F435305

General Info

Members Datasets Scaffolds Average Seq Length
403 265 806 246

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100138205|Ga0070669_1001382052
Length 275
Sequence MCSQAILWAPPFPLRSPCFSLIANMTTMKKLVLLRHGESAWNKENRFTGWTDVDLTAQGVEEARAAGRLLKSSGFDFDFTYTSVLKRAIRTLHFVLEEMDRLWLPVEKDWRLNERHYGALQGLNKAEMAAKFGEAQVLAWRRSYDTRPPALETGDERDASRDRRYSGLSREELPMTECLKDTVARVVPYWKERIAPRVQRGERILVAAHGNSIRALIKYFDNMSDEAIIQENVPTGMPLVYEFDDALRPGGRQYLGDPEAVAKAMSSVASQGKAR

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
163 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
229 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
230 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
231 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
232 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
233 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
234 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
235 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
236 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
237 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
238 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
239 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
240 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
241 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
242 2847085930 Erwinia persicina B64 Isolate Bulb
243 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
244 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
245 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
246 2876601092 Pantoea endophytica 596 Isolate Unclassified
247 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
248 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
249 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
250 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
251 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
252 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
253 2919150387 Rahnella aceris 1817 Isolate Unclassified
254 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
255 2927143783 Rahnella sp. 2050 Isolate Unclassified
256 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
257 2937967321 Serratia sp. YC16 Isolate Unclassified
258 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
259 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
260 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
261 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
262 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
263 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
264 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
265 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 0
Isolates 9.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.25
Endosphere 5.46
Nodule 0.25
Rhizoplane 1.49
Rhizosphere 80.15
Stem 0
Stem Tuber 0.5
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100138205 3300005353 Bacteria 1876
2 SwRhRL2b_contig_1820963 2162886007 Bacteria 5085
3 JGI24740J21852_10015445 3300001979 Bacteria 2788
4 JGI25163J39215_1000007 3300002771 Bacteria 113612
5 JGI25164J39214_1000014 3300002772 Bacteria 219691
6 Ga0055538_1000005 3300003751 Bacteria 575218
7 Ga0055539_1000007 3300003752 Bacteria 575218
8 Ga0055533_1000009 3300003756 Bacteria 575218
9 Ga0055525_1000010 3300003759 Bacteria 575218
10 Ga0055541_1000005 3300003841 Bacteria 575218
11 Ga0058692_1000396 3300003856 Bacteria 20877
12 Ga0058692_1000727 3300003856 Bacteria 13407
13 Ga0058692_1028416 3300003856 Bacteria 1079
14 Ga0065704_10000763 3300005289 Bacteria 34745
15 Ga0070658_10049647 3300005327 Bacteria 3400
16 Ga0070658_10337622 3300005327 Bacteria 1288
17 Ga0070658_10356869 3300005327 Bacteria 1252
18 Ga0068869_100118194 3300005334 Bacteria 2024
19 Ga0068869_100242753 3300005334 Bacteria 1436
20 Ga0068868_100017934 3300005338 Bacteria 5281
21 Ga0068868_100225323 3300005338 Bacteria 1571
22 Ga0070689_100010921 3300005340 Bacteria 6489
23 Ga0070689_100147066 3300005340 Bacteria 1899
24 Ga0070689_100209632 3300005340 Bacteria 1594
25 Ga0070689_100436953 3300005340 Bacteria 1112
26 Ga0070687_100125310 3300005343 Bacteria 1475
27 Ga0070668_100052349 3300005347 Bacteria 3146
28 Ga0070669_100012333 3300005353 Bacteria 6063
29 Ga0070675_100024557 3300005354 Unclassified 4827
30 Ga0070675_100433028 3300005354 Bacteria 1177
31 Ga0070671_100177588 3300005355 Bacteria 1802
32 Ga0070674_100092775 3300005356 Bacteria 2183
33 Ga0070673_100057507 3300005364 Bacteria 3072
34 Ga0070673_100139839 3300005364 Bacteria 2041
35 Ga0070673_100238231 3300005364 Bacteria 1581
36 Ga0070673_100351711 3300005364 Bacteria 1308
37 Ga0070688_100011338 3300005365 Unclassified 4951
38 Ga0070709_10208642 3300005434 Bacteria 1387
39 Ga0070714_100049967 3300005435 Bacteria 3560
40 Ga0070714_100050054 3300005435 Bacteria 3557
41 Ga0070705_100171769 3300005440 Bacteria 1460
42 Ga0070700_100154466 3300005441 Bacteria 1573
43 Ga0070678_100241064 3300005456 Bacteria 1512
44 Ga0070681_10056966 3300005458 Bacteria 3888
45 Ga0070681_10184340 3300005458 Bacteria 2008
46 Ga0070672_100112338 3300005543 Bacteria 2222
47 Ga0070686_100198401 3300005544 Bacteria 1437
48 Ga0070695_100149452 3300005545 Bacteria 1629
49 Ga0070696_100041583 3300005546 Bacteria 3175
50 Ga0070704_100038995 3300005549 Bacteria 3258
51 Ga0070704_100087633 3300005549 Bacteria 2311
52 Ga0070704_100626215 3300005549 Bacteria 948
53 Ga0068855_100018124 3300005563 Bacteria 8461
54 Ga0068855_100033076 3300005563 Bacteria 6174
55 Ga0068855_100038425 3300005563 Bacteria 5687
56 Ga0068855_100229615 3300005563 Bacteria 2079
57 Ga0068857_100104832 3300005577 Bacteria 2539
58 Ga0068854_100031363 3300005578 Bacteria 3693
59 Ga0068854_100414192 3300005578 Bacteria 1118
60 Ga0070702_100050004 3300005615 Bacteria 2386
61 Ga0068852_100005931 3300005616 Bacteria 8784
62 Ga0068852_100012070 3300005616 Bacteria 6541
63 Ga0068859_100089336 3300005617 Bacteria 3131
64 Ga0068859_100093504 3300005617 Bacteria 3058
65 Ga0068861_100099026 3300005719 Bacteria 2315
66 Ga0068861_100113266 3300005719 Unclassified 2176
67 Ga0068858_100092361 3300005842 Bacteria 2817
68 Ga0068858_100357271 3300005842 Bacteria 1400
69 Ga0068860_100144559 3300005843 Bacteria 2288
70 Ga0068862_100029564 3300005844 Bacteria 4617
71 Ga0075366_10000852 3300006195 Bacteria 14695
72 Ga0075366_10161211 3300006195 Bacteria 1359
73 Ga0075366_10167269 3300006195 Bacteria 1333
74 Ga0097621_100282802 3300006237 Bacteria 1460
75 Ga0097621_100420346 3300006237 Bacteria 1200
76 Ga0068871_100016657 3300006358 Bacteria 5544
77 Ga0068871_100156855 3300006358 Bacteria 1944
78 Ga0068871_100162057 3300006358 Bacteria 1913
79 Ga0075428_100009589 3300006844 Bacteria 10750
80 Ga0075428_100222091 3300006844 Bacteria 2040
81 Ga0075430_100019150 3300006846 Bacteria 5821
82 Ga0075431_100133000 3300006847 Bacteria 2565
83 Ga0075433_10120368 3300006852 Bacteria 2330
84 Ga0075434_100153227 3300006871 Bacteria 2325
85 Ga0075429_100000209 3300006880 Bacteria 39220
86 Ga0068865_100052505 3300006881 Bacteria 2825
87 Ga0075436_100002239 3300006914 Bacteria 13356
88 Ga0097620_100089346 3300006931 Bacteria 3131
89 Ga0097620_100093501 3300006931 Bacteria 3058
90 Ga0079104_1000080 3300006946 Bacteria 140677
91 Ga0105251_10024851 3300009011 Bacteria 3071
92 Ga0105244_10000006 3300009036 Bacteria 357997
93 Ga0105244_10000194 3300009036 Bacteria 61396
94 Ga0105244_10059040 3300009036 Bacteria 1934
95 Ga0105244_10060187 3300009036 Bacteria 1914
96 Ga0105244_10075697 3300009036 Bacteria 1672
97 Ga0105244_10116930 3300009036 Bacteria 1294
98 Ga0105244_10172022 3300009036 Bacteria 1030
99 Ga0105250_10005127 3300009092 Bacteria 5919
100 Ga0105240_10041414 3300009093 Bacteria 5878
101 Ga0105240_10188247 3300009093 Bacteria 2429
102 Ga0105240_10712215 3300009093 Bacteria 1095
103 Ga0111539_10006551 3300009094 Bacteria 15008
104 Ga0111539_10012497 3300009094 Bacteria 10641
105 Ga0111539_10090302 3300009094 Bacteria 3600
106 Ga0111539_10176825 3300009094 Bacteria 2493
107 Ga0105245_10072355 3300009098 Bacteria 3132
108 Ga0105245_10511482 3300009098 Bacteria 1218
109 Ga0114129_10190463 3300009147 Bacteria 2786
110 Ga0114129_10244953 3300009147 Bacteria 2409
111 Ga0105243_10746295 3300009148 Bacteria 959
112 Ga0105241_10486451 3300009174 Bacteria 1098
113 Ga0105242_10030460 3300009176 Bacteria 4308
114 Ga0105242_10069921 3300009176 Bacteria 2909
115 Ga0105242_10138016 3300009176 Bacteria 2113
116 Ga0105242_10375474 3300009176 Bacteria 1320
117 Ga0105242_10583177 3300009176 Bacteria 1077
118 Ga0105248_10140455 3300009177 Bacteria 2725
119 Ga0105248_10395556 3300009177 Bacteria 1556
120 Ga0105238_10050204 3300009551 Bacteria 4199
121 Ga0105249_10042886 3300009553 Bacteria 4115
122 Ga0105249_10310352 3300009553 Bacteria 1585
123 Ga0105246_10000235 3300011119 Bacteria 28470
124 Ga0157373_10001013 3300013100 Bacteria 21700
125 Ga0157371_10000167 3300013102 Bacteria 95585
126 Ga0157371_10000462 3300013102 Bacteria 49728
127 Ga0157370_10000093 3300013104 Bacteria 101308
128 Ga0157370_10008428 3300013104 Bacteria 11115
129 Ga0157369_10577700 3300013105 Bacteria 1161
130 Ga0157374_10268197 3300013296 Bacteria 1683
131 Ga0157378_10052017 3300013297 Bacteria 3644
132 Ga0163162_10068774 3300013306 Bacteria 3593
133 Ga0163162_10100081 3300013306 Bacteria 2990
134 Ga0163162_10282557 3300013306 Bacteria 1792
135 Ga0157372_10005119 3300013307 Bacteria 13932
136 Ga0157372_10062670 3300013307 Bacteria 4167
137 Ga0157372_10141332 3300013307 Bacteria 2773
138 Ga0157375_10259435 3300013308 Bacteria 1899
139 Ga0157375_10278959 3300013308 Bacteria 1834
140 Ga0157375_10837012 3300013308 Bacteria 1067
141 Ga0157380_10065618 3300014326 Unclassified 2918
142 Ga0157380_10330341 3300014326 Bacteria 1418
143 Ga0157377_10015939 3300014745 Bacteria 3856
144 Ga0157376_10165804 3300014969 Bacteria 2007
145 Ga0157376_10590299 3300014969 Bacteria 1104
146 Ga0182006_1000063 3300015261 Bacteria 154042
147 Ga0183360_10539 3300015689 Bacteria 1089
148 Ga0213876_10034486 3300021384 Bacteria 2669
149 Ga0209760_100001 3300025207 Bacteria 348781
150 Ga0209784_100001 3300025224 Bacteria 3600592
151 Ga0209566_100001 3300025225 Bacteria 3600765
152 Ga0209674_100002 3300025226 Bacteria 3600592
153 Ga0209563_100008 3300025230 Bacteria 1554545
154 Ga0207427_100002 3300025231 Bacteria 1355321
155 Ga0209437_100007 3300025233 Bacteria 938377
156 Ga0209437_100295 3300025233 Bacteria 72055
157 Ga0209677_100004 3300025253 Bacteria 1554545
158 Ga0209233_1001492 3300025261 Bacteria 9201
159 Ga0207697_10119427 3300025315 Bacteria 1133
160 Ga0207656_10011152 3300025321 Bacteria 3388
161 Ga0207696_1000312 3300025711 Bacteria 54441
162 Ga0207696_1000444 3300025711 Bacteria 36917
163 Ga0207655_1000023 3300025728 Bacteria 467070
164 Ga0207655_1000149 3300025728 Bacteria 129937
165 Ga0207655_1000157 3300025728 Bacteria 124885
166 Ga0207655_1003730 3300025728 Bacteria 11184
167 Ga0207655_1024976 3300025728 Bacteria 2914
168 Ga0207655_1060931 3300025728 Bacteria 1460
169 Ga0207655_1100162 3300025728 Bacteria 999
170 Ga0207713_1019782 3300025735 Bacteria 3282
171 Ga0207643_10024700 3300025908 Bacteria 3316
172 Ga0207705_10086360 3300025909 Bacteria 2293
173 Ga0207705_10115778 3300025909 Bacteria 1984
174 Ga0207705_10179542 3300025909 Bacteria 1597
175 Ga0207705_10253362 3300025909 Bacteria 1343
176 Ga0207654_10432243 3300025911 Bacteria 920
177 Ga0207707_10058255 3300025912 Bacteria 3362
178 Ga0207707_10131372 3300025912 Bacteria 2190
179 Ga0207695_10150915 3300025913 Bacteria 2263
180 Ga0207671_10478652 3300025914 Bacteria 992
181 Ga0207657_10067181 3300025919 Bacteria 3049
182 Ga0207652_10607504 3300025921 Bacteria 980
183 Ga0207681_10067848 3300025923 Bacteria 2474
184 Ga0207659_10009662 3300025926 Bacteria 6034
185 Ga0207659_10217671 3300025926 Bacteria 1533
186 Ga0207659_10296028 3300025926 Bacteria 1327
187 Ga0207659_10694896 3300025926 Unclassified 871
188 Ga0207659_10790770 3300025926 Bacteria 815
189 Ga0207687_10085749 3300025927 Bacteria 2285
190 Ga0207700_10207244 3300025928 Bacteria 1655
191 Ga0207700_10537095 3300025928 Bacteria 1037
192 Ga0207664_10017547 3300025929 Bacteria 5251
193 Ga0207664_10314210 3300025929 Bacteria 1381
194 Ga0207644_10565009 3300025931 Bacteria 942
195 Ga0207690_10515059 3300025932 Bacteria 969
196 Ga0207706_10214264 3300025933 Bacteria 1687
197 Ga0207706_10310017 3300025933 Bacteria 1374
198 Ga0207686_10011601 3300025934 Bacteria 4830
199 Ga0207686_10016399 3300025934 Bacteria 4159
200 Ga0207686_10128328 3300025934 Bacteria 1736
201 Ga0207686_10321174 3300025934 Bacteria 1157
202 Ga0207686_10353992 3300025934 Bacteria 1106
203 Ga0207670_10058971 3300025936 Bacteria 2609
204 Ga0207670_10105073 3300025936 Bacteria 2024
205 Ga0207670_10119892 3300025936 Bacteria 1910
206 Ga0207670_10398945 3300025936 Bacteria 1099
207 Ga0207704_10006758 3300025938 Bacteria 5375
208 Ga0207665_10485052 3300025939 Bacteria 953
209 Ga0207691_10011455 3300025940 Bacteria 8510
210 Ga0207691_10015917 3300025940 Bacteria 7144
211 Ga0207711_10386853 3300025941 Bacteria 1298
212 Ga0207689_10040961 3300025942 Bacteria 3832
213 Ga0207667_10006733 3300025949 Bacteria 13876
214 Ga0207667_10020766 3300025949 Bacteria 7295
215 Ga0207667_10114030 3300025949 Bacteria 2786
216 Ga0207651_10046082 3300025960 Bacteria 2929
217 Ga0207651_10239081 3300025960 Bacteria 1479
218 Ga0207712_10096361 3300025961 Bacteria 2190
219 Ga0207668_10099800 3300025972 Bacteria 2154
220 Ga0207677_10013698 3300026023 Bacteria 4707
221 Ga0207708_10107440 3300026075 Bacteria 2164
222 Ga0207708_10250121 3300026075 Bacteria 1428
223 Ga0207648_10066284 3300026089 Bacteria 3149
224 Ga0207674_10018402 3300026116 Bacteria 7595
225 Ga0207674_10283844 3300026116 Bacteria 1604
226 Ga0207675_100130673 3300026118 Bacteria 2381
227 Ga0207675_100174897 3300026118 Bacteria 2054
228 Ga0207698_10015160 3300026142 Bacteria 5153
229 Ga0207698_10147741 3300026142 Bacteria 2035
230 Ga0207698_10361586 3300026142 Bacteria 1375
231 Ga0209371_1000010 3300027312 Bacteria 922021
232 Ga0209371_1000170 3300027312 Bacteria 97312
233 Ga0209371_1001882 3300027312 Bacteria 12873
234 Ga0209371_1006008 3300027312 Bacteria 4637
235 Ga0209996_1005223 3300027395 Bacteria 1663
236 Ga0209971_1005985 3300027682 Bacteria 2882
237 Ga0209966_1002571 3300027695 Bacteria 3029
238 Ga0209974_10017722 3300027876 Bacteria 2361
239 Ga0207428_10001508 3300027907 Bacteria 24337
240 Ga0207428_10036227 3300027907 Bacteria 4026
241 Ga0207428_10145132 3300027907 Bacteria 1809
242 Ga0268265_10177564 3300028380 Bacteria 1827
243 Ga0268264_10028474 3300028381 Bacteria 4571
244 Ga0268256_1000022 3300030500 Bacteria 531115
245 Ga0268256_1000142 3300030500 Bacteria 97311
246 Ga0268256_1001643 3300030500 Bacteria 12873
247 Ga0268256_1005987 3300030500 Bacteria 4638
248 Ga0307408_100078146 3300031548 Bacteria 2466
249 Ga0265314_10024870 3300031711 Bacteria 4531
250 Ga0307405_10295694 3300031731 Bacteria 1226
251 Ga0316577_10020637 3300031733 Bacteria 3651
252 Ga0307406_10260458 3300031901 Bacteria 1312
253 Ga0307412_10301886 3300031911 Bacteria 1266
254 Ga0307412_10648918 3300031911 Bacteria 900
255 Ga0307416_100022416 3300032002 Bacteria 4559
256 Ga0307416_100254356 3300032002 Bacteria 1712
257 Ga0373956_0026804 3300035119 Bacteria 2498
258 Ga0373955_0115918 3300035172 Bacteria 1553
259 Ga0316574_0027218 3300035398 Bacteria 3443
260 Ga0373931_0133936 3300035691 Bacteria 1429
261 Ga0373947_0301396 3300035725 Bacteria 1069
262 Ga0373937_0514293 3300036401 Bacteria 1137
263 Ga0316582_0045879 3300036647 Bacteria 2753
264 Ga0316584_0001871 3300036712 Bacteria 13047
265 Ga0395900_0187203 3300037418 Bacteria 2101
266 Ga0395898_0413609 3300037466 Bacteria 1285
267 Ga0395901_0317114 3300038443 Bacteria 1613
268 Ga0395901_0411336 3300038443 Bacteria 1388
269 Ga0436365_0346054 3300039437 Bacteria 3350
270 Ga0439438_000001 3300041405 Bacteria 1263568
271 Ga0439438_000958 3300041405 Bacteria 12865
272 Ga0439447_002111 3300041407 Bacteria 7305
273 Ga0439447_002918 3300041407 Bacteria 6122
274 Ga0439432_002348 3300042006 Bacteria 7142
275 Ga0439452_000003 3300042010 Bacteria 942815
276 Ga0451577_0018489 3300042876 Bacteria 6420
277 Ga0453683_0425910 3300044673 Bacteria 857
278 Ga0453684_0068391 3300044712 Bacteria 4510
279 Ga0466959_0042716 3300045049 Bacteria 3344
280 Ga0466958_0024192 3300045836 Bacteria 3573
281 Ga0495591_000080 3300046458 Bacteria 107876
282 Ga0495651_0262497 3300046462 Bacteria 1175
283 Ga0495650_0000016 3300046471 Bacteria 554693
284 Ga0495608_0005328 3300046511 Bacteria 9189
285 Ga0495652_0133994 3300046529 Bacteria 1957
286 Ga0495654_0000125 3300046530 Bacteria 85809
287 Ga0495587_0077039 3300046536 Bacteria 1936
288 Ga0495645_0000490 3300046543 Bacteria 27455
289 Ga0495667_0012132 3300046559 Bacteria 5840
290 Ga0495599_0048419 3300046678 Bacteria 2664
291 Ga0495669_0009275 3300046684 Bacteria 4146
292 Ga0495660_0000007 3300046810 Bacteria 485295
293 Ga0495604_0158343 3300047317 Bacteria 1602
294 Ga0495636_0015855 3300047318 Bacteria 3005
295 Ga0495680_0184058 3300047322 Bacteria 1506
296 Ga0495684_0039151 3300047471 Bacteria 3635
297 Ga0495686_0000834 3300047472 Bacteria 39641
298 Ga0495686_0320507 3300047472 Bacteria 850
299 Ga0496100_0049321 3300048903 Bacteria 2722
300 Ga0496101_0000098 3300048904 Bacteria 90945
301 Ga0496104_0000940 3300048907 Bacteria 25017
302 Ga0496104_0027083 3300048907 Bacteria 5301
303 Ga0496110_0200548 3300048913 Bacteria 1813
304 Ga0496116_0000127 3300048919 Bacteria 158773
305 Ga0496116_0000180 3300048919 Bacteria 126589
306 Ga0496116_0002243 3300048919 Bacteria 20546
307 Ga0496116_0005098 3300048919 Bacteria 12340
308 Ga0496116_0078411 3300048919 Bacteria 2060
309 Ga0496117_0009683 3300048920 Bacteria 8911
310 Ga0496117_0085413 3300048920 Bacteria 2055
311 Ga0496118_0004504 3300048921 Bacteria 16479
312 Ga0496118_0005561 3300048921 Bacteria 14274
313 Ga0496119_0001991 3300048922 Bacteria 23154
314 Ga0496119_0005046 3300048922 Bacteria 12830
315 Ga0496119_0024577 3300048922 Bacteria 4233
316 Ga0496120_0000046 3300048923 Bacteria 190675
317 Ga0496120_0000859 3300048923 Bacteria 42978
318 Ga0496120_0011047 3300048923 Bacteria 6234
319 Ga0496121_0477587 3300048924 Bacteria 797
320 Ga0496122_0000013 3300048925 Bacteria 501039
321 Ga0496122_0008146 3300048925 Bacteria 11412
322 Ga0496122_0009325 3300048925 Bacteria 10367
323 Ga0496122_0057017 3300048925 Bacteria 2906
324 Ga0496123_0000010 3300048926 Bacteria 501039
325 Ga0496123_0002225 3300048926 Bacteria 24606
326 Ga0496123_0165613 3300048926 Bacteria 1173
327 Ga0496124_0000515 3300048927 Bacteria 66726
328 Ga0496124_0009444 3300048927 Bacteria 10046
329 Ga0496124_0022253 3300048927 Bacteria 5817
330 Ga0496125_0000019 3300048928 Bacteria 474989
331 Ga0496125_0034192 3300048928 Bacteria 4484
332 Ga0496125_0187507 3300048928 Bacteria 1370
333 Ga0496126_0001396 3300048929 Bacteria 38235
334 Ga0496126_0443813 3300048929 Bacteria 1045
335 Ga0501033_0275877 3300049570 Bacteria 1188
336 Ga0501043_0077135 3300049579 Bacteria 2618
337 Ga0501046_0102431 3300049580 Bacteria 2195
338 Ga0501047_0003648 3300049581 Bacteria 14509
339 Ga0501068_0147901 3300049584 Bacteria 1475
340 Ga0501069_0001230 3300049585 Bacteria 12515
341 Ga0501070_0001632 3300049586 Bacteria 19881
342 Ga0501073_0004853 3300049589 Bacteria 10093
343 Ga0501074_0139921 3300049590 Bacteria 1731
344 Ga0501080_0018775 3300049742 Bacteria 6400
345 Ga0501083_0001539 3300049744 Bacteria 15778
346 Ga0501035_0495360 3300049822 Bacteria 1006
347 Ga0501044_0067622 3300049823 Bacteria 3640
348 Ga0501044_0181630 3300049823 Bacteria 2070
349 nmdc:mga00v17_6440_c1 3300050491 Bacteria 6229
350 nmdc:mga0k408_436_c1 3300050493 Bacteria 16112
351 nmdc:mga05p37_266886_c1 3300050507 Bacteria 2047
352 nmdc:mga09592_196596_c1 3300050508 Bacteria 1746
353 nmdc:mga09592_252065_c1 3300050508 Bacteria 1530
354 nmdc:mga09592_4961_c1 3300050508 Bacteria 10785
355 nmdc:mga0qj67_4913_c1 3300050509 Bacteria 9726
356 nmdc:mga06r32_38064_c1 3300050510 Bacteria 4554
357 nmdc:mga08y16_1378_c1 3300050511 Bacteria 24279
358 nmdc:mga08y16_14107_c1 3300050511 Bacteria 8412
359 nmdc:mga08y16_38217_c1 3300050511 Bacteria 5041
360 nmdc:mga08y16_85730_c1 3300050511 Bacteria 3283
361 nmdc:mga0n895_190754_c1 3300050512 Bacteria 2080
362 nmdc:mga08x19_15549_c1 3300050514 Bacteria 4632
363 Ga0495601_0003644 3300053077 Bacteria 8857
364 Ga0495619_0294868 3300053085 Bacteria 1123
365 Ga0501084_0029207 3300054114 Bacteria 4612
366 2511382106 2511231025 Bacteria 5324661
367 2511436069 2511231035 Bacteria 5341610
368 2550902741 2548877040 Bacteria 7507281
369 2556064735 2554235469 Bacteria 3590176
370 2571532264 2571042143 Bacteria 6986194
371 2643736747 2643221543 Bacteria 6628015
372 2671108196 2667528173 Bacteria 5375747
373 2707099796 2706794495 Bacteria 4536932
374 2728532183 2728368933 Bacteria 7044283
375 2772437818 2772190666 Bacteria 5117644
376 2791923246 2791354903 Bacteria 4937680
377 2793406209 2791355275 Bacteria 4429597
378 2821117817 2821111986 Bacteria 6894338
379 2842718606 2842718218 Bacteria 4560148
380 2847088473 2847085930 Bacteria 5070450
381 2854604582 2854601825 Bacteria 4797592
382 2858470126 2858466076 Bacteria 4722413
383 2864735850 2864733723 Bacteria 6770668
384 2876602685 2876601092 Bacteria 5114497
385 2885528141 2885526491 Bacteria 7164189
386 2889047861 2889042446 Bacteria 7618936
387 2904167005 2904162308 Bacteria 7086713
388 2904475132 2904474040 Bacteria 5504324
389 2904496188 2904490793 Bacteria 7046938
390 2908670956 2908669403 Bacteria 5740494
391 2919151478 2919150387 Bacteria 5500879
392 2919165482 2919160200 Bacteria 6929020
393 2927146352 2927143783 Bacteria 5504251
394 2931384970 2931384279 Bacteria 7299545
395 2937969548 2937967321 Bacteria 5094075
396 2939602847 2939602548 Bacteria 4950493
397 2939685363 2939679117 Bacteria 6921672
398 2945996416 2945991243 Bacteria 7008369
399 2946059104 2946053406 Bacteria 6978655
400 8016736677 8016733728 Bacteria 5274317
401 8019501911 8019499862 Bacteria 5169538
402 8054470677 8054465665 Bacteria 7323556
403 8055695245 8055693939 Bacteria 4772047
404 Ga0070669_100138205
405 SwRhRL2b_contig_1820963
406 JGI24740J21852_10015445
407 JGI25163J39215_1000007
408 JGI25164J39214_1000014
409 Ga0055538_1000005
410 Ga0055539_1000007
411 Ga0055533_1000009
412 Ga0055525_1000010
413 Ga0055541_1000005
414 Ga0058692_1000396
415 Ga0058692_1000727
416 Ga0058692_1028416
417 Ga0065704_10000763
418 Ga0070658_10049647
419 Ga0070658_10337622
420 Ga0070658_10356869
421 Ga0068869_100118194
422 Ga0068869_100242753
423 Ga0068868_100017934
424 Ga0068868_100225323
425 Ga0070689_100010921
426 Ga0070689_100147066
427 Ga0070689_100209632
428 Ga0070689_100436953
429 Ga0070687_100125310
430 Ga0070668_100052349
431 Ga0070669_100012333
432 Ga0070675_100024557
433 Ga0070675_100433028
434 Ga0070671_100177588
435 Ga0070674_100092775
436 Ga0070673_100057507
437 Ga0070673_100139839
438 Ga0070673_100238231
439 Ga0070673_100351711
440 Ga0070688_100011338
441 Ga0070709_10208642
442 Ga0070714_100049967
443 Ga0070714_100050054
444 Ga0070705_100171769
445 Ga0070700_100154466
446 Ga0070678_100241064
447 Ga0070681_10056966
448 Ga0070681_10184340
449 Ga0070672_100112338
450 Ga0070686_100198401
451 Ga0070695_100149452
452 Ga0070696_100041583
453 Ga0070704_100038995
454 Ga0070704_100087633
455 Ga0070704_100626215
456 Ga0068855_100018124
457 Ga0068855_100033076
458 Ga0068855_100038425
459 Ga0068855_100229615
460 Ga0068857_100104832
461 Ga0068854_100031363
462 Ga0068854_100414192
463 Ga0070702_100050004
464 Ga0068852_100005931
465 Ga0068852_100012070
466 Ga0068859_100089336
467 Ga0068859_100093504
468 Ga0068861_100099026
469 Ga0068861_100113266
470 Ga0068858_100092361
471 Ga0068858_100357271
472 Ga0068860_100144559
473 Ga0068862_100029564
474 Ga0075366_10000852
475 Ga0075366_10161211
476 Ga0075366_10167269
477 Ga0097621_100282802
478 Ga0097621_100420346
479 Ga0068871_100016657
480 Ga0068871_100156855
481 Ga0068871_100162057
482 Ga0075428_100009589
483 Ga0075428_100222091
484 Ga0075430_100019150
485 Ga0075431_100133000
486 Ga0075433_10120368
487 Ga0075434_100153227
488 Ga0075429_100000209
489 Ga0068865_100052505
490 Ga0075436_100002239
491 Ga0097620_100089346
492 Ga0097620_100093501
493 Ga0079104_1000080
494 Ga0105251_10024851
495 Ga0105244_10000006
496 Ga0105244_10000194
497 Ga0105244_10059040
498 Ga0105244_10060187
499 Ga0105244_10075697
500 Ga0105244_10116930
501 Ga0105244_10172022
502 Ga0105250_10005127
503 Ga0105240_10041414
504 Ga0105240_10188247
505 Ga0105240_10712215
506 Ga0111539_10006551
507 Ga0111539_10012497
508 Ga0111539_10090302
509 Ga0111539_10176825
510 Ga0105245_10072355
511 Ga0105245_10511482
512 Ga0114129_10190463
513 Ga0114129_10244953
514 Ga0105243_10746295
515 Ga0105241_10486451
516 Ga0105242_10030460
517 Ga0105242_10069921
518 Ga0105242_10138016
519 Ga0105242_10375474
520 Ga0105242_10583177
521 Ga0105248_10140455
522 Ga0105248_10395556
523 Ga0105238_10050204
524 Ga0105249_10042886
525 Ga0105249_10310352
526 Ga0105246_10000235
527 Ga0157373_10001013
528 Ga0157371_10000167
529 Ga0157371_10000462
530 Ga0157370_10000093
531 Ga0157370_10008428
532 Ga0157369_10577700
533 Ga0157374_10268197
534 Ga0157378_10052017
535 Ga0163162_10068774
536 Ga0163162_10100081
537 Ga0163162_10282557
538 Ga0157372_10005119
539 Ga0157372_10062670
540 Ga0157372_10141332
541 Ga0157375_10259435
542 Ga0157375_10278959
543 Ga0157375_10837012
544 Ga0157380_10065618
545 Ga0157380_10330341
546 Ga0157377_10015939
547 Ga0157376_10165804
548 Ga0157376_10590299
549 Ga0182006_1000063
550 Ga0183360_10539
551 Ga0213876_10034486
552 Ga0209760_100001
553 Ga0209784_100001
554 Ga0209566_100001
555 Ga0209674_100002
556 Ga0209563_100008
557 Ga0207427_100002
558 Ga0209437_100007
559 Ga0209437_100295
560 Ga0209677_100004
561 Ga0209233_1001492
562 Ga0207697_10119427
563 Ga0207656_10011152
564 Ga0207696_1000312
565 Ga0207696_1000444
566 Ga0207655_1000023
567 Ga0207655_1000149
568 Ga0207655_1000157
569 Ga0207655_1003730
570 Ga0207655_1024976
571 Ga0207655_1060931
572 Ga0207655_1100162
573 Ga0207713_1019782
574 Ga0207643_10024700
575 Ga0207705_10086360
576 Ga0207705_10115778
577 Ga0207705_10179542
578 Ga0207705_10253362
579 Ga0207654_10432243
580 Ga0207707_10058255
581 Ga0207707_10131372
582 Ga0207695_10150915
583 Ga0207671_10478652
584 Ga0207657_10067181
585 Ga0207652_10607504
586 Ga0207681_10067848
587 Ga0207659_10009662
588 Ga0207659_10217671
589 Ga0207659_10296028
590 Ga0207659_10694896
591 Ga0207659_10790770
592 Ga0207687_10085749
593 Ga0207700_10207244
594 Ga0207700_10537095
595 Ga0207664_10017547
596 Ga0207664_10314210
597 Ga0207644_10565009
598 Ga0207690_10515059
599 Ga0207706_10214264
600 Ga0207706_10310017
601 Ga0207686_10011601
602 Ga0207686_10016399
603 Ga0207686_10128328
604 Ga0207686_10321174
605 Ga0207686_10353992
606 Ga0207670_10058971
607 Ga0207670_10105073
608 Ga0207670_10119892
609 Ga0207670_10398945
610 Ga0207704_10006758
611 Ga0207665_10485052
612 Ga0207691_10011455
613 Ga0207691_10015917
614 Ga0207711_10386853
615 Ga0207689_10040961
616 Ga0207667_10006733
617 Ga0207667_10020766
618 Ga0207667_10114030
619 Ga0207651_10046082
620 Ga0207651_10239081
621 Ga0207712_10096361
622 Ga0207668_10099800
623 Ga0207677_10013698
624 Ga0207708_10107440
625 Ga0207708_10250121
626 Ga0207648_10066284
627 Ga0207674_10018402
628 Ga0207674_10283844
629 Ga0207675_100130673
630 Ga0207675_100174897
631 Ga0207698_10015160
632 Ga0207698_10147741
633 Ga0207698_10361586
634 Ga0209371_1000010
635 Ga0209371_1000170
636 Ga0209371_1001882
637 Ga0209371_1006008
638 Ga0209996_1005223
639 Ga0209971_1005985
640 Ga0209966_1002571
641 Ga0209974_10017722
642 Ga0207428_10001508
643 Ga0207428_10036227
644 Ga0207428_10145132
645 Ga0268265_10177564
646 Ga0268264_10028474
647 Ga0268256_1000022
648 Ga0268256_1000142
649 Ga0268256_1001643
650 Ga0268256_1005987
651 Ga0307408_100078146
652 Ga0265314_10024870
653 Ga0307405_10295694
654 Ga0316577_10020637
655 Ga0307406_10260458
656 Ga0307412_10301886
657 Ga0307412_10648918
658 Ga0307416_100022416
659 Ga0307416_100254356
660 Ga0373956_0026804
661 Ga0373955_0115918
662 Ga0316574_0027218
663 Ga0373931_0133936
664 Ga0373947_0301396
665 Ga0373937_0514293
666 Ga0316582_0045879
667 Ga0316584_0001871
668 Ga0395900_0187203
669 Ga0395898_0413609
670 Ga0395901_0317114
671 Ga0395901_0411336
672 Ga0436365_0346054
673 Ga0439438_000001
674 Ga0439438_000958
675 Ga0439447_002111
676 Ga0439447_002918
677 Ga0439432_002348
678 Ga0439452_000003
679 Ga0451577_0018489
680 Ga0453683_0425910
681 Ga0453684_0068391
682 Ga0466959_0042716
683 Ga0466958_0024192
684 Ga0495591_000080
685 Ga0495651_0262497
686 Ga0495650_0000016
687 Ga0495608_0005328
688 Ga0495652_0133994
689 Ga0495654_0000125
690 Ga0495587_0077039
691 Ga0495645_0000490
692 Ga0495667_0012132
693 Ga0495599_0048419
694 Ga0495669_0009275
695 Ga0495660_0000007
696 Ga0495604_0158343
697 Ga0495636_0015855
698 Ga0495680_0184058
699 Ga0495684_0039151
700 Ga0495686_0000834
701 Ga0495686_0320507
702 Ga0496100_0049321
703 Ga0496101_0000098
704 Ga0496104_0000940
705 Ga0496104_0027083
706 Ga0496110_0200548
707 Ga0496116_0000127
708 Ga0496116_0000180
709 Ga0496116_0002243
710 Ga0496116_0005098
711 Ga0496116_0078411
712 Ga0496117_0009683
713 Ga0496117_0085413
714 Ga0496118_0004504
715 Ga0496118_0005561
716 Ga0496119_0001991
717 Ga0496119_0005046
718 Ga0496119_0024577
719 Ga0496120_0000046
720 Ga0496120_0000859
721 Ga0496120_0011047
722 Ga0496121_0477587
723 Ga0496122_0000013
724 Ga0496122_0008146
725 Ga0496122_0009325
726 Ga0496122_0057017
727 Ga0496123_0000010
728 Ga0496123_0002225
729 Ga0496123_0165613
730 Ga0496124_0000515
731 Ga0496124_0009444
732 Ga0496124_0022253
733 Ga0496125_0000019
734 Ga0496125_0034192
735 Ga0496125_0187507
736 Ga0496126_0001396
737 Ga0496126_0443813
738 Ga0501033_0275877
739 Ga0501043_0077135
740 Ga0501046_0102431
741 Ga0501047_0003648
742 Ga0501068_0147901
743 Ga0501069_0001230
744 Ga0501070_0001632
745 Ga0501073_0004853
746 Ga0501074_0139921
747 Ga0501080_0018775
748 Ga0501083_0001539
749 Ga0501035_0495360
750 Ga0501044_0067622
751 Ga0501044_0181630
752 nmdc:mga00v17_6440_c1
753 nmdc:mga0k408_436_c1
754 nmdc:mga05p37_266886_c1
755 nmdc:mga09592_196596_c1
756 nmdc:mga09592_252065_c1
757 nmdc:mga09592_4961_c1
758 nmdc:mga0qj67_4913_c1
759 nmdc:mga06r32_38064_c1
760 nmdc:mga08y16_1378_c1
761 nmdc:mga08y16_14107_c1
762 nmdc:mga08y16_38217_c1
763 nmdc:mga08y16_85730_c1
764 nmdc:mga0n895_190754_c1
765 nmdc:mga08x19_15549_c1
766 Ga0495601_0003644
767 Ga0495619_0294868
768 Ga0501084_0029207
769 2511382106
770 2511436069
771 2550902741
772 2556064735
773 2571532264
774 2643736747
775 2671108196
776 2707099796
777 2728532183
778 2772437818
779 2791923246
780 2793406209
781 2821117817
782 2842718606
783 2847088473
784 2854604582
785 2858470126
786 2864735850
787 2876602685
788 2885528141
789 2889047861
790 2904167005
791 2904475132
792 2904496188
793 2908670956
794 2919151478
795 2919165482
796 2927146352
797 2931384970
798 2937969548
799 2939602847
800 2939685363
801 2945996416
802 2946059104
803 8016736677
804 8019501911
805 8054470677
806 8055695245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

31

163

0.95

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

153

246

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e59-assembly1.cif.gz_A-2 e.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate 0.9968 3 239
5um0-assembly1.cif.gz_D crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae 0.99 4 230
3ezn-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b 0.9885 4 237
5vve-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from naegleria fowleri 0.9872 1 239
3fdz-assembly1.cif.gz_B crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid 0.9866 4 231
ID Description Score Start End Superfamily
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9926 6 231 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9828 6 231 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9599 1 243 3.40.50.1240
af_Q8T8W6_17_267_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9565 2 244 3.40.50.1240
af_F1M1Y1_1_186_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9539 59 250 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A377E6M7-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (BPG-dependent PGAM) (PGAM) (Phosphoglyceromutase) (dPGM) (EC 5.4.2.11) 1.001 1 223 GO:0006094
GO:0006096
GO:0046538
AF-A0A2P8K6W6-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 1.001 56 194 GO:0006094
GO:0006096
GO:0016868
AF-A0A4V1TKA2-F1-model_v4 deleted 0.9993 9 85
AF-A0A3D4YTB4-F1-model_v4 deleted 0.999 9 153
AF-A0A5N8H843-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.9986 1 179 GO:0006094
GO:0006096
GO:0046538

Map