0075428_100593511
505 Ga0075428_100858455
506 Ga0075430_100524502
507 Ga0075430_100710440
508 Ga0075431_100014539
509 Ga0075431_100020448
510 Ga0075433_10034226
511 Ga0075433_10096798
512 Ga0075433_10118749
513 Ga0075433_10150175
514 Ga0075433_10355434
515 Ga0075434_100631556
516 Ga0075429_100327054
517 Ga0075435_100027111
518 Ga0075435_100609619
519 Ga0105240_10028260
520 Ga0105240_10903471
521 Ga0111539_10014036
522 Ga0105245_10063713
523 Ga0105245_10067132
524 Ga0105245_10191710
525 Ga0105245_10239807
526 Ga0105247_10463494
527 Ga0114129_10106042
528 Ga0114129_10124167
529 Ga0114129_10329768
530 Ga0114129_10438055
531 Ga0114129_10448408
532 Ga0105243_10067492
533 Ga0105243_10083840
534 Ga0105243_10314236
535 Ga0105243_10642553
536 Ga0105248_10247813
537 Ga0105237_10048862
538 Ga0105237_10066446
539 Ga0105237_10119560
540 Ga0105237_10363527
541 Ga0105238_10204535
542 Ga0105238_11100696
543 Ga0105249_10034301
544 Ga0105249_10448422
545 Ga0105239_10230309
546 Ga0105246_10045920
547 Ga0154019_117967
548 Ga0154016_123438
549 Ga0154012_104654
550 Ga0157370_10011417
551 Ga0157369_10027802
552 Ga0157369_10104322
553 Ga0157369_10583200
554 Ga0157374_10047933
555 Ga0157374_10427201
556 Ga0157372_10064096
557 Ga0157372_10102949
558 Ga0157372_10111310
559 Ga0157372_10289744
560 Ga0157372_10290387
561 Ga0157380_10062467
562 Ga0197907_11048632
563 Ga0197907_11099417
564 Ga0197907_11375205
565 Ga0206356_10303716
566 Ga0206356_10756835
567 Ga0206349_1186408
568 Ga0206349_1359079
569 Ga0206355_1145119
570 Ga0206355_1446909
571 Ga0206351_10606084
572 Ga0206352_10873254
573 Ga0206352_11069980
574 Ga0206350_10035949
575 Ga0206354_10678748
576 Ga0206354_10752524
577 Ga0206354_10889618
578 Ga0206353_10354406
579 Ga0206353_11032603
580 Ga0206353_11814465
581 Ga0154015_1321447
582 Ga0213876_10223856
583 Ga0224712_10077098
584 Ga0224712_10119529
585 Ga0224712_10202519
586 Ga0207656_10110172
587 Ga0207692_10036063
588 Ga0207692_10322490
589 Ga0207688_10033957
590 Ga0207685_10033559
591 Ga0207699_10209007
592 Ga0207699_10441231
593 Ga0207705_10622299
594 Ga0207684_10000418
595 Ga0207684_10003801
596 Ga0207684_10194765
597 Ga0207684_10230151
598 Ga0207707_10027055
599 Ga0207707_10168196
600 Ga0207695_10029613
601 Ga0207671_10073519
602 Ga0207671_10312724
603 Ga0207693_10047387
604 Ga0207693_10128341
605 Ga0207693_10146184
606 Ga0207693_10264105
607 Ga0207663_10280237
608 Ga0207660_10015533
609 Ga0207660_10153110
610 Ga0207657_10016659
611 Ga0207649_10505781
612 Ga0207652_10062710
613 Ga0207646_10000431
614 Ga0207646_10006509
615 Ga0207646_10017734
616 Ga0207646_10025465
617 Ga0207646_10034230
618 Ga0207681_10097451
619 Ga0207694_10031715
620 Ga0207687_10118651
621 Ga0207700_10001121
622 Ga0207664_10003899
623 Ga0207664_10007906
624 Ga0207664_10063873
625 Ga0207664_10092891
626 Ga0207644_10144183
627 Ga0207690_10007648
628 Ga0207690_10213019
629 Ga0207709_10014003
630 Ga0207709_10140487
631 Ga0207709_10156743
632 Ga0207669_10105278
633 Ga0207711_10198418
634 Ga0207661_10004228
635 Ga0207661_10004329
636 Ga0207661_10011974
637 Ga0207661_10074258
638 Ga0207661_10291343
639 Ga0207679_10267536
640 Ga0207679_10319108
641 Ga0207712_10222105
642 Ga0207712_10574732
643 Ga0207712_10665968
644 Ga0207677_10101648
645 Ga0207708_10002314
646 Ga0207702_10000489
647 Ga0207702_10018778
648 Ga0207702_10121117
649 Ga0207648_10252704
650 Ga0207674_10000612
651 Ga0207674_10032076
652 Ga0207674_10202675
653 Ga0207675_100024832
654 Ga0207683_10174221
655 Ga0207683_10179504
656 Ga0207698_10342488
657 Ga0265332_10118927
658 Ga0307410_10407552
659 Ga0307415_100899775
660 Ga0373934_0144187
661 Ga0373953_0015379
662 Ga0373954_0043181
663 Ga0373956_0009673
664 Ga0373955_0044100
665 Ga0373924_0020898
666 Ga0373933_0245327
667 Ga0265778_011870
668 Ga0395899_0111450
669 Ga0395900_0040750
670 Ga0395900_0375825
671 Ga0395898_0009529
672 Ga0395905_0056562
673 Ga0395901_0220080
674 Ga0395901_0365228
675 Ga0436361_0257771
676 Ga0439448_0013583
677 Ga0439454_007928
678 Ga0439463_008105
679 Ga0450900_013302
680 Ga0450902_007014
681 Ga0450902_018299
682 Ga0439464_0063935
683 Ga0450916_008238
684 Ga0451577_0250944
685 Ga0453683_0105994
686 Ga0451576_0284496
687 Ga0495592_0297966
688 Ga0495629_0073638
689 Ga0495629_0093208
690 Ga0495629_0169332
691 Ga0495651_0121428
692 Ga0495594_0018265
693 Ga0495596_0030214
694 Ga0495608_0051889
695 Ga0495640_0097702
696 Ga0495622_0000039
697 Ga0495667_0108038
698 Ga0495667_0128974
699 Ga0495657_0186504
700 Ga0495623_0137592
701 Ga0495646_0077999
702 Ga0495624_0010395
703 Ga0495674_0025921
704 Ga0495680_0063553
705 Ga0495679_046759
706 Ga0495684_0281890
707 Ga0496102_0015530
708 Ga0496102_0299842
709 Ga0496104_0080413
710 Ga0496104_0394163
711 Ga0496104_0407113
712 Ga0496104_0428259
713 Ga0496104_0999124
714 Ga0496105_0096695
715 Ga0496105_0290989
716 Ga0496108_0039388
717 Ga0496108_0040057
718 Ga0496109_0040836
719 Ga0496109_0042025
720 Ga0496110_0021481
721 Ga0496110_0025598
722 Ga0496110_0058623
723 Ga0496110_0677737
724 Ga0496111_0036312
725 Ga0496111_0202024
726 Ga0496111_0294281
727 Ga0496112_0080958
728 Ga0496112_0094798
729 Ga0496112_0095829
730 Ga0496112_0175721
731 Ga0496112_0239894
732 Ga0496112_0362746
733 Ga0496112_0769721
734 Ga0496113_0151365
735 Ga0496114_0867879
736 Ga0496115_0250941
737 Ga0496115_0324738
738 Ga0501031_0028653
739 Ga0501033_0015043
740 Ga0501033_0092392
741 Ga0501036_0044181
742 Ga0501036_0094612
743 Ga0501037_0149873
744 Ga0501037_0260234
745 Ga0501038_0317922
746 Ga0501038_0454816
747 Ga0501039_0024204
748 Ga0501039_0066207
749 Ga0501040_0000516
750 Ga0501040_0187932
751 Ga0501041_0013763
752 Ga0501041_0017345
753 Ga0501042_0018199
754 Ga0501043_0045635
755 Ga0501043_0056161
756 Ga0501046_0024207
757 Ga0501046_0054188
758 Ga0501047_0170089
759 Ga0501048_0017451
760 Ga0501048_0274925
761 Ga0501068_0010985
762 Ga0501069_0009093
763 Ga0501069_0133565
764 Ga0501070_0172531
765 Ga0501071_0007698
766 Ga0501071_0051575
767 Ga0501072_0006087
768 Ga0501072_0055871
769 Ga0501073_0211580
770 Ga0501074_0016123
771 Ga0501075_0016087
772 Ga0501075_0233856
773 Ga0501076_0025512
774 Ga0501076_0161094
775 Ga0501077_0016173
776 Ga0501077_0031683
777 Ga0501079_0006141
778 Ga0501079_0024669
779 Ga0501080_0092378
780 Ga0501081_0001932
781 Ga0501081_0111394
782 Ga0501035_0064332
783 Ga0501044_0346547
784 Ga0501045_0019463
785 Ga0501045_0021779
786 nmdc:mga05p37_230943_c1
787 nmdc:mga05p37_292466_c1
788 nmdc:mga05p37_504342_c1
789 nmdc:mga05p37_96972_c1
790 nmdc:mga09592_483258_c1
791 nmdc:mga09592_91309_c1
792 nmdc:mga06r32_20837_c1
793 nmdc:mga06r32_36934_c1
794 nmdc:mga08y16_42338_c1
795 nmdc:mga0n895_603268_c1
796 nmdc:mga0rr50_14602_c1
797 nmdc:mga0rr50_256208_c1
798 nmdc:mga0rr50_522116_c1
799 nmdc:mga0a205_610254_c1
800 Ga0501084_0021514
801 Ga0501084_0021794
802 Ga0501082_0055329
803 Ga0501082_0079446
804 Ga0530510_0020396
805 Ga0530510_0041784
806 2831940694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12695

Abhydrolase_5

Alpha/beta hydrolase family

49

147

0.87

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

50

264

0.7

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

48

258

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.878 15 244
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8685 15 244
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.856 15 244
3x3h-assembly1.cif.gz_A crystal structure of the manihot esculenta hydroxynitrile lyase (mehnl) 3kp (k176p, k199p, k224p) triple mutant 0.837 14 246
3dqz-assembly2.cif.gz_D structure of the hydroxynitrile lyase from arabidopsis thaliana 0.8346 13 245
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9382 14 245 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9182 14 245 3.40.50.1820
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9055 13 105 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8934 15 108 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8555 13 244 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y0JXA0-F1-model_v4 Alpha/beta hydrolase 0.9938 14 246 GO:0016787
AF-A0A6J4VY36-F1-model_v4 Probable signal peptide protein 0.9832 6 247
AF-I0L7D3-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9818 34 246
AF-A0A421AEU8-F1-model_v4 deleted 0.9806 8 246
AF-A0A4V2TYI8-F1-model_v4 deleted 0.9776 144 241

Map