F435216

General Info

Members Datasets Scaffolds Average Seq Length
402 217 402 258

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0013031|Ga0501039_0013031_4631_5485
Length 284
Sequence MVSWLPVVEERVCPKAMTSSISIDSTPADRRDECRIRIAAAGDIHYGERADDRKRAAAAFGALEGRVDLLLLAGDLTTHGEPEQAQIVADAVRDLGIPVLAVLGNHDWHVNRADEFAAVLRDAGVIVMDKDHSHEILDLCDTEVGIVGVKGFMGGFPGSHLPDFGEPSLRGVYRESVDEAEALDAGLRAVAMCPFRIVLLHYAPTTETLEGERREIWTFLGTDRLAPPILEHNPDMVLHGHAHAGTFEGRLGEVPVYNVSVPVLGEDFWIFELAGDRRAPSEVH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 7.96
Rhizosphere 86.82
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001883 3300003203 Bacteria 9864
2 JGI25407J50210_10000092 3300003373 Bacteria 12133
3 Ga0070683_100121992 3300005329 Bacteria 2463
4 Ga0070683_100322481 3300005329 Bacteria 1470
5 Ga0070683_100749650 3300005329 Bacteria 935
6 Ga0068869_100260933 3300005334 Bacteria 1387
7 Ga0070680_100000744 3300005336 Bacteria 22758
8 Ga0070680_100132037 3300005336 Bacteria 2090
9 Ga0070680_100225476 3300005336 Bacteria 1582
10 Ga0070682_100038280 3300005337 Bacteria 2941
11 Ga0070682_100074549 3300005337 Bacteria 2179
12 Ga0070682_100075332 3300005337 Bacteria 2170
13 Ga0068868_100025496 3300005338 Bacteria 4499
14 Ga0068868_100628437 3300005338 Bacteria 954
15 Ga0070660_100040806 3300005339 Bacteria 3534
16 Ga0070691_10126960 3300005341 Bacteria 1289
17 Ga0070661_100096994 3300005344 Bacteria 2188
18 Ga0070661_100175553 3300005344 Bacteria 1628
19 Ga0070661_100388208 3300005344 Bacteria 1102
20 Ga0070674_100132542 3300005356 Bacteria 1860
21 Ga0070659_100006654 3300005366 Bacteria 8353
22 Ga0070659_100159221 3300005366 Bacteria 1845
23 Ga0070714_100075079 3300005435 Bacteria 2933
24 Ga0070714_100437707 3300005435 Bacteria 1240
25 Ga0070713_100022876 3300005436 Bacteria 4839
26 Ga0070710_10032115 3300005437 Bacteria 2841
27 Ga0070710_10162285 3300005437 Bacteria 1387
28 Ga0070701_10083519 3300005438 Unclassified 1734
29 Ga0070711_100568454 3300005439 Unclassified 942
30 Ga0070705_100117196 3300005440 Bacteria 1713
31 Ga0070705_100137121 3300005440 Bacteria 1605
32 Ga0070700_100080401 3300005441 Unclassified 2103
33 Ga0070700_100093261 3300005441 Bacteria 1969
34 Ga0070708_100142334 3300005445 Bacteria 2225
35 Ga0070663_100031170 3300005455 Bacteria 3662
36 Ga0070678_100006090 3300005456 Bacteria 7039
37 Ga0070681_10013860 3300005458 Bacteria 8022
38 Ga0070681_10282361 3300005458 Bacteria 1571
39 Ga0068867_100128449 3300005459 Bacteria 1967
40 Ga0070707_100068200 3300005468 Bacteria 3423
41 Ga0070679_100057362 3300005530 Bacteria 3882
42 Ga0070679_100167542 3300005530 Bacteria 2170
43 Ga0070684_100023037 3300005535 Bacteria 5201
44 Ga0070684_100105608 3300005535 Bacteria 2520
45 Ga0068853_100248797 3300005539 Bacteria 1630
46 Ga0070672_100729491 3300005543 Bacteria 869
47 Ga0070693_100003076 3300005547 Bacteria 7742
48 Ga0070693_100036835 3300005547 Bacteria 2723
49 Ga0070665_100253828 3300005548 Bacteria 1759
50 Ga0070704_100584037 3300005549 Bacteria 980
51 Ga0070664_100030007 3300005564 Bacteria 4534
52 Ga0070664_100103801 3300005564 Bacteria 2475
53 Ga0070664_100564826 3300005564 Bacteria 1053
54 Ga0068857_100238934 3300005577 Bacteria 1663
55 Ga0068856_100021936 3300005614 Bacteria 6208
56 Ga0068856_100055666 3300005614 Bacteria 3903
57 Ga0070702_100051473 3300005615 Bacteria 2358
58 Ga0068852_100059940 3300005616 Bacteria 3303
59 Ga0068859_100041331 3300005617 Bacteria 4631
60 Ga0068864_100289890 3300005618 Bacteria 1530
61 Ga0068861_100147146 3300005719 Bacteria 1929
62 Ga0081455_10117377 3300005937 Bacteria 2103
63 Ga0081538_10000544 3300005981 Bacteria 41533
64 Ga0081538_10000842 3300005981 Bacteria 33275
65 Ga0081538_10002495 3300005981 Bacteria 17936
66 Ga0081538_10003881 3300005981 Bacteria 13960
67 Ga0081538_10009662 3300005981 Bacteria 8016
68 Ga0081538_10014032 3300005981 Bacteria 6300
69 Ga0081538_10019173 3300005981 Bacteria 5099
70 Ga0081538_10024683 3300005981 Bacteria 4275
71 Ga0081538_10032020 3300005981 Bacteria 3534
72 Ga0081538_10048292 3300005981 Bacteria 2597
73 Ga0081539_10004714 3300005985 Bacteria 14767
74 Ga0075365_10109650 3300006038 Bacteria 1896
75 Ga0075364_10191544 3300006051 Bacteria 1385
76 Ga0075432_10010647 3300006058 Bacteria 3125
77 Ga0070715_10038607 3300006163 Bacteria 1983
78 Ga0097621_100034721 3300006237 Bacteria 4024
79 Ga0068871_100047761 3300006358 Bacteria 3453
80 Ga0075428_100062146 3300006844 Bacteria 4089
81 Ga0075428_100154436 3300006844 Bacteria 2493
82 Ga0075430_100016227 3300006846 Bacteria 6343
83 Ga0075433_10182156 3300006852 Bacteria 1869
84 Ga0068865_100095007 3300006881 Bacteria 2171
85 Ga0068865_100199664 3300006881 Bacteria 1552
86 Ga0075436_100103943 3300006914 Bacteria 1979
87 Ga0097620_100041331 3300006931 Bacteria 4631
88 Ga0105240_10278906 3300009093 Bacteria 1921
89 Ga0111539_10078836 3300009094 Bacteria 3874
90 Ga0111539_10102431 3300009094 Bacteria 3360
91 Ga0111539_10161555 3300009094 Bacteria 2620
92 Ga0111539_10300172 3300009094 Bacteria 1869
93 Ga0105245_10040528 3300009098 Bacteria 4150
94 Ga0114129_10109516 3300009147 Bacteria 3813
95 Ga0114129_10296845 3300009147 Bacteria 2155
96 Ga0105243_10046827 3300009148 Bacteria 3403
97 Ga0105243_10059963 3300009148 Bacteria 3039
98 Ga0105241_10428344 3300009174 Bacteria 1166
99 Ga0105237_10009348 3300009545 Bacteria 10498
100 Ga0105238_10020509 3300009551 Bacteria 6729
101 Ga0105246_10245081 3300011119 Bacteria 1419
102 Ga0157373_10132661 3300013100 Bacteria 1751
103 Ga0157371_10499435 3300013102 Bacteria 898
104 Ga0157369_10009959 3300013105 Bacteria 10858
105 Ga0163162_11162067 3300013306 Unclassified 875
106 Ga0157372_10012329 3300013307 Bacteria 9110
107 Ga0157375_11072358 3300013308 Bacteria 942
108 Ga0157375_11229552 3300013308 Bacteria 879
109 Ga0163163_10024579 3300014325 Bacteria 5734
110 Ga0157380_10356867 3300014326 Bacteria 1370
111 Ga0157377_10118503 3300014745 Bacteria 1601
112 Ga0213876_10030979 3300021384 Bacteria 2823
113 Ga0213876_10053393 3300021384 Bacteria 2135
114 Ga0213875_10063770 3300021388 Bacteria 1722
115 Ga0213875_10137311 3300021388 Unclassified 1144
116 Ga0207692_10019151 3300025898 Bacteria 3087
117 Ga0207699_10019611 3300025906 Bacteria 3610
118 Ga0207645_10383559 3300025907 Bacteria 944
119 Ga0207643_10151291 3300025908 Bacteria 1391
120 Ga0207707_10001912 3300025912 Bacteria 18946
121 Ga0207693_10113921 3300025915 Bacteria 2122
122 Ga0207693_10145057 3300025915 Bacteria 1867
123 Ga0207663_10002995 3300025916 Bacteria 8178
124 Ga0207663_10229848 3300025916 Bacteria 1354
125 Ga0207660_10122134 3300025917 Bacteria 1974
126 Ga0207660_10142056 3300025917 Bacteria 1836
127 Ga0207662_10120048 3300025918 Bacteria 1648
128 Ga0207657_10114204 3300025919 Bacteria 2227
129 Ga0207657_10133921 3300025919 Bacteria 2029
130 Ga0207649_10137914 3300025920 Bacteria 1665
131 Ga0207649_10263233 3300025920 Bacteria 1247
132 Ga0207649_10275619 3300025920 Bacteria 1221
133 Ga0207652_10461693 3300025921 Bacteria 1144
134 Ga0207646_10112791 3300025922 Bacteria 2440
135 Ga0207694_10038915 3300025924 Bacteria 3657
136 Ga0207659_10475977 3300025926 Bacteria 1055
137 Ga0207687_10400134 3300025927 Bacteria 1129
138 Ga0207700_10056541 3300025928 Bacteria 2954
139 Ga0207664_10026148 3300025929 Bacteria 4407
140 Ga0207664_10073721 3300025929 Bacteria 2755
141 Ga0207664_10191949 3300025929 Bacteria 1759
142 Ga0207706_10081352 3300025933 Bacteria 2846
143 Ga0207706_10579190 3300025933 Bacteria 965
144 Ga0207709_10104764 3300025935 Unclassified 1878
145 Ga0207669_10359388 3300025937 Bacteria 1128
146 Ga0207704_10473218 3300025938 Bacteria 1004
147 Ga0207661_10022136 3300025944 Bacteria 4779
148 Ga0207661_10490510 3300025944 Bacteria 1122
149 Ga0207679_10697978 3300025945 Unclassified 921
150 Ga0207712_10184300 3300025961 Bacteria 1642
151 Ga0207668_10241526 3300025972 Bacteria 1462
152 Ga0207640_10270717 3300025981 Bacteria 1329
153 Ga0207640_10466195 3300025981 Unclassified 1044
154 Ga0207677_10027867 3300026023 Bacteria 3566
155 Ga0207677_10063057 3300026023 Bacteria 2574
156 Ga0207639_10062610 3300026041 Bacteria 2878
157 Ga0207678_10064723 3300026067 Bacteria 3141
158 Ga0207678_10291945 3300026067 Bacteria 1400
159 Ga0207708_10098682 3300026075 Unclassified 2258
160 Ga0207708_10136242 3300026075 Bacteria 1923
161 Ga0207708_10240109 3300026075 Bacteria 1457
162 Ga0207702_10015196 3300026078 Bacteria 6383
163 Ga0207702_10315158 3300026078 Bacteria 1488
164 Ga0207648_10054327 3300026089 Bacteria 3499
165 Ga0207648_10305942 3300026089 Bacteria 1426
166 Ga0207674_10039947 3300026116 Bacteria 4861
167 Ga0207675_100069883 3300026118 Bacteria 3282
168 Ga0207675_100157550 3300026118 Bacteria 2164
169 Ga0207675_100456114 3300026118 Bacteria 1267
170 Ga0207683_10002935 3300026121 Bacteria 14872
171 Ga0207428_10002990 3300027907 Bacteria 16692
172 Ga0207428_10027159 3300027907 Bacteria 4767
173 Ga0207428_10244341 3300027907 Bacteria 1340
174 Ga0268266_10386291 3300028379 Bacteria 1321
175 Ga0307408_100078591 3300031548 Bacteria 2460
176 Ga0307408_100127513 3300031548 Unclassified 1981
177 Ga0307408_100302471 3300031548 Bacteria 1340
178 Ga0307408_100351025 3300031548 Bacteria 1252
179 Ga0307408_100358922 3300031548 Bacteria 1239
180 Ga0307408_100416980 3300031548 Bacteria 1157
181 Ga0307405_10008105 3300031731 Bacteria 5305
182 Ga0307405_10028254 3300031731 Bacteria 3265
183 Ga0307405_10129538 3300031731 Bacteria 1741
184 Ga0307405_10143293 3300031731 Bacteria 1670
185 Ga0307405_10382471 3300031731 Bacteria 1096
186 Ga0307413_10021925 3300031824 Bacteria 3430
187 Ga0307413_10031884 3300031824 Bacteria 2979
188 Ga0307413_10047875 3300031824 Bacteria 2552
189 Ga0307413_10284041 3300031824 Bacteria 1246
190 Ga0307410_10014932 3300031852 Bacteria 4590
191 Ga0307410_10103279 3300031852 Bacteria 2047
192 Ga0307410_10150176 3300031852 Bacteria 1734
193 Ga0307410_10183744 3300031852 Bacteria 1585
194 Ga0326468_10015859 3300031889 Bacteria 839
195 Ga0307406_10012651 3300031901 Bacteria 4812
196 Ga0307406_10020910 3300031901 Bacteria 3863
197 Ga0307406_10066396 3300031901 Bacteria 2348
198 Ga0307406_10085563 3300031901 Bacteria 2109
199 Ga0307406_10237183 3300031901 Bacteria 1366
200 Ga0307406_10357953 3300031901 Bacteria 1143
201 Ga0307407_10004638 3300031903 Bacteria 5864
202 Ga0307407_10005169 3300031903 Bacteria 5633
203 Ga0307407_10153158 3300031903 Bacteria 1500
204 Ga0307407_10220411 3300031903 Bacteria 1282
205 Ga0307407_10249723 3300031903 Bacteria 1215
206 Ga0307407_10261482 3300031903 Bacteria 1191
207 Ga0307412_10065896 3300031911 Bacteria 2453
208 Ga0307412_10269010 3300031911 Bacteria 1333
209 Ga0307409_100003066 3300031995 Bacteria 8939
210 Ga0307409_100041233 3300031995 Bacteria 3446
211 Ga0307409_100048699 3300031995 Bacteria 3227
212 Ga0307409_100174878 3300031995 Bacteria 1894
213 Ga0307409_100268363 3300031995 Bacteria 1570
214 Ga0307416_100001087 3300032002 Bacteria 14526
215 Ga0307416_100003831 3300032002 Bacteria 8939
216 Ga0307416_100042208 3300032002 Bacteria 3559
217 Ga0307416_100173352 3300032002 Bacteria 2012
218 Ga0307416_100190858 3300032002 Bacteria 1932
219 Ga0307416_100562818 3300032002 Bacteria 1215
220 Ga0307416_100654394 3300032002 Bacteria 1136
221 Ga0307414_10019957 3300032004 Bacteria 4166
222 Ga0307414_10279700 3300032004 Bacteria 1402
223 Ga0307411_10006877 3300032005 Bacteria 5733
224 Ga0307411_10068080 3300032005 Bacteria 2398
225 Ga0307411_10201200 3300032005 Bacteria 1530
226 Ga0307411_10531545 3300032005 Bacteria 1000
227 Ga0307415_100002961 3300032126 Bacteria 8531
228 Ga0307415_100013784 3300032126 Bacteria 4729
229 Ga0307415_100029453 3300032126 Bacteria 3509
230 Ga0307415_100060562 3300032126 Bacteria 2616
231 Ga0307415_100109907 3300032126 Bacteria 2043
232 Ga0307415_100164737 3300032126 Bacteria 1722
233 Ga0373959_0007640 3300034820 Bacteria 1821
234 Ga0373938_0024221 3300034957 Bacteria 1254
235 Ga0373940_0032315 3300035088 Bacteria 1402
236 Ga0373932_0004992 3300035112 Bacteria 3124
237 Ga0395899_0196291 3300037312 Bacteria 1410
238 Ga0436364_0691268 3300037853 Bacteria 1124
239 Ga0436364_1238467 3300037853 Bacteria 3877
240 Ga0436364_1333433 3300037853 Bacteria 9399
241 Ga0436364_1366524 3300037853 Bacteria 5617
242 Ga0436364_1447937 3300037853 Bacteria 2633
243 Ga0395901_0183162 3300038443 Bacteria 2197
244 Ga0395901_0630856 3300038443 Bacteria 1077
245 Ga0242420_003716 3300038996 Bacteria 2268
246 Ga0436365_0308855 3300039437 Bacteria 18122
247 Ga0436365_1008576 3300039437 Unclassified 2425
248 Ga0436365_1093652 3300039437 Bacteria 18228
249 Ga0436365_1897488 3300039437 Bacteria 2103
250 Ga0436363_0654155 3300039450 Bacteria 35800
251 Ga0436363_1274650 3300039450 Bacteria 2698
252 Ga0436363_1386217 3300039450 Bacteria 3272
253 Ga0436362_0768940 3300039453 Bacteria 1705
254 Ga0436362_1053058 3300039453 Bacteria 1989
255 Ga0451802_0683558 3300041460 Bacteria 1876
256 Ga0439433_0008922 3300041999 Bacteria 2182
257 Ga0439448_0003897 3300042005 Bacteria 4179
258 Ga0439450_027376 3300042008 Bacteria 1262
259 Ga0439455_0085668 3300042012 Bacteria 860
260 Ga0439463_059586 3300042016 Bacteria 976
261 Ga0439458_0001952 3300042157 Bacteria 5111
262 Ga0439459_0032223 3300042438 Bacteria 1073
263 Ga0439440_0046483 3300042993 Bacteria 1073
264 Ga0466965_0097969 3300044683 Bacteria 1497
265 Ga0466961_0047627 3300044693 Bacteria 2741
266 Ga0466963_0001331 3300044694 Bacteria 13156
267 Ga0466963_0004785 3300044694 Bacteria 7895
268 Ga0466963_0027122 3300044694 Bacteria 3666
269 Ga0466963_0254496 3300044694 Bacteria 1232
270 Ga0466963_0262189 3300044694 Bacteria 1213
271 Ga0466963_0268630 3300044694 Bacteria 1198
272 Ga0466963_0274616 3300044694 Bacteria 1184
273 Ga0466971_0018406 3300044719 Bacteria 3094
274 Ga0466968_0132113 3300044735 Bacteria 1137
275 Ga0466957_0089216 3300044842 Unclassified 1930
276 Ga0466957_0142439 3300044842 Bacteria 1545
277 Ga0466960_0000087 3300044901 Bacteria 30410
278 Ga0466960_0043331 3300044901 Bacteria 2140
279 Ga0466960_0062541 3300044901 Bacteria 1830
280 Ga0466960_0146602 3300044901 Bacteria 1258
281 Ga0466959_0117341 3300045049 Bacteria 1894
282 Ga0466959_0278146 3300045049 Bacteria 1149
283 Ga0466958_0011493 3300045836 Bacteria 4986
284 Ga0466958_0014064 3300045836 Bacteria 4565
285 Ga0466958_0029169 3300045836 Bacteria 3273
286 Ga0466958_0049269 3300045836 Bacteria 2548
287 Ga0466958_0209158 3300045836 Bacteria 1242
288 Ga0466967_0005370 3300045976 Bacteria 8866
289 Ga0466967_0021988 3300045976 Bacteria 5194
290 Ga0466967_0023703 3300045976 Bacteria 5034
291 Ga0466967_0047344 3300045976 Bacteria 3748
292 Ga0466967_0048197 3300045976 Bacteria 3719
293 Ga0466967_0050939 3300045976 Bacteria 3626
294 Ga0466967_0056147 3300045976 Bacteria 3471
295 Ga0466967_0064835 3300045976 Bacteria 3250
296 Ga0466967_0083571 3300045976 Bacteria 2887
297 Ga0466967_0083769 3300045976 Bacteria 2884
298 Ga0466967_0208879 3300045976 Bacteria 1851
299 Ga0466967_0317541 3300045976 Bacteria 1502
300 Ga0466967_0348254 3300045976 Bacteria 1433
301 Ga0466967_0458022 3300045976 Bacteria 1247
302 Ga0466967_0797794 3300045976 Bacteria 937
303 Ga0495650_0000054 3300046471 Bacteria 313631
304 Ga0495639_0269065 3300046475 Bacteria 845
305 Ga0495630_0032030 3300046517 Bacteria 3915
306 Ga0495630_0043809 3300046517 Bacteria 3344
307 Ga0495665_0070426 3300046531 Bacteria 1843
308 Ga0495598_0025090 3300046537 Bacteria 1623
309 Ga0495621_0024747 3300046539 Bacteria 2009
310 Ga0495658_0051191 3300046683 Bacteria 2339
311 Ga0495676_0009158 3300047321 Bacteria 9027
312 Ga0496100_0020759 3300048903 Bacteria 3945
313 Ga0496100_0387218 3300048903 Archaea 1063
314 Ga0496101_0123940 3300048904 Bacteria 1956
315 Ga0496101_0128584 3300048904 Bacteria 1922
316 Ga0496102_0016901 3300048905 Bacteria 6385
317 Ga0496102_0329667 3300048905 Bacteria 1438
318 Ga0496103_0007758 3300048906 Bacteria 6382
319 Ga0496104_0003336 3300048907 Bacteria 13855
320 Ga0496105_0001512 3300048908 Bacteria 16428
321 Ga0496105_0118931 3300048908 Bacteria 2179
322 Ga0496106_0068873 3300048909 Bacteria 2700
323 Ga0496107_0550218 3300048910 Bacteria 855
324 Ga0496108_0088043 3300048911 Bacteria 2638
325 Ga0496108_0115721 3300048911 Bacteria 2296
326 Ga0496108_0206985 3300048911 Bacteria 1702
327 Ga0496108_0491353 3300048911 Bacteria 1072
328 Ga0496109_0011656 3300048912 Bacteria 7559
329 Ga0496109_0139209 3300048912 Bacteria 2269
330 Ga0496110_0000774 3300048913 Bacteria 22221
331 Ga0496110_0509105 3300048913 Bacteria 1096
332 Ga0496111_0004555 3300048914 Bacteria 8772
333 Ga0496112_0003828 3300048915 Bacteria 12567
334 Ga0496112_0024387 3300048915 Bacteria 5790
335 Ga0496112_0303480 3300048915 Bacteria 1542
336 Ga0496113_0003911 3300048916 Bacteria 9031
337 Ga0496113_0139410 3300048916 Bacteria 1907
338 Ga0496114_0008667 3300048917 Bacteria 8061
339 Ga0496114_0120439 3300048917 Bacteria 2256
340 Ga0496114_0393291 3300048917 Bacteria 1228
341 Ga0496115_0055640 3300048918 Bacteria 3178
342 Ga0496115_0248040 3300048918 Bacteria 1466
343 Ga0501031_0049962 3300049568 Bacteria 2726
344 Ga0501031_0061639 3300049568 Bacteria 2444
345 Ga0501031_0079700 3300049568 Bacteria 2134
346 Ga0501036_0019833 3300049572 Bacteria 5646
347 Ga0501036_0089292 3300049572 Bacteria 2604
348 Ga0501037_0108650 3300049573 Bacteria 1999
349 Ga0501038_0149299 3300049574 Bacteria 1906
350 Ga0501039_0013031 3300049575 Bacteria 6356
351 Ga0501039_0036921 3300049575 Bacteria 3770
352 Ga0501039_0037597 3300049575 Bacteria 3737
353 Ga0501040_0049272 3300049576 Bacteria 2880
354 Ga0501040_0088101 3300049576 Bacteria 2155
355 Ga0501040_0176389 3300049576 Bacteria 1514
356 Ga0501041_0045687 3300049577 Bacteria 2663
357 Ga0501042_0014344 3300049578 Bacteria 5408
358 Ga0501042_0368009 3300049578 Bacteria 1040
359 Ga0501042_0460668 3300049578 Bacteria 922
360 Ga0501046_0147505 3300049580 Bacteria 1776
361 Ga0501046_0426252 3300049580 Bacteria 956
362 Ga0501047_0367131 3300049581 Bacteria 1275
363 Ga0501048_0013622 3300049582 Bacteria 6035
364 Ga0501048_0308700 3300049582 Bacteria 1126
365 Ga0501068_0309009 3300049584 Bacteria 1013
366 Ga0501070_0248099 3300049586 Bacteria 1457
367 Ga0501071_0014453 3300049587 Bacteria 5399
368 Ga0501071_0033657 3300049587 Bacteria 3641
369 Ga0501072_0036682 3300049588 Bacteria 3844
370 Ga0501072_0130564 3300049588 Bacteria 2002
371 Ga0501074_0036661 3300049590 Bacteria 3552
372 Ga0501075_0018125 3300049591 Bacteria 5091
373 Ga0501075_0029438 3300049591 Bacteria 4062
374 Ga0501076_0032313 3300049592 Bacteria 4084
375 Ga0501076_0048183 3300049592 Bacteria 3369
376 Ga0501077_0047084 3300049593 Bacteria 2740
377 Ga0501077_0048085 3300049593 Bacteria 2710
378 Ga0501080_0035031 3300049742 Bacteria 4687
379 Ga0501080_0182973 3300049742 Bacteria 1928
380 Ga0501080_0390169 3300049742 Bacteria 1253
381 Ga0501081_0016750 3300049743 Bacteria 4845
382 Ga0501083_0175511 3300049744 Bacteria 1400
383 Ga0501035_0239435 3300049822 Bacteria 1544
384 Ga0501045_0089897 3300049824 Bacteria 2268
385 nmdc:mga03683_30649_c1 3300050489 Bacteria 2153
386 nmdc:mga00v17_69580_c1 3300050491 Bacteria 2178
387 nmdc:mga0yw44_7075_c1 3300050492 Bacteria 5493
388 nmdc:mga05p37_16031_c1 3300050507 Bacteria 9018
389 nmdc:mga05p37_290095_c1 3300050507 Bacteria 1948
390 nmdc:mga09592_194561_c1 3300050508 Bacteria 1755
391 nmdc:mga09592_202343_c1 3300050508 Unclassified 1720
392 nmdc:mga06r32_177968_c1 3300050510 Bacteria 2112
393 nmdc:mga08y16_14590_c1 3300050511 Bacteria 8264
394 nmdc:mga08y16_545792_c1 3300050511 Bacteria 1173
395 nmdc:mga08y16_90757_c1 3300050511 Bacteria 3185
396 nmdc:mga0n895_63363_c1 3300050512 Bacteria 3656
397 nmdc:mga0rr50_13161_c1 3300050513 Bacteria 5376
398 nmdc:mga0a205_57636_c1 3300050515 Bacteria 3751
399 Ga0501082_0023739 3300060353 Bacteria 5287
400 Ga0466962_0070027 3300061719 Bacteria 1675
401 Ga0530510_0007298 3300061734 Bacteria 7691
402 Ga0530510_0210637 3300061734 Bacteria 1444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10383559 Ga0207645_103835591 228
2 3300026089 Ga0207648_10305942 Ga0207648_103059422 235
3 3300005344 Ga0070661_100388208 Ga0070661_1003882081 243
4 3300006058 Ga0075432_10010647 Ga0075432_100106473 243
5 3300006844 Ga0075428_100154436 Ga0075428_1001544362 243
6 3300006852 Ga0075433_10182156 Ga0075433_101821562 243
7 3300006881 Ga0068865_100095007 Ga0068865_1000950072 243
8 3300006914 Ga0075436_100103943 Ga0075436_1001039433 243
9 3300009094 Ga0111539_10102431 Ga0111539_101024312 243
10 3300009147 Ga0114129_10109516 Ga0114129_101095164 243
11 3300025920 Ga0207649_10275619 Ga0207649_102756192 243
12 3300025926 Ga0207659_10475977 Ga0207659_104759771 243
13 3300025933 Ga0207706_10081352 Ga0207706_100813522 243
14 3300026075 Ga0207708_10240109 Ga0207708_102401092 243
15 3300027907 Ga0207428_10002990 Ga0207428_1000299019 243
16 3300032005 Ga0307411_10531545 Ga0307411_105315451 243
17 3300042005 Ga0439448_0003897 Ga0439448_0003897_1005_1745 243
18 3300042008 Ga0439450_027376 Ga0439450_027376_25_765 243
19 3300042012 Ga0439455_0085668 Ga0439455_0085668_53_793 243
20 3300042016 Ga0439463_059586 Ga0439463_059586_103_843 243
21 3300042157 Ga0439458_0001952 Ga0439458_0001952_1557_2297 243
22 3300050507 nmdc:mga05p37_16031_c1 nmdc:mga05p37_16031_c1_6714_7454 243
23 3300050508 nmdc:mga09592_194561_c1 nmdc:mga09592_194561_c1_518_1258 243
24 3300050510 nmdc:mga06r32_177968_c1 nmdc:mga06r32_177968_c1_994_1734 243
25 3300050511 nmdc:mga08y16_14590_c1 nmdc:mga08y16_14590_c1_4955_5695 243
26 3300050512 nmdc:mga0n895_63363_c1 nmdc:mga0n895_63363_c1_2212_2952 243
27 3300050513 nmdc:mga0rr50_13161_c1 nmdc:mga0rr50_13161_c1_2672_3412 243
28 3300050515 nmdc:mga0a205_57636_c1 nmdc:mga0a205_57636_c1_705_1445 243
29 3300038996 Ga0242420_003716 Ga0242420_003716_1136_1873 244
30 3300046517 Ga0495630_0043809 Ga0495630_0043809_1146_1886 244
31 3300005336 Ga0070680_100132037 Ga0070680_1001320371 245
32 3300005337 Ga0070682_100038280 Ga0070682_1000382802 245
33 3300005337 Ga0070682_100075332 Ga0070682_1000753323 245
34 3300005341 Ga0070691_10126960 Ga0070691_101269602 245
35 3300005435 Ga0070714_100437707 Ga0070714_1004377072 245
36 3300005436 Ga0070713_100022876 Ga0070713_1000228766 245
37 3300005437 Ga0070710_10032115 Ga0070710_100321153 245
38 3300005437 Ga0070710_10162285 Ga0070710_101622852 245
39 3300005439 Ga0070711_100568454 Ga0070711_1005684541 245
40 3300005440 Ga0070705_100117196 Ga0070705_1001171961 245
41 3300005440 Ga0070705_100137121 Ga0070705_1001371213 245
42 3300005455 Ga0070663_100031170 Ga0070663_1000311703 245
43 3300005456 Ga0070678_100006090 Ga0070678_1000060905 245
44 3300005458 Ga0070681_10282361 Ga0070681_102823612 245
45 3300005459 Ga0068867_100128449 Ga0068867_1001284493 245
46 3300005530 Ga0070679_100057362 Ga0070679_1000573625 245
47 3300005547 Ga0070693_100003076 Ga0070693_1000030769 245
48 3300005547 Ga0070693_100036835 Ga0070693_1000368356 245
49 3300005549 Ga0070704_100584037 Ga0070704_1005840372 245
50 3300005564 Ga0070664_100564826 Ga0070664_1005648262 245
51 3300005615 Ga0070702_100051473 Ga0070702_1000514735 245
52 3300006163 Ga0070715_10038607 Ga0070715_100386072 245
53 3300006237 Ga0097621_100034721 Ga0097621_1000347215 245
54 3300006358 Ga0068871_100047761 Ga0068871_1000477614 245
55 3300009174 Ga0105241_10428344 Ga0105241_104283443 245
56 3300009551 Ga0105238_10020509 Ga0105238_100205095 245
57 3300013100 Ga0157373_10132661 Ga0157373_101326613 245
58 3300014325 Ga0163163_10024579 Ga0163163_100245796 245
59 3300014326 Ga0157380_10356867 Ga0157380_103568673 245
60 3300025898 Ga0207692_10019151 Ga0207692_100191514 245
61 3300025906 Ga0207699_10019611 Ga0207699_100196114 245
62 3300025908 Ga0207643_10151291 Ga0207643_101512912 245
63 3300025915 Ga0207693_10113921 Ga0207693_101139213 245
64 3300025915 Ga0207693_10145057 Ga0207693_101450571 245
65 3300025916 Ga0207663_10002995 Ga0207663_100029955 245
66 3300025917 Ga0207660_10122134 Ga0207660_101221342 245
67 3300025921 Ga0207652_10461693 Ga0207652_104616932 245
68 3300025928 Ga0207700_10056541 Ga0207700_100565414 245
69 3300025929 Ga0207664_10026148 Ga0207664_100261485 245
70 3300025929 Ga0207664_10073721 Ga0207664_100737215 245
71 3300025929 Ga0207664_10191949 Ga0207664_101919492 245
72 3300025945 Ga0207679_10697978 Ga0207679_106979781 245
73 3300025981 Ga0207640_10270717 Ga0207640_102707173 245
74 3300026067 Ga0207678_10064723 Ga0207678_100647232 245
75 3300026121 Ga0207683_10002935 Ga0207683_100029356 245
76 3300034820 Ga0373959_0007640 Ga0373959_0007640_549_1292 245
77 3300034957 Ga0373938_0024221 Ga0373938_0024221_81_824 245
78 3300035088 Ga0373940_0032315 Ga0373940_0032315_303_1046 245
79 3300035112 Ga0373932_0004992 Ga0373932_0004992_625_1368 245
80 3300046475 Ga0495639_0269065 Ga0495639_0269065_95_835 245
81 3300046517 Ga0495630_0032030 Ga0495630_0032030_1325_2065 245
82 3300046531 Ga0495665_0070426 Ga0495665_0070426_582_1322 245
83 3300046683 Ga0495658_0051191 Ga0495658_0051191_1074_1814 245
84 3300047321 Ga0495676_0009158 Ga0495676_0009158_2200_2940 245
85 3300048903 Ga0496100_0020759 Ga0496100_0020759_3159_3899 245
86 3300048904 Ga0496101_0123940 Ga0496101_0123940_572_1312 245
87 3300048905 Ga0496102_0016901 Ga0496102_0016901_856_1596 245
88 3300048906 Ga0496103_0007758 Ga0496103_0007758_2985_3728 245
89 3300048907 Ga0496104_0003336 Ga0496104_0003336_817_1557 245
90 3300048908 Ga0496105_0001512 Ga0496105_0001512_11382_12122 245
91 3300048908 Ga0496105_0118931 Ga0496105_0118931_1081_1824 245
92 3300048909 Ga0496106_0068873 Ga0496106_0068873_329_1069 245
93 3300048910 Ga0496107_0550218 Ga0496107_0550218_28_768 245
94 3300048911 Ga0496108_0115721 Ga0496108_0115721_1258_1998 245
95 3300048911 Ga0496108_0491353 Ga0496108_0491353_157_900 245
96 3300048912 Ga0496109_0011656 Ga0496109_0011656_817_1557 245
97 3300048912 Ga0496109_0139209 Ga0496109_0139209_1104_1847 245
98 3300048913 Ga0496110_0000774 Ga0496110_0000774_15509_16249 245
99 3300048914 Ga0496111_0004555 Ga0496111_0004555_3149_3889 245
100 3300048915 Ga0496112_0003828 Ga0496112_0003828_679_1419 245
101 3300048915 Ga0496112_0024387 Ga0496112_0024387_4164_4907 245
102 3300048916 Ga0496113_0003911 Ga0496113_0003911_2085_2825 245
103 3300048917 Ga0496114_0008667 Ga0496114_0008667_4335_5075 245
104 3300048917 Ga0496114_0120439 Ga0496114_0120439_324_1067 245
105 3300048918 Ga0496115_0055640 Ga0496115_0055640_1653_2396 245
106 3300048918 Ga0496115_0248040 Ga0496115_0248040_226_969 245
107 3300005445 Ga0070708_100142334 Ga0070708_1001423342 246
108 3300005468 Ga0070707_100068200 Ga0070707_1000682002 246
109 3300009147 Ga0114129_10296845 Ga0114129_102968452 246
110 3300025922 Ga0207646_10112791 Ga0207646_101127913 246
111 3300031548 Ga0307408_100127513 Ga0307408_1001275133 246
112 3300032005 Ga0307411_10201200 Ga0307411_102012002 246
113 3300032126 Ga0307415_100060562 Ga0307415_1000605622 246
114 3300041999 Ga0439433_0008922 Ga0439433_0008922_874_1677 246
115 3300048911 Ga0496108_0088043 Ga0496108_0088043_229_978 246
116 3300048915 Ga0496112_0303480 Ga0496112_0303480_209_958 246
117 3300048916 Ga0496113_0139410 Ga0496113_0139410_1029_1778 246
118 3300049581 Ga0501047_0367131 Ga0501047_0367131_193_945 246
119 3300050507 nmdc:mga05p37_290095_c1 nmdc:mga05p37_290095_c1_832_1641 246
120 3300003373 JGI25407J50210_10000092 JGI25407J50210_100000926 247
121 3300005981 Ga0081538_10000544 Ga0081538_100005446 247
122 3300005981 Ga0081538_10000842 Ga0081538_100008427 247
123 3300005981 Ga0081538_10024683 Ga0081538_100246834 247
124 3300006846 Ga0075430_100016227 Ga0075430_1000162275 247
125 3300041460 Ga0451802_0683558 Ga0451802_0683558_1097_1843 247
126 3300049590 Ga0501074_0036661 Ga0501074_0036661_1754_2500 247
127 3300049742 Ga0501080_0035031 Ga0501080_0035031_2962_3708 247
128 3300050489 nmdc:mga03683_30649_c1 nmdc:mga03683_30649_c1_209_967 247
129 3300061734 Ga0530510_0210637 Ga0530510_0210637_513_1307 247
130 3300005543 Ga0070672_100729491 Ga0070672_1007294911 248
131 3300006051 Ga0075364_10191544 Ga0075364_101915442 248
132 3300044683 Ga0466965_0097969 Ga0466965_0097969_194_940 248
133 3300026075 Ga0207708_10136242 Ga0207708_101362422 249
134 3300026118 Ga0207675_100069883 Ga0207675_1000698833 249
135 3300045836 Ga0466958_0029169 Ga0466958_0029169_734_1489 249
136 3300046471 Ga0495650_0000054 Ga0495650_0000054_110307_111056 249
137 3300046537 Ga0495598_0025090 Ga0495598_0025090_500_1309 249
138 3300046539 Ga0495621_0024747 Ga0495621_0024747_358_1167 249
139 3300049584 Ga0501068_0309009 Ga0501068_0309009_63_836 250
140 3300044694 Ga0466963_0004785 Ga0466963_0004785_5889_6650 251
141 3300044694 Ga0466963_0262189 Ga0466963_0262189_76_831 251
142 3300044735 Ga0466968_0132113 Ga0466968_0132113_250_1005 251
143 3300044901 Ga0466960_0000087 Ga0466960_0000087_16539_17294 251
144 3300045049 Ga0466959_0278146 Ga0466959_0278146_107_862 251
145 3300045836 Ga0466958_0011493 Ga0466958_0011493_747_1508 251
146 3300045976 Ga0466967_0797794 Ga0466967_0797794_40_795 251
147 3300025927 Ga0207687_10400134 Ga0207687_104001341 252
148 3300031548 Ga0307408_100358922 Ga0307408_1003589222 252
149 3300031731 Ga0307405_10129538 Ga0307405_101295383 252
150 3300031824 Ga0307413_10047875 Ga0307413_100478751 252
151 3300031901 Ga0307406_10066396 Ga0307406_100663962 252
152 3300031903 Ga0307407_10153158 Ga0307407_101531582 252
153 3300032004 Ga0307414_10279700 Ga0307414_102797002 252
154 3300037312 Ga0395899_0196291 Ga0395899_0196291_413_1171 252
155 3300037853 Ga0436364_0691268 Ga0436364_0691268_231_995 252
156 3300037853 Ga0436364_1238467 Ga0436364_1238467_367_1131 252
157 3300038443 Ga0395901_0630856 Ga0395901_0630856_32_790 252
158 3300044694 Ga0466963_0001331 Ga0466963_0001331_10834_11598 252
159 3300045836 Ga0466958_0209158 Ga0466958_0209158_201_965 252
160 3300045976 Ga0466967_0056147 Ga0466967_0056147_1603_2367 252
161 3300045976 Ga0466967_0458022 Ga0466967_0458022_216_980 252
162 3300048917 Ga0496114_0393291 Ga0496114_0393291_320_1099 252
163 3300013308 Ga0157375_11229552 Ga0157375_112295521 253
164 3300005344 Ga0070661_100175553 Ga0070661_1001755532 254
165 3300005435 Ga0070714_100075079 Ga0070714_1000750791 254
166 3300031889 Ga0326468_10015859 Ga0326468_100158591 254
167 3300031995 Ga0307409_100041233 Ga0307409_1000412334 254
168 3300039437 Ga0436365_1008576 Ga0436365_1008576_154_930 254
169 3300042993 Ga0439440_0046483 Ga0439440_0046483_214_978 254
170 3300044842 Ga0466957_0089216 Ga0466957_0089216_984_1754 254
171 3300045836 Ga0466958_0014064 Ga0466958_0014064_1297_2067 254
172 3300045836 Ga0466958_0049269 Ga0466958_0049269_409_1179 254
173 3300009094 Ga0111539_10300172 Ga0111539_103001722 255
174 3300021384 Ga0213876_10030979 Ga0213876_100309794 255
175 3300021384 Ga0213876_10053393 Ga0213876_100533932 255
176 3300021388 Ga0213875_10063770 Ga0213875_100637702 255
177 3300021388 Ga0213875_10137311 Ga0213875_101373111 255
178 3300025916 Ga0207663_10229848 Ga0207663_102298482 255
179 3300026067 Ga0207678_10291945 Ga0207678_102919452 255
180 3300027907 Ga0207428_10244341 Ga0207428_102443412 255
181 3300032002 Ga0307416_100654394 Ga0307416_1006543941 255
182 3300037853 Ga0436364_1333433 Ga0436364_1333433_3112_3885 255
183 3300037853 Ga0436364_1366524 Ga0436364_1366524_4037_4810 255
184 3300037853 Ga0436364_1447937 Ga0436364_1447937_707_1480 255
185 3300039437 Ga0436365_0308855 Ga0436365_0308855_15422_16195 255
186 3300039437 Ga0436365_1093652 Ga0436365_1093652_13554_14327 255
187 3300039437 Ga0436365_1897488 Ga0436365_1897488_826_1599 255
188 3300039450 Ga0436363_0654155 Ga0436363_0654155_24690_25463 255
189 3300039450 Ga0436363_1274650 Ga0436363_1274650_1535_2308 255
190 3300039450 Ga0436363_1386217 Ga0436363_1386217_1920_2693 255
191 3300039453 Ga0436362_0768940 Ga0436362_0768940_916_1689 255
192 3300039453 Ga0436362_1053058 Ga0436362_1053058_306_1079 255
193 3300044901 Ga0466960_0043331 Ga0466960_0043331_112_900 255
194 3300045049 Ga0466959_0117341 Ga0466959_0117341_65_838 255
195 3300045976 Ga0466967_0064835 Ga0466967_0064835_1192_1980 255
196 3300045976 Ga0466967_0083769 Ga0466967_0083769_875_1663 255
197 3300048913 Ga0496110_0509105 Ga0496110_0509105_153_929 255
198 3300005329 Ga0070683_100749650 Ga0070683_1007496501 256
199 3300005336 Ga0070680_100225476 Ga0070680_1002254761 256
200 3300005338 Ga0068868_100025496 Ga0068868_1000254963 256
201 3300005441 Ga0070700_100093261 Ga0070700_1000932613 256
202 3300005535 Ga0070684_100105608 Ga0070684_1001056082 256
203 3300005564 Ga0070664_100030007 Ga0070664_1000300073 256
204 3300005614 Ga0068856_100055666 Ga0068856_1000556661 256
205 3300011119 Ga0105246_10245081 Ga0105246_102450811 256
206 3300013306 Ga0163162_11162067 Ga0163162_111620671 256
207 3300025944 Ga0207661_10490510 Ga0207661_104905102 256
208 3300026078 Ga0207702_10315158 Ga0207702_103151582 256
209 3300026116 Ga0207674_10039947 Ga0207674_100399473 256
210 3300026118 Ga0207675_100157550 Ga0207675_1001575502 256
211 3300032002 Ga0307416_100562818 Ga0307416_1005628182 256
212 3300048904 Ga0496101_0128584 Ga0496101_0128584_869_1663 256
213 3300005981 Ga0081538_10009662 Ga0081538_100096622 257
214 3300005981 Ga0081538_10014032 Ga0081538_100140323 257
215 3300005981 Ga0081538_10019173 Ga0081538_100191736 257
216 3300028379 Ga0268266_10386291 Ga0268266_103862912 258
217 3300006038 Ga0075365_10109650 Ga0075365_101096502 259
218 3300038443 Ga0395901_0183162 Ga0395901_0183162_761_1540 259
219 3300050491 nmdc:mga00v17_69580_c1 nmdc:mga00v17_69580_c1_1283_2062 259
220 3300050492 nmdc:mga0yw44_7075_c1 nmdc:mga0yw44_7075_c1_2568_3347 259
221 3300005618 Ga0068864_100289890 Ga0068864_1002898902 261
222 3300044694 Ga0466963_0268630 Ga0466963_0268630_291_1082 261
223 3300044842 Ga0466957_0142439 Ga0466957_0142439_466_1344 261
224 3300045976 Ga0466967_0005370 Ga0466967_0005370_5192_5977 261
225 3300045976 Ga0466967_0048197 Ga0466967_0048197_887_1672 261
226 3300045976 Ga0466967_0050939 Ga0466967_0050939_466_1257 261
227 3300049568 Ga0501031_0061639 Ga0501031_0061639_1454_2254 261
228 3300005329 Ga0070683_100322481 Ga0070683_1003224812 262
229 3300005336 Ga0070680_100000744 Ga0070680_10000074416 262
230 3300005339 Ga0070660_100040806 Ga0070660_1000408065 262
231 3300005344 Ga0070661_100096994 Ga0070661_1000969942 262
232 3300005366 Ga0070659_100006654 Ga0070659_1000066545 262
233 3300005458 Ga0070681_10013860 Ga0070681_100138602 262
234 3300005535 Ga0070684_100023037 Ga0070684_1000230372 262
235 3300005539 Ga0068853_100248797 Ga0068853_1002487972 262
236 3300005614 Ga0068856_100021936 Ga0068856_1000219364 262
237 3300005616 Ga0068852_100059940 Ga0068852_1000599402 262
238 3300009093 Ga0105240_10278906 Ga0105240_102789062 262
239 3300009545 Ga0105237_10009348 Ga0105237_1000934814 262
240 3300013102 Ga0157371_10499435 Ga0157371_104994351 262
241 3300013105 Ga0157369_10009959 Ga0157369_100099592 262
242 3300013307 Ga0157372_10012329 Ga0157372_1001232910 262
243 3300025912 Ga0207707_10001912 Ga0207707_100019129 262
244 3300025917 Ga0207660_10142056 Ga0207660_101420563 262
245 3300025919 Ga0207657_10114204 Ga0207657_101142043 262
246 3300025920 Ga0207649_10137914 Ga0207649_101379142 262
247 3300025924 Ga0207694_10038915 Ga0207694_100389155 262
248 3300025944 Ga0207661_10022136 Ga0207661_100221367 262
249 3300026041 Ga0207639_10062610 Ga0207639_100626104 262
250 3300026078 Ga0207702_10015196 Ga0207702_100151967 262
251 3300031548 Ga0307408_100302471 Ga0307408_1003024711 262
252 3300031548 Ga0307408_100416980 Ga0307408_1004169802 262
253 3300031731 Ga0307405_10008105 Ga0307405_100081052 262
254 3300031731 Ga0307405_10143293 Ga0307405_101432932 262
255 3300031731 Ga0307405_10382471 Ga0307405_103824711 262
256 3300031824 Ga0307413_10031884 Ga0307413_100318844 262
257 3300031824 Ga0307413_10284041 Ga0307413_102840412 262
258 3300031852 Ga0307410_10014932 Ga0307410_100149324 262
259 3300031852 Ga0307410_10103279 Ga0307410_101032791 262
260 3300031852 Ga0307410_10150176 Ga0307410_101501763 262
261 3300031852 Ga0307410_10183744 Ga0307410_101837442 262
262 3300031901 Ga0307406_10020910 Ga0307406_100209104 262
263 3300031901 Ga0307406_10085563 Ga0307406_100855633 262
264 3300031903 Ga0307407_10005169 Ga0307407_100051694 262
265 3300031903 Ga0307407_10220411 Ga0307407_102204111 262
266 3300031911 Ga0307412_10065896 Ga0307412_100658964 262
267 3300031911 Ga0307412_10269010 Ga0307412_102690101 262
268 3300031995 Ga0307409_100003066 Ga0307409_1000030666 262
269 3300031995 Ga0307409_100048699 Ga0307409_1000486991 262
270 3300032002 Ga0307416_100001087 Ga0307416_10000108711 262
271 3300032005 Ga0307411_10068080 Ga0307411_100680804 262
272 3300032126 Ga0307415_100002961 Ga0307415_1000029619 262
273 3300032126 Ga0307415_100109907 Ga0307415_1001099072 262
274 3300044693 Ga0466961_0047627 Ga0466961_0047627_890_1678 262
275 3300044694 Ga0466963_0274616 Ga0466963_0274616_24_812 262
276 3300044901 Ga0466960_0146602 Ga0466960_0146602_411_1199 262
277 3300045976 Ga0466967_0021988 Ga0466967_0021988_607_1395 262
278 3300045976 Ga0466967_0047344 Ga0466967_0047344_2493_3281 262
279 3300045976 Ga0466967_0317541 Ga0466967_0317541_138_926 262
280 3300003203 JGI25406J46586_10001883 JGI25406J46586_100018835 263
281 3300005329 Ga0070683_100121992 Ga0070683_1001219924 263
282 3300005334 Ga0068869_100260933 Ga0068869_1002609333 263
283 3300005337 Ga0070682_100074549 Ga0070682_1000745492 263
284 3300005338 Ga0068868_100628437 Ga0068868_1006284371 263
285 3300005356 Ga0070674_100132542 Ga0070674_1001325423 263
286 3300005366 Ga0070659_100159221 Ga0070659_1001592212 263
287 3300005438 Ga0070701_10083519 Ga0070701_100835191 263
288 3300005441 Ga0070700_100080401 Ga0070700_1000804011 263
289 3300005530 Ga0070679_100167542 Ga0070679_1001675422 263
290 3300005548 Ga0070665_100253828 Ga0070665_1002538281 263
291 3300005564 Ga0070664_100103801 Ga0070664_1001038014 263
292 3300005577 Ga0068857_100238934 Ga0068857_1002389342 263
293 3300005617 Ga0068859_100041331 Ga0068859_1000413313 263
294 3300005719 Ga0068861_100147146 Ga0068861_1001471461 263
295 3300005937 Ga0081455_10117377 Ga0081455_101173773 263
296 3300005981 Ga0081538_10002495 Ga0081538_100024957 263
297 3300005981 Ga0081538_10003881 Ga0081538_100038819 263
298 3300005981 Ga0081538_10032020 Ga0081538_100320204 263
299 3300005981 Ga0081538_10048292 Ga0081538_100482922 263
300 3300005985 Ga0081539_10004714 Ga0081539_100047147 263
301 3300006844 Ga0075428_100062146 Ga0075428_1000621462 263
302 3300006881 Ga0068865_100199664 Ga0068865_1001996642 263
303 3300006931 Ga0097620_100041331 Ga0097620_1000413313 263
304 3300009094 Ga0111539_10078836 Ga0111539_100788363 263
305 3300009094 Ga0111539_10161555 Ga0111539_101615552 263
306 3300009098 Ga0105245_10040528 Ga0105245_100405283 263
307 3300009148 Ga0105243_10046827 Ga0105243_100468273 263
308 3300009148 Ga0105243_10059963 Ga0105243_100599633 263
309 3300013308 Ga0157375_11072358 Ga0157375_110723581 263
310 3300014745 Ga0157377_10118503 Ga0157377_101185032 263
311 3300025918 Ga0207662_10120048 Ga0207662_101200481 263
312 3300025919 Ga0207657_10133921 Ga0207657_101339212 263
313 3300025920 Ga0207649_10263233 Ga0207649_102632332 263
314 3300025933 Ga0207706_10579190 Ga0207706_105791902 263
315 3300025935 Ga0207709_10104764 Ga0207709_101047643 263
316 3300025937 Ga0207669_10359388 Ga0207669_103593881 263
317 3300025938 Ga0207704_10473218 Ga0207704_104732182 263
318 3300025961 Ga0207712_10184300 Ga0207712_101843001 263
319 3300025972 Ga0207668_10241526 Ga0207668_102415262 263
320 3300025981 Ga0207640_10466195 Ga0207640_104661952 263
321 3300026023 Ga0207677_10027867 Ga0207677_100278674 263
322 3300026023 Ga0207677_10063057 Ga0207677_100630573 263
323 3300026075 Ga0207708_10098682 Ga0207708_100986822 263
324 3300026089 Ga0207648_10054327 Ga0207648_100543272 263
325 3300026118 Ga0207675_100456114 Ga0207675_1004561141 263
326 3300027907 Ga0207428_10027159 Ga0207428_100271594 263
327 3300031548 Ga0307408_100078591 Ga0307408_1000785912 263
328 3300031548 Ga0307408_100351025 Ga0307408_1003510251 263
329 3300031731 Ga0307405_10028254 Ga0307405_100282542 263
330 3300031824 Ga0307413_10021925 Ga0307413_100219252 263
331 3300031901 Ga0307406_10012651 Ga0307406_100126512 263
332 3300031901 Ga0307406_10237183 Ga0307406_102371832 263
333 3300031901 Ga0307406_10357953 Ga0307406_103579532 263
334 3300031903 Ga0307407_10004638 Ga0307407_100046386 263
335 3300031903 Ga0307407_10249723 Ga0307407_102497232 263
336 3300031903 Ga0307407_10261482 Ga0307407_102614821 263
337 3300031995 Ga0307409_100174878 Ga0307409_1001748783 263
338 3300031995 Ga0307409_100268363 Ga0307409_1002683632 263
339 3300032002 Ga0307416_100003831 Ga0307416_10000383110 263
340 3300032002 Ga0307416_100042208 Ga0307416_1000422082 263
341 3300032002 Ga0307416_100173352 Ga0307416_1001733522 263
342 3300032002 Ga0307416_100190858 Ga0307416_1001908583 263
343 3300032004 Ga0307414_10019957 Ga0307414_100199572 263
344 3300032005 Ga0307411_10006877 Ga0307411_100068772 263
345 3300032126 Ga0307415_100013784 Ga0307415_1000137842 263
346 3300032126 Ga0307415_100029453 Ga0307415_1000294533 263
347 3300032126 Ga0307415_100164737 Ga0307415_1001647372 263
348 3300042438 Ga0439459_0032223 Ga0439459_0032223_39_830 263
349 3300044694 Ga0466963_0027122 Ga0466963_0027122_827_1621 263
350 3300044694 Ga0466963_0254496 Ga0466963_0254496_55_858 263
351 3300044719 Ga0466971_0018406 Ga0466971_0018406_1533_2324 263
352 3300044901 Ga0466960_0062541 Ga0466960_0062541_721_1512 263
353 3300045976 Ga0466967_0023703 Ga0466967_0023703_482_1276 263
354 3300045976 Ga0466967_0083571 Ga0466967_0083571_1096_1890 263
355 3300045976 Ga0466967_0208879 Ga0466967_0208879_734_1585 263
356 3300045976 Ga0466967_0348254 Ga0466967_0348254_512_1315 263
357 3300048903 Ga0496100_0387218 Ga0496100_0387218_23_823 263
358 3300048905 Ga0496102_0329667 Ga0496102_0329667_273_1073 263
359 3300048911 Ga0496108_0206985 Ga0496108_0206985_299_1099 263
360 3300049568 Ga0501031_0049962 Ga0501031_0049962_1635_2426 263
361 3300049568 Ga0501031_0079700 Ga0501031_0079700_723_1514 263
362 3300049572 Ga0501036_0019833 Ga0501036_0019833_112_903 263
363 3300049572 Ga0501036_0089292 Ga0501036_0089292_318_1124 263
364 3300049573 Ga0501037_0108650 Ga0501037_0108650_660_1451 263
365 3300049574 Ga0501038_0149299 Ga0501038_0149299_623_1414 263
366 3300049575 Ga0501039_0013031 Ga0501039_0013031_4631_5485 263
367 3300049575 Ga0501039_0036921 Ga0501039_0036921_2430_3221 263
368 3300049575 Ga0501039_0037597 Ga0501039_0037597_1248_2039 263
369 3300049576 Ga0501040_0049272 Ga0501040_0049272_893_1747 263
370 3300049576 Ga0501040_0088101 Ga0501040_0088101_392_1183 263
371 3300049576 Ga0501040_0176389 Ga0501040_0176389_663_1454 263
372 3300049577 Ga0501041_0045687 Ga0501041_0045687_478_1269 263
373 3300049578 Ga0501042_0014344 Ga0501042_0014344_3967_4758 263
374 3300049578 Ga0501042_0368009 Ga0501042_0368009_114_968 263
375 3300049578 Ga0501042_0460668 Ga0501042_0460668_60_854 263
376 3300049580 Ga0501046_0147505 Ga0501046_0147505_897_1688 263
377 3300049580 Ga0501046_0426252 Ga0501046_0426252_37_843 263
378 3300049582 Ga0501048_0013622 Ga0501048_0013622_1488_2279 263
379 3300049582 Ga0501048_0308700 Ga0501048_0308700_253_1107 263
380 3300049586 Ga0501070_0248099 Ga0501070_0248099_41_832 263
381 3300049587 Ga0501071_0014453 Ga0501071_0014453_293_1084 263
382 3300049587 Ga0501071_0033657 Ga0501071_0033657_785_1576 263
383 3300049588 Ga0501072_0036682 Ga0501072_0036682_449_1303 263
384 3300049588 Ga0501072_0130564 Ga0501072_0130564_1198_1989 263
385 3300049591 Ga0501075_0018125 Ga0501075_0018125_308_1099 263
386 3300049591 Ga0501075_0029438 Ga0501075_0029438_1420_2211 263
387 3300049592 Ga0501076_0032313 Ga0501076_0032313_1066_1920 263
388 3300049592 Ga0501076_0048183 Ga0501076_0048183_1235_2026 263
389 3300049593 Ga0501077_0047084 Ga0501077_0047084_1200_1991 263
390 3300049593 Ga0501077_0048085 Ga0501077_0048085_550_1341 263
391 3300049742 Ga0501080_0182973 Ga0501080_0182973_74_865 263
392 3300049742 Ga0501080_0390169 Ga0501080_0390169_424_1215 263
393 3300049743 Ga0501081_0016750 Ga0501081_0016750_128_919 263
394 3300049744 Ga0501083_0175511 Ga0501083_0175511_30_821 263
395 3300049822 Ga0501035_0239435 Ga0501035_0239435_183_989 263
396 3300049824 Ga0501045_0089897 Ga0501045_0089897_583_1374 263
397 3300050508 nmdc:mga09592_202343_c1 nmdc:mga09592_202343_c1_455_1246 263
398 3300050511 nmdc:mga08y16_545792_c1 nmdc:mga08y16_545792_c1_221_1012 263
399 3300050511 nmdc:mga08y16_90757_c1 nmdc:mga08y16_90757_c1_1179_1970 263
400 3300060353 Ga0501082_0023739 Ga0501082_0023739_3825_4616 263
401 3300061719 Ga0466962_0070027 Ga0466962_0070027_370_1161 263
402 3300061734 Ga0530510_0007298 Ga0530510_0007298_2620_3411 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

36

245

0.65

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

36

258

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7165 18 239
7jj0-assembly2.cif.gz_D gtp-specific succinyl-coa synthetase complexed with mg-gmppcp 0.7148 34 109
3jul-assembly1.cif.gz_A-2 crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate 0.7084 29 108
7mst-assembly1.cif.gz_B phosphorylated human e105qa gtp-specific succinyl-coa synthetase complexed with coenzyme a 0.7044 34 109
7jmk-assembly2.cif.gz_D gtp-specific succinyl-coa synthetase complexed with mg-gdp in space group p32 0.6982 34 110
ID Description Score Start End Superfamily
3d03A01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.7499 18 103 3.60.21.40
af_Q22704_214_405_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7455 18 223 3.60.21.10
af_P37049_48_231_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7096 18 222 3.60.21.10
af_Q08BG1_205_402_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7014 20 223 3.60.21.10
af_P0AEW4_8_273_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6945 9 237 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A538H4K2-F1-model_v4 Metallophosphoesterase 0.9859 16 252 GO:0008758
GO:0009245
GO:0016020
AF-A0A7V9FNT6-F1-model_v4 Metallophosphoesterase 0.9845 18 252 GO:0008758
GO:0009245
GO:0016020
AF-A0A538EYF8-F1-model_v4 Metallophosphoesterase 0.9825 16 254 GO:0008758
GO:0009245
GO:0016020
AF-A0A7V9FNT6-F1-model_v4 Metallophosphoesterase 0.9762 18 252 GO:0008758
GO:0009245
GO:0016020
AF-A0A3N5TT85-F1-model_v4 Metallophosphoesterase 0.9689 18 221 GO:0008758
GO:0009245
GO:0016020

Feature Viewer

pLDDT pTM Quality
90.38 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map