F435152
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 402 | 263 | 368 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0002838|Ga0439449_0002838_1821_2744 |
| Length | 291 |
| Sequence | MTRLLRIATRKSPLALWQSEHVAAALRAAHSGLDVVLVPMSTRGDEVLDRSLAAIGGKGLFLKELELAMLRGEADCAVHSLKDVPMELEPGFALPAILQRADHADAFVSNRYDNIDALPLGAVVGTSSLRRQAQLRTRLAKLDAGEYDAIVLACAGLQRLGFDARIRSRMDAPQWLPAPAQGAIAIECRDDDADTRALCAKLDHTATRICVEAERAMNRTLHGSCHVPVAAFARLEGERLHLHGLVGSAADGRAIRAQAEGRGDAPESLGREVAQSLQQQGAGDLIAASGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 7 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 10 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 11 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 12 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 13 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 14 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 15 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 16 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 17 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 18 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 19 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 20 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 21 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 22 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 23 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 24 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 25 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 26 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 27 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 28 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 29 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 30 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 31 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 36 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 229 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 232 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 258 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 259 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 260 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 261 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 262 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 263 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.29 |
| Metatranscriptomes | 0.25 |
| Isolates | 8.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.43 |
| Nodule | 0 |
| Rhizoplane | 2.24 |
| Rhizosphere | 68.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3470979 | 2162886007 | Bacteria | 1482 |
| 2 | MBSR1b_contig_6401888 | 2162886012 | Bacteria | 2289 |
| 3 | JGI24739J22299_10000087 | 3300001989 | Bacteria | 26642 |
| 4 | JGI25157J39369_1001284 | 3300002741 | Bacteria | 10096 |
| 5 | JGI25153J46596_10010132 | 3300003215 | Bacteria | 4293 |
| 6 | rootH1_10097541 | 3300003316 | Bacteria | 1941 |
| 7 | Ga0055527_1000140 | 3300003760 | Bacteria | 51402 |
| 8 | Ga0055535_1000147 | 3300003761 | Bacteria | 74557 |
| 9 | Ga0055535_1000278 | 3300003761 | Bacteria | 53724 |
| 10 | Ga0055542_1000064 | 3300003762 | Bacteria | 159853 |
| 11 | Ga0055542_1000308 | 3300003762 | Bacteria | 53724 |
| 12 | Ga0055529_1000072 | 3300003763 | Bacteria | 159853 |
| 13 | Ga0055524_1007011 | 3300003775 | Bacteria | 4840 |
| 14 | Ga0055524_1010056 | 3300003775 | Bacteria | 3793 |
| 15 | Ga0055536_1000759 | 3300003781 | Bacteria | 21507 |
| 16 | Ga0055536_1005294 | 3300003781 | Bacteria | 6349 |
| 17 | Ga0055536_1006701 | 3300003781 | Bacteria | 5295 |
| 18 | Ga0055536_1014566 | 3300003781 | Bacteria | 2748 |
| 19 | Ga0055530_10001396 | 3300003791 | Bacteria | 17854 |
| 20 | Ga0055530_10003265 | 3300003791 | Bacteria | 9433 |
| 21 | Ga0055531_10004504 | 3300003794 | Bacteria | 8459 |
| 22 | Ga0055531_10006858 | 3300003794 | Bacteria | 6349 |
| 23 | Ga0058692_1000028 | 3300003856 | Bacteria | 193757 |
| 24 | Ga0065704_10072505 | 3300005289 | Bacteria | 8411 |
| 25 | Ga0065704_10144331 | 3300005289 | Bacteria | 1482 |
| 26 | Ga0065715_10094970 | 3300005293 | Bacteria | 4199 |
| 27 | Ga0070690_100000679 | 3300005330 | Bacteria | 17392 |
| 28 | Ga0070670_100009158 | 3300005331 | Bacteria | 8463 |
| 29 | Ga0070670_100011348 | 3300005331 | Bacteria | 7614 |
| 30 | Ga0070670_100073661 | 3300005331 | Bacteria | 2933 |
| 31 | Ga0070670_100347405 | 3300005331 | Bacteria | 1303 |
| 32 | Ga0070660_100044971 | 3300005339 | Bacteria | 3378 |
| 33 | Ga0070687_100002156 | 3300005343 | Bacteria | 7279 |
| 34 | Ga0070661_100033798 | 3300005344 | Bacteria | 3707 |
| 35 | Ga0070669_100008308 | 3300005353 | Bacteria | 7414 |
| 36 | Ga0070669_100058663 | 3300005353 | Bacteria | 2825 |
| 37 | Ga0070675_100001328 | 3300005354 | Bacteria | 18093 |
| 38 | Ga0070671_100018481 | 3300005355 | Bacteria | 5663 |
| 39 | Ga0070671_100303541 | 3300005355 | Bacteria | 1359 |
| 40 | Ga0070673_100001221 | 3300005364 | Bacteria | 14852 |
| 41 | Ga0070688_100046229 | 3300005365 | Bacteria | 2695 |
| 42 | Ga0070659_100124972 | 3300005366 | Bacteria | 2087 |
| 43 | Ga0070667_100316753 | 3300005367 | Bacteria | 1407 |
| 44 | Ga0070701_10018974 | 3300005438 | Bacteria | 3242 |
| 45 | Ga0070705_100028884 | 3300005440 | Bacteria | 3043 |
| 46 | Ga0070700_100002135 | 3300005441 | Bacteria | 10025 |
| 47 | Ga0070663_100181746 | 3300005455 | Bacteria | 1632 |
| 48 | Ga0070678_100030344 | 3300005456 | Bacteria | 3716 |
| 49 | Ga0070662_100321378 | 3300005457 | Bacteria | 1262 |
| 50 | Ga0070684_100000450 | 3300005535 | Bacteria | 28151 |
| 51 | Ga0070672_100041648 | 3300005543 | Bacteria | 3532 |
| 52 | Ga0070672_100106060 | 3300005543 | Bacteria | 2285 |
| 53 | Ga0070686_100000933 | 3300005544 | Bacteria | 16821 |
| 54 | Ga0070696_100176574 | 3300005546 | Bacteria | 1582 |
| 55 | Ga0070693_100038696 | 3300005547 | Bacteria | 2667 |
| 56 | Ga0070665_100015798 | 3300005548 | Bacteria | 7582 |
| 57 | Ga0068855_100009026 | 3300005563 | Bacteria | 12046 |
| 58 | Ga0068855_100092486 | 3300005563 | Bacteria | 3488 |
| 59 | Ga0070664_100001964 | 3300005564 | Bacteria | 16503 |
| 60 | Ga0068857_100001283 | 3300005577 | Bacteria | 19730 |
| 61 | Ga0068854_100002940 | 3300005578 | Bacteria | 10567 |
| 62 | Ga0068854_100038189 | 3300005578 | Bacteria | 3376 |
| 63 | Ga0068856_100038861 | 3300005614 | Bacteria | 4672 |
| 64 | Ga0070702_100054498 | 3300005615 | Bacteria | 2301 |
| 65 | Ga0068852_100038796 | 3300005616 | Bacteria | 4006 |
| 66 | Ga0068859_100006841 | 3300005617 | Bacteria | 11584 |
| 67 | Ga0068864_100000569 | 3300005618 | Bacteria | 31341 |
| 68 | Ga0068866_10042409 | 3300005718 | Bacteria | 2264 |
| 69 | Ga0068861_100020202 | 3300005719 | Bacteria | 4766 |
| 70 | Ga0068851_10000226 | 3300005834 | Bacteria | 27072 |
| 71 | Ga0068863_100001625 | 3300005841 | Bacteria | 22204 |
| 72 | Ga0068858_100054718 | 3300005842 | Bacteria | 3690 |
| 73 | Ga0068862_100004773 | 3300005844 | Bacteria | 11408 |
| 74 | Ga0075364_10000199 | 3300006051 | Bacteria | 27820 |
| 75 | Ga0075434_100205832 | 3300006871 | Bacteria | 1988 |
| 76 | Ga0068865_100035116 | 3300006881 | Bacteria | 3369 |
| 77 | Ga0097620_100006841 | 3300006931 | Bacteria | 11584 |
| 78 | Ga0105251_10000155 | 3300009011 | Bacteria | 69872 |
| 79 | Ga0105251_10002607 | 3300009011 | Bacteria | 13945 |
| 80 | Ga0105244_10020824 | 3300009036 | Bacteria | 3635 |
| 81 | Ga0105240_10005933 | 3300009093 | Bacteria | 18089 |
| 82 | Ga0105240_10030882 | 3300009093 | Bacteria | 6959 |
| 83 | Ga0105240_10047398 | 3300009093 | Bacteria | 5438 |
| 84 | Ga0105240_10051758 | 3300009093 | Bacteria | 5166 |
| 85 | Ga0105243_10031039 | 3300009148 | Bacteria | 4119 |
| 86 | Ga0105248_10001446 | 3300009177 | Bacteria | 26459 |
| 87 | Ga0105248_10144138 | 3300009177 | Bacteria | 2688 |
| 88 | Ga0105248_10350440 | 3300009177 | Bacteria | 1662 |
| 89 | Ga0105248_10700582 | 3300009177 | Bacteria | 1143 |
| 90 | Ga0105237_10000212 | 3300009545 | Bacteria | 82465 |
| 91 | Ga0105237_10000387 | 3300009545 | Bacteria | 62716 |
| 92 | Ga0105237_10097696 | 3300009545 | Bacteria | 2927 |
| 93 | Ga0105249_10008733 | 3300009553 | Bacteria | 8839 |
| 94 | Ga0105032_100139 | 3300009979 | Bacteria | 7657 |
| 95 | Ga0105239_10013080 | 3300010375 | Bacteria | 9221 |
| 96 | Ga0157314_1000003 | 3300012500 | Bacteria | 34099 |
| 97 | Ga0157369_10047874 | 3300013105 | Bacteria | 4641 |
| 98 | Ga0163162_10083756 | 3300013306 | Bacteria | 3263 |
| 99 | Ga0157372_10056422 | 3300013307 | Bacteria | 4389 |
| 100 | Ga0157375_10001177 | 3300013308 | Bacteria | 22597 |
| 101 | Ga0157375_10255886 | 3300013308 | Bacteria | 1912 |
| 102 | Ga0163163_10001913 | 3300014325 | Bacteria | 17623 |
| 103 | Ga0157377_10018572 | 3300014745 | Bacteria | 3616 |
| 104 | Ga0182006_1015236 | 3300015261 | Bacteria | 3298 |
| 105 | Ga0182005_1000676 | 3300015265 | Bacteria | 16002 |
| 106 | Ga0182005_1003051 | 3300015265 | Bacteria | 5778 |
| 107 | Ga0163161_10008609 | 3300017792 | Bacteria | 7053 |
| 108 | Ga0206353_10413103 | 3300020082 | Bacteria | 7123 |
| 109 | Ga0213876_10052435 | 3300021384 | Bacteria | 2156 |
| 110 | Ga0209674_100111 | 3300025226 | Bacteria | 143058 |
| 111 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 112 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 113 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 114 | Ga0209258_100217 | 3300025242 | Bacteria | 110607 |
| 115 | Ga0209026_1000384 | 3300025250 | Bacteria | 40186 |
| 116 | Ga0209026_1000437 | 3300025250 | Bacteria | 34592 |
| 117 | Ga0209677_105507 | 3300025253 | Bacteria | 3280 |
| 118 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 119 | Ga0209148_1000197 | 3300025254 | Bacteria | 109412 |
| 120 | Ga0209759_1000164 | 3300025256 | Bacteria | 113141 |
| 121 | Ga0209129_1002281 | 3300025258 | Bacteria | 9558 |
| 122 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 123 | Ga0209673_1004308 | 3300025273 | Bacteria | 7688 |
| 124 | Ga0209675_1007371 | 3300025291 | Bacteria | 4226 |
| 125 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 126 | Ga0209676_1000501 | 3300025292 | Bacteria | 62489 |
| 127 | Ga0209676_1003012 | 3300025292 | Bacteria | 10956 |
| 128 | Ga0209676_1006481 | 3300025292 | Bacteria | 5765 |
| 129 | Ga0209676_1012381 | 3300025292 | Bacteria | 3356 |
| 130 | Ga0209676_1012770 | 3300025292 | Bacteria | 3270 |
| 131 | Ga0209025_1002579 | 3300025294 | Bacteria | 18798 |
| 132 | Ga0209025_1003420 | 3300025294 | Bacteria | 15056 |
| 133 | Ga0209025_1020582 | 3300025294 | Bacteria | 3600 |
| 134 | Ga0209564_1008102 | 3300025295 | Bacteria | 5259 |
| 135 | Ga0209758_1000408 | 3300025297 | Bacteria | 73642 |
| 136 | Ga0209758_1030868 | 3300025297 | Bacteria | 2210 |
| 137 | Ga0209050_1000424 | 3300025298 | Bacteria | 77803 |
| 138 | Ga0209050_1002116 | 3300025298 | Bacteria | 18094 |
| 139 | Ga0209256_1001986 | 3300025299 | Bacteria | 18396 |
| 140 | Ga0209256_1002614 | 3300025299 | Bacteria | 14244 |
| 141 | Ga0209256_1005972 | 3300025299 | Bacteria | 6693 |
| 142 | Ga0209051_1000809 | 3300025303 | Bacteria | 32636 |
| 143 | Ga0209051_1022773 | 3300025303 | Bacteria | 2626 |
| 144 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 145 | Ga0209257_1000414 | 3300025304 | Bacteria | 82489 |
| 146 | Ga0209257_1001475 | 3300025304 | Bacteria | 27666 |
| 147 | Ga0209257_1012708 | 3300025304 | Bacteria | 3850 |
| 148 | Ga0209257_1017247 | 3300025304 | Bacteria | 2858 |
| 149 | Ga0207655_1050401 | 3300025728 | Bacteria | 1693 |
| 150 | Ga0207713_1001387 | 3300025735 | Bacteria | 19637 |
| 151 | Ga0207713_1003492 | 3300025735 | Bacteria | 10675 |
| 152 | Ga0207682_10039412 | 3300025893 | Bacteria | 1921 |
| 153 | Ga0207647_10011817 | 3300025904 | Bacteria | 6102 |
| 154 | Ga0207647_10021906 | 3300025904 | Bacteria | 4255 |
| 155 | Ga0207695_10001617 | 3300025913 | Bacteria | 36534 |
| 156 | Ga0207695_10009925 | 3300025913 | Bacteria | 11699 |
| 157 | Ga0207695_10024489 | 3300025913 | Bacteria | 6789 |
| 158 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 159 | Ga0207671_10000327 | 3300025914 | Bacteria | 69712 |
| 160 | Ga0207662_10005373 | 3300025918 | Bacteria | 6824 |
| 161 | Ga0207657_10027100 | 3300025919 | Bacteria | 5254 |
| 162 | Ga0207649_10124953 | 3300025920 | Bacteria | 1739 |
| 163 | Ga0207681_10006279 | 3300025923 | Bacteria | 7297 |
| 164 | Ga0207694_10035353 | 3300025924 | Bacteria | 3832 |
| 165 | Ga0207650_10002717 | 3300025925 | Bacteria | 12212 |
| 166 | Ga0207650_10107187 | 3300025925 | Bacteria | 2158 |
| 167 | Ga0207650_10489729 | 3300025925 | Bacteria | 1027 |
| 168 | Ga0207659_10031698 | 3300025926 | Bacteria | 3622 |
| 169 | Ga0207687_10203985 | 3300025927 | Bacteria | 1547 |
| 170 | Ga0207644_10072150 | 3300025931 | Bacteria | 2528 |
| 171 | Ga0207706_10335702 | 3300025933 | Bacteria | 1315 |
| 172 | Ga0207670_10024203 | 3300025936 | Bacteria | 3793 |
| 173 | Ga0207691_10057156 | 3300025940 | Bacteria | 3552 |
| 174 | Ga0207711_10005954 | 3300025941 | Bacteria | 10307 |
| 175 | Ga0207711_10025341 | 3300025941 | Bacteria | 4976 |
| 176 | Ga0207689_10159212 | 3300025942 | Bacteria | 1861 |
| 177 | Ga0207679_10036818 | 3300025945 | Bacteria | 3473 |
| 178 | Ga0207667_10000063 | 3300025949 | Bacteria | 188281 |
| 179 | Ga0207667_10035763 | 3300025949 | Bacteria | 5327 |
| 180 | Ga0207651_10030405 | 3300025960 | Bacteria | 3438 |
| 181 | Ga0207712_10086311 | 3300025961 | Bacteria | 2299 |
| 182 | Ga0207668_10007764 | 3300025972 | Bacteria | 6383 |
| 183 | Ga0207640_10000746 | 3300025981 | Bacteria | 18703 |
| 184 | Ga0207640_10072491 | 3300025981 | Bacteria | 2324 |
| 185 | Ga0207658_10071560 | 3300025986 | Bacteria | 2626 |
| 186 | Ga0207703_10105125 | 3300026035 | Bacteria | 2400 |
| 187 | Ga0207678_10371963 | 3300026067 | Bacteria | 1235 |
| 188 | Ga0207708_10003483 | 3300026075 | Bacteria | 11606 |
| 189 | Ga0207702_10000985 | 3300026078 | Bacteria | 29150 |
| 190 | Ga0207641_10031430 | 3300026088 | Bacteria | 4403 |
| 191 | Ga0207641_10419153 | 3300026088 | Bacteria | 1289 |
| 192 | Ga0207648_10010963 | 3300026089 | Bacteria | 8562 |
| 193 | Ga0207676_10004368 | 3300026095 | Bacteria | 10000 |
| 194 | Ga0207674_10000123 | 3300026116 | Bacteria | 89456 |
| 195 | Ga0207674_10092901 | 3300026116 | Bacteria | 3006 |
| 196 | Ga0207675_100071135 | 3300026118 | Bacteria | 3252 |
| 197 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 198 | Ga0209970_1004485 | 3300027614 | Bacteria | 2320 |
| 199 | Ga0209983_1022754 | 3300027665 | Bacteria | 1315 |
| 200 | Ga0209971_1001501 | 3300027682 | Bacteria | 5789 |
| 201 | Ga0268265_10005173 | 3300028380 | Bacteria | 8939 |
| 202 | Ga0268264_10012065 | 3300028381 | Bacteria | 7114 |
| 203 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 204 | Ga0307513_10313635 | 3300031456 | Bacteria | 1329 |
| 205 | Ga0307410_10129331 | 3300031852 | Bacteria | 1853 |
| 206 | Ga0307406_10004711 | 3300031901 | Bacteria | 7435 |
| 207 | Ga0307416_100034678 | 3300032002 | Bacteria | 3844 |
| 208 | Ga0307416_100250482 | 3300032002 | Bacteria | 1723 |
| 209 | Ga0307414_10001239 | 3300032004 | Bacteria | 13148 |
| 210 | Ga0307414_10004652 | 3300032004 | Bacteria | 7474 |
| 211 | Ga0307414_10017956 | 3300032004 | Bacteria | 4339 |
| 212 | Ga0307411_10114401 | 3300032005 | Bacteria | 1938 |
| 213 | Ga0307411_10131552 | 3300032005 | Bacteria | 1829 |
| 214 | Ga0316574_0168259 | 3300035398 | Bacteria | 1411 |
| 215 | Ga0373931_0099822 | 3300035691 | Bacteria | 1631 |
| 216 | Ga0316584_0084340 | 3300036712 | Bacteria | 2380 |
| 217 | Ga0395899_0000057 | 3300037312 | Bacteria | 214710 |
| 218 | Ga0395899_0019444 | 3300037312 | Bacteria | 5159 |
| 219 | Ga0395899_0106379 | 3300037312 | Bacteria | 2020 |
| 220 | Ga0395900_0000035 | 3300037418 | Bacteria | 254301 |
| 221 | Ga0395900_0018823 | 3300037418 | Bacteria | 7043 |
| 222 | Ga0395898_0000045 | 3300037466 | Bacteria | 297127 |
| 223 | Ga0395898_0000150 | 3300037466 | Bacteria | 181023 |
| 224 | Ga0395905_0004974 | 3300037471 | Bacteria | 13689 |
| 225 | Ga0395901_0036036 | 3300038443 | Bacteria | 5112 |
| 226 | Ga0395901_0087858 | 3300038443 | Bacteria | 3250 |
| 227 | Ga0436365_1474399 | 3300039437 | Bacteria | 3424 |
| 228 | Ga0439436_0001192 | 3300041404 | Bacteria | 7385 |
| 229 | Ga0439436_0001844 | 3300041404 | Bacteria | 6256 |
| 230 | Ga0439436_0014671 | 3300041404 | Bacteria | 2361 |
| 231 | Ga0439436_0032814 | 3300041404 | Bacteria | 1505 |
| 232 | Ga0439436_0054857 | 3300041404 | Bacteria | 1120 |
| 233 | Ga0439465_0000271 | 3300041413 | Bacteria | 14513 |
| 234 | Ga0439465_0019999 | 3300041413 | Bacteria | 2094 |
| 235 | Ga0439465_0082944 | 3300041413 | Bacteria | 1089 |
| 236 | Ga0451807_2042735 | 3300041486 | Bacteria | 1638 |
| 237 | Ga0439445_0001921 | 3300042004 | Bacteria | 4584 |
| 238 | Ga0439445_0002572 | 3300042004 | Bacteria | 4035 |
| 239 | Ga0439445_0027085 | 3300042004 | Bacteria | 1471 |
| 240 | Ga0439449_0000094 | 3300042007 | Bacteria | 28713 |
| 241 | Ga0439449_0002733 | 3300042007 | Bacteria | 6866 |
| 242 | Ga0439449_0002838 | 3300042007 | Bacteria | 6736 |
| 243 | Ga0451577_0007856 | 3300042876 | Bacteria | 10435 |
| 244 | Ga0451577_0020907 | 3300042876 | Bacteria | 5999 |
| 245 | Ga0451577_0193836 | 3300042876 | Bacteria | 1833 |
| 246 | Ga0466969_0001986 | 3300044656 | Bacteria | 10937 |
| 247 | Ga0466969_0081193 | 3300044656 | Bacteria | 1547 |
| 248 | Ga0466972_0027472 | 3300044658 | Bacteria | 2814 |
| 249 | Ga0466982_0000006 | 3300044672 | Bacteria | 333931 |
| 250 | Ga0466966_0028677 | 3300044684 | Bacteria | 3623 |
| 251 | Ga0466966_0075700 | 3300044684 | Bacteria | 2102 |
| 252 | Ga0466961_0000201 | 3300044693 | Bacteria | 40285 |
| 253 | Ga0466961_0000758 | 3300044693 | Bacteria | 20217 |
| 254 | Ga0466961_0004623 | 3300044693 | Bacteria | 8638 |
| 255 | Ga0466961_0126727 | 3300044693 | Bacteria | 1601 |
| 256 | Ga0466964_0013641 | 3300044706 | Bacteria | 3083 |
| 257 | Ga0466964_0032921 | 3300044706 | Bacteria | 2062 |
| 258 | Ga0453684_0535231 | 3300044712 | Bacteria | 1292 |
| 259 | Ga0466971_0000539 | 3300044719 | Bacteria | 15024 |
| 260 | Ga0466970_0000399 | 3300044765 | Bacteria | 21121 |
| 261 | Ga0466970_0054801 | 3300044765 | Bacteria | 2129 |
| 262 | Ga0466957_0001246 | 3300044842 | Bacteria | 13275 |
| 263 | Ga0466957_0055809 | 3300044842 | Bacteria | 2414 |
| 264 | Ga0466959_0000038 | 3300045049 | Bacteria | 101314 |
| 265 | Ga0466959_0002947 | 3300045049 | Bacteria | 10983 |
| 266 | Ga0451576_0327842 | 3300045051 | Bacteria | 1602 |
| 267 | Ga0466958_0031969 | 3300045836 | Bacteria | 3129 |
| 268 | Ga0466967_0031492 | 3300045976 | Bacteria | 4465 |
| 269 | Ga0495627_022468 | 3300046453 | Bacteria | 2076 |
| 270 | Ga0495610_0002965 | 3300046512 | Bacteria | 13686 |
| 271 | Ga0495616_0162253 | 3300046513 | Bacteria | 1004 |
| 272 | Ga0495631_0010000 | 3300046518 | Bacteria | 4714 |
| 273 | Ga0495598_0002801 | 3300046537 | Bacteria | 3627 |
| 274 | Ga0495621_0000246 | 3300046539 | Bacteria | 12893 |
| 275 | Ga0495621_0002002 | 3300046539 | Bacteria | 5370 |
| 276 | Ga0495633_0006647 | 3300046558 | Bacteria | 6818 |
| 277 | Ga0495656_0022257 | 3300046615 | Bacteria | 2480 |
| 278 | Ga0495668_0032153 | 3300046616 | Bacteria | 2954 |
| 279 | Ga0495671_0149951 | 3300046692 | Bacteria | 1135 |
| 280 | Ga0495660_0035310 | 3300046810 | Bacteria | 2794 |
| 281 | Ga0495636_0010028 | 3300047318 | Bacteria | 3735 |
| 282 | Ga0495636_0028422 | 3300047318 | Bacteria | 2281 |
| 283 | Ga0495672_0088360 | 3300047320 | Bacteria | 1708 |
| 284 | Ga0495615_0032334 | 3300048090 | Bacteria | 1261 |
| 285 | Ga0495615_0045625 | 3300048090 | Bacteria | 1111 |
| 286 | Ga0496103_0188345 | 3300048906 | Bacteria | 1327 |
| 287 | Ga0496106_0011188 | 3300048909 | Bacteria | 6640 |
| 288 | Ga0496110_0098884 | 3300048913 | Bacteria | 2616 |
| 289 | Ga0496112_0188638 | 3300048915 | Bacteria | 2024 |
| 290 | Ga0496112_0248485 | 3300048915 | Bacteria | 1730 |
| 291 | Ga0496112_0338677 | 3300048915 | Bacteria | 1448 |
| 292 | Ga0496113_0151437 | 3300048916 | Bacteria | 1830 |
| 293 | Ga0496114_0000853 | 3300048917 | Bacteria | 22815 |
| 294 | Ga0496116_0015919 | 3300048919 | Bacteria | 5914 |
| 295 | Ga0496116_0095167 | 3300048919 | Bacteria | 1798 |
| 296 | Ga0496117_0001505 | 3300048920 | Bacteria | 33389 |
| 297 | Ga0496117_0020497 | 3300048920 | Bacteria | 5386 |
| 298 | Ga0496118_0104254 | 3300048921 | Bacteria | 1904 |
| 299 | Ga0496118_0142476 | 3300048921 | Bacteria | 1516 |
| 300 | Ga0496119_0000719 | 3300048922 | Bacteria | 44523 |
| 301 | Ga0496119_0001745 | 3300048922 | Bacteria | 25344 |
| 302 | Ga0496120_0000196 | 3300048923 | Bacteria | 103427 |
| 303 | Ga0496120_0001466 | 3300048923 | Bacteria | 28121 |
| 304 | Ga0496121_0018204 | 3300048924 | Bacteria | 7100 |
| 305 | Ga0496121_0026151 | 3300048924 | Bacteria | 5511 |
| 306 | Ga0496121_0048779 | 3300048924 | Bacteria | 3598 |
| 307 | Ga0496122_0001011 | 3300048925 | Bacteria | 49773 |
| 308 | Ga0496122_0006902 | 3300048925 | Bacteria | 12836 |
| 309 | Ga0496122_0029410 | 3300048925 | Bacteria | 4635 |
| 310 | Ga0496123_0002592 | 3300048926 | Bacteria | 21986 |
| 311 | Ga0496123_0036981 | 3300048926 | Bacteria | 3453 |
| 312 | Ga0496123_0037121 | 3300048926 | Bacteria | 3445 |
| 313 | Ga0496124_0000219 | 3300048927 | Bacteria | 111562 |
| 314 | Ga0496124_0000584 | 3300048927 | Bacteria | 61524 |
| 315 | Ga0496124_0001337 | 3300048927 | Bacteria | 37033 |
| 316 | Ga0496124_0007264 | 3300048927 | Bacteria | 11816 |
| 317 | Ga0496124_0012154 | 3300048927 | Bacteria | 8525 |
| 318 | Ga0496124_0253785 | 3300048927 | Bacteria | 1299 |
| 319 | Ga0496125_0000251 | 3300048928 | Bacteria | 110300 |
| 320 | Ga0496125_0000825 | 3300048928 | Bacteria | 49981 |
| 321 | Ga0496125_0001438 | 3300048928 | Bacteria | 34681 |
| 322 | Ga0496125_0088325 | 3300048928 | Bacteria | 2337 |
| 323 | Ga0496126_0001087 | 3300048929 | Bacteria | 45711 |
| 324 | Ga0496126_0006973 | 3300048929 | Bacteria | 12492 |
| 325 | Ga0496126_0042046 | 3300048929 | Bacteria | 4224 |
| 326 | Ga0501031_0027221 | 3300049568 | Bacteria | 3728 |
| 327 | Ga0501031_0078274 | 3300049568 | Bacteria | 2154 |
| 328 | Ga0501031_0106492 | 3300049568 | Bacteria | 1830 |
| 329 | Ga0501032_0011165 | 3300049569 | Bacteria | 6453 |
| 330 | Ga0501032_0075048 | 3300049569 | Bacteria | 2252 |
| 331 | Ga0501032_0298275 | 3300049569 | Bacteria | 1042 |
| 332 | Ga0501033_0010238 | 3300049570 | Bacteria | 7195 |
| 333 | Ga0501033_0059658 | 3300049570 | Bacteria | 2817 |
| 334 | Ga0501034_0002264 | 3300049571 | Bacteria | 23614 |
| 335 | Ga0501034_0002403 | 3300049571 | Bacteria | 22668 |
| 336 | Ga0501034_0087809 | 3300049571 | Bacteria | 3109 |
| 337 | Ga0501034_0174456 | 3300049571 | Bacteria | 2116 |
| 338 | Ga0501036_0025387 | 3300049572 | Bacteria | 4998 |
| 339 | Ga0501037_0021686 | 3300049573 | Bacteria | 4750 |
| 340 | Ga0501037_0120656 | 3300049573 | Bacteria | 1885 |
| 341 | Ga0501038_0039625 | 3300049574 | Bacteria | 4120 |
| 342 | Ga0501038_0087555 | 3300049574 | Bacteria | 2615 |
| 343 | Ga0501038_0242562 | 3300049574 | Bacteria | 1430 |
| 344 | Ga0501039_0019611 | 3300049575 | Bacteria | 5186 |
| 345 | Ga0501039_0324751 | 3300049575 | Bacteria | 1209 |
| 346 | Ga0501043_0039385 | 3300049579 | Bacteria | 3714 |
| 347 | Ga0501043_0045757 | 3300049579 | Bacteria | 3441 |
| 348 | Ga0501046_0324966 | 3300049580 | Bacteria | 1120 |
| 349 | Ga0501047_0005616 | 3300049581 | Bacteria | 11816 |
| 350 | Ga0501048_0016232 | 3300049582 | Bacteria | 5490 |
| 351 | Ga0501048_0061216 | 3300049582 | Bacteria | 2666 |
| 352 | Ga0501070_0038358 | 3300049586 | Bacteria | 3997 |
| 353 | Ga0501080_0015725 | 3300049742 | Bacteria | 6979 |
| 354 | Ga0501275_000137 | 3300049772 | Bacteria | 8171 |
| 355 | Ga0501035_0006759 | 3300049822 | Bacteria | 10719 |
| 356 | Ga0501035_0055813 | 3300049822 | Bacteria | 3526 |
| 357 | Ga0501035_0080433 | 3300049822 | Bacteria | 2877 |
| 358 | Ga0501035_0163554 | 3300049822 | Bacteria | 1925 |
| 359 | Ga0501035_0234756 | 3300049822 | Bacteria | 1562 |
| 360 | Ga0501044_0016710 | 3300049823 | Bacteria | 7878 |
| 361 | Ga0501044_0059182 | 3300049823 | Bacteria | 3926 |
| 362 | Ga0501044_0142000 | 3300049823 | Bacteria | 2389 |
| 363 | nmdc:mga00v17_154784_c1 | 3300050491 | Bacteria | 1474 |
| 364 | nmdc:mga00v17_574_c1 | 3300050491 | Bacteria | 20546 |
| 365 | nmdc:mga00v17_86307_c1 | 3300050491 | Bacteria | 1967 |
| 366 | Ga0500634_0004804 | 3300053161 | Bacteria | 6327 |
| 367 | Ga0466962_0026292 | 3300061719 | Bacteria | 2794 |
| 368 | Ga0466962_0158633 | 3300061719 | Bacteria | 1099 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003775 | Ga0055524_1010056 | Ga0055524_10100565 | 284 |
| 2 | 3300003781 | Ga0055536_1014566 | Ga0055536_10145663 | 284 |
| 3 | 3300003794 | Ga0055531_10004504 | Ga0055531_100045045 | 284 |
| 4 | 3300025273 | Ga0209673_1004308 | Ga0209673_10043083 | 284 |
| 5 | 3300025292 | Ga0209676_1003012 | Ga0209676_10030126 | 284 |
| 6 | 3300025292 | Ga0209676_1012770 | Ga0209676_10127703 | 284 |
| 7 | 3300025294 | Ga0209025_1002579 | Ga0209025_10025791 | 284 |
| 8 | 3300025297 | Ga0209758_1030868 | Ga0209758_10308681 | 284 |
| 9 | 3300025299 | Ga0209256_1005972 | Ga0209256_10059722 | 284 |
| 10 | 3300025304 | Ga0209257_1000414 | Ga0209257_100041467 | 284 |
| 11 | 3300025304 | Ga0209257_1001475 | Ga0209257_100147514 | 284 |
| 12 | 3300025304 | Ga0209257_1017247 | Ga0209257_10172473 | 284 |
| 13 | 3300032004 | Ga0307414_10001239 | Ga0307414_100012394 | 284 |
| 14 | 3300032005 | Ga0307411_10114401 | Ga0307411_101144011 | 288 |
| 15 | 3300049568 | Ga0501031_0027221 | Ga0501031_0027221_2779_3696 | 288 |
| 16 | 3300049573 | Ga0501037_0120656 | Ga0501037_0120656_216_1133 | 288 |
| 17 | 3300049574 | Ga0501038_0242562 | Ga0501038_0242562_179_1096 | 288 |
| 18 | 3300049579 | Ga0501043_0039385 | Ga0501043_0039385_2517_3434 | 288 |
| 19 | 3300049580 | Ga0501046_0324966 | Ga0501046_0324966_80_997 | 288 |
| 20 | 3300049581 | Ga0501047_0005616 | Ga0501047_0005616_1013_1930 | 288 |
| 21 | 3300049822 | Ga0501035_0006759 | Ga0501035_0006759_7481_8398 | 288 |
| 22 | 3300049823 | Ga0501044_0059182 | Ga0501044_0059182_1417_2334 | 288 |
| 23 | 3300032002 | Ga0307416_100250482 | Ga0307416_1002504821 | 289 |
| 24 | 3300025294 | Ga0209025_1020582 | Ga0209025_10205823 | 290 |
| 25 | 3300041404 | Ga0439436_0054857 | Ga0439436_0054857_61_984 | 290 |
| 26 | 3300042007 | Ga0439449_0002838 | Ga0439449_0002838_1821_2744 | 290 |
| 27 | 3300032005 | Ga0307411_10131552 | Ga0307411_101315522 | 291 |
| 28 | 3300042876 | Ga0451577_0020907 | Ga0451577_0020907_2281_3204 | 291 |
| 29 | 3300003781 | Ga0055536_1000759 | Ga0055536_10007597 | 292 |
| 30 | 3300005355 | Ga0070671_100303541 | Ga0070671_1003035412 | 292 |
| 31 | 3300025291 | Ga0209675_1007371 | Ga0209675_10073716 | 292 |
| 32 | 3300025292 | Ga0209676_1000501 | Ga0209676_100050114 | 292 |
| 33 | 3300048915 | Ga0496112_0248485 | Ga0496112_0248485_99_1043 | 292 |
| 34 | 3300009177 | Ga0105248_10700582 | Ga0105248_107005821 | 293 |
| 35 | iso_pu_bacteria | 2895498888 | 2895502852 | 297 |
| 36 | iso_pu_bacteria | 2895511927 | 2895512894 | 297 |
| 37 | iso_pu_bacteria | 2895522137 | 2895522902 | 297 |
| 38 | iso_pu_bacteria | 2895525241 | 2895525326 | 297 |
| 39 | iso_pu_bacteria | 2894414249 | 2894414329 | 298 |
| 40 | iso_pu_bacteria | 2923516293 | 2923519746 | 298 |
| 41 | iso_pu_bacteria | 2576861471 | 2578456872 | 299 |
| 42 | iso_pu_bacteria | 2852649853 | 2852652028 | 299 |
| 43 | iso_pu_bacteria | 2857442823 | 2857444288 | 299 |
| 44 | iso_pu_bacteria | 2919513703 | 2919515553 | 299 |
| 45 | iso_pu_bacteria | 2919675420 | 2919678443 | 299 |
| 46 | iso_pu_bacteria | 2941475908 | 2941478651 | 299 |
| 47 | iso_pu_bacteria | 2643221559 | 2643818209 | 300 |
| 48 | iso_pu_bacteria | 2643221586 | 2643937877 | 300 |
| 49 | iso_pu_bacteria | 2643221612 | 2644078786 | 300 |
| 50 | iso_pu_bacteria | 2643221727 | 2644693563 | 300 |
| 51 | iso_pu_bacteria | 2747842501 | 2748018757 | 300 |
| 52 | iso_pu_bacteria | 8002869464 | 8002870908 | 300 |
| 53 | 3300005289 | Ga0065704_10072505 | Ga0065704_100725056 | 301 |
| 54 | 3300005546 | Ga0070696_100176574 | Ga0070696_1001765742 | 301 |
| 55 | 3300006051 | Ga0075364_10000199 | Ga0075364_1000019919 | 301 |
| 56 | 3300009093 | Ga0105240_10030882 | Ga0105240_100308827 | 301 |
| 57 | 3300009545 | Ga0105237_10000387 | Ga0105237_1000038735 | 301 |
| 58 | 3300020082 | Ga0206353_10413103 | Ga0206353_104131038 | 301 |
| 59 | 3300025250 | Ga0209026_1000384 | Ga0209026_100038435 | 301 |
| 60 | 3300025904 | Ga0207647_10021906 | Ga0207647_100219065 | 301 |
| 61 | 3300025913 | Ga0207695_10001617 | Ga0207695_1000161729 | 301 |
| 62 | 3300025914 | Ga0207671_10000327 | Ga0207671_1000032712 | 301 |
| 63 | 3300025949 | Ga0207667_10035763 | Ga0207667_100357632 | 301 |
| 64 | 3300031456 | Ga0307513_10313635 | Ga0307513_103136352 | 301 |
| 65 | 3300037312 | Ga0395899_0019444 | Ga0395899_0019444_2389_3333 | 301 |
| 66 | 3300037418 | Ga0395900_0018823 | Ga0395900_0018823_4045_4989 | 301 |
| 67 | 3300037471 | Ga0395905_0004974 | Ga0395905_0004974_1351_2295 | 301 |
| 68 | 3300038443 | Ga0395901_0036036 | Ga0395901_0036036_1796_2740 | 301 |
| 69 | 3300041404 | Ga0439436_0014671 | Ga0439436_0014671_1324_2229 | 301 |
| 70 | 3300041486 | Ga0451807_2042735 | Ga0451807_2042735_653_1558 | 301 |
| 71 | 3300042004 | Ga0439445_0027085 | Ga0439445_0027085_332_1237 | 301 |
| 72 | 3300042007 | Ga0439449_0002733 | Ga0439449_0002733_3823_4728 | 301 |
| 73 | 3300046513 | Ga0495616_0162253 | Ga0495616_0162253_59_964 | 301 |
| 74 | 3300046692 | Ga0495671_0149951 | Ga0495671_0149951_59_964 | 301 |
| 75 | 3300048925 | Ga0496122_0029410 | Ga0496122_0029410_1703_2608 | 301 |
| 76 | 3300048926 | Ga0496123_0037121 | Ga0496123_0037121_180_1085 | 301 |
| 77 | 3300049568 | Ga0501031_0106492 | Ga0501031_0106492_823_1734 | 301 |
| 78 | 3300049569 | Ga0501032_0075048 | Ga0501032_0075048_877_1788 | 301 |
| 79 | 3300049570 | Ga0501033_0059658 | Ga0501033_0059658_795_1706 | 301 |
| 80 | 3300049574 | Ga0501038_0039625 | Ga0501038_0039625_353_1264 | 301 |
| 81 | 3300049575 | Ga0501039_0019611 | Ga0501039_0019611_3219_4130 | 301 |
| 82 | 3300049579 | Ga0501043_0045757 | Ga0501043_0045757_2159_3070 | 301 |
| 83 | 3300049822 | Ga0501035_0055813 | Ga0501035_0055813_1208_2119 | 301 |
| 84 | 3300049822 | Ga0501035_0080433 | Ga0501035_0080433_93_1004 | 301 |
| 85 | 3300049823 | Ga0501044_0016710 | Ga0501044_0016710_108_1019 | 301 |
| 86 | 3300050491 | nmdc:mga00v17_574_c1 | nmdc:mga00v17_574_c1_15852_16757 | 301 |
| 87 | iso_pu_bacteria | 8003014200 | 8003015509 | 301 |
| 88 | 3300003781 | Ga0055536_1006701 | Ga0055536_10067014 | 302 |
| 89 | 3300025913 | Ga0207695_10024489 | Ga0207695_100244891 | 302 |
| 90 | 3300031852 | Ga0307410_10129331 | Ga0307410_101293312 | 302 |
| 91 | 3300032004 | Ga0307414_10004652 | Ga0307414_100046526 | 302 |
| 92 | 3300037312 | Ga0395899_0106379 | Ga0395899_0106379_956_1870 | 302 |
| 93 | 3300041413 | Ga0439465_0019999 | Ga0439465_0019999_863_1789 | 302 |
| 94 | 3300042876 | Ga0451577_0007856 | Ga0451577_0007856_9318_10226 | 302 |
| 95 | 3300044712 | Ga0453684_0535231 | Ga0453684_0535231_149_1057 | 302 |
| 96 | 3300046616 | Ga0495668_0032153 | Ga0495668_0032153_38_946 | 302 |
| 97 | 3300047318 | Ga0495636_0028422 | Ga0495636_0028422_12_920 | 302 |
| 98 | 3300048917 | Ga0496114_0000853 | Ga0496114_0000853_727_1653 | 302 |
| 99 | 3300048929 | Ga0496126_0006973 | Ga0496126_0006973_1283_2209 | 302 |
| 100 | 3300049571 | Ga0501034_0002264 | Ga0501034_0002264_6072_6998 | 302 |
| 101 | 3300049571 | Ga0501034_0087809 | Ga0501034_0087809_2168_3082 | 302 |
| 102 | 3300049772 | Ga0501275_000137 | Ga0501275_000137_3602_4510 | 302 |
| 103 | iso_pu_bacteria | 2643221573 | 2643880397 | 302 |
| 104 | iso_pu_bacteria | 2643221579 | 2643906663 | 302 |
| 105 | iso_pu_bacteria | 2643221581 | 2643913836 | 302 |
| 106 | iso_pu_bacteria | 2643221720 | 2644660972 | 302 |
| 107 | iso_pu_bacteria | 2643221728 | 2644699054 | 302 |
| 108 | iso_pu_bacteria | 2687453130 | 2687584969 | 302 |
| 109 | iso_pu_bacteria | 2818991457 | 2819661379 | 302 |
| 110 | 3300002741 | JGI25157J39369_1001284 | JGI25157J39369_10012845 | 303 |
| 111 | 3300003760 | Ga0055527_1000140 | Ga0055527_100014023 | 303 |
| 112 | 3300003761 | Ga0055535_1000147 | Ga0055535_100014723 | 303 |
| 113 | 3300003762 | Ga0055542_1000064 | Ga0055542_100006424 | 303 |
| 114 | 3300003763 | Ga0055529_1000072 | Ga0055529_1000072117 | 303 |
| 115 | 3300003781 | Ga0055536_1005294 | Ga0055536_10052942 | 303 |
| 116 | 3300003791 | Ga0055530_10003265 | Ga0055530_100032658 | 303 |
| 117 | 3300003794 | Ga0055531_10006858 | Ga0055531_100068582 | 303 |
| 118 | 3300005563 | Ga0068855_100009026 | Ga0068855_1000090266 | 303 |
| 119 | 3300005578 | Ga0068854_100002940 | Ga0068854_1000029409 | 303 |
| 120 | 3300005614 | Ga0068856_100038861 | Ga0068856_1000388613 | 303 |
| 121 | 3300009011 | Ga0105251_10002607 | Ga0105251_100026075 | 303 |
| 122 | 3300009036 | Ga0105244_10020824 | Ga0105244_100208244 | 303 |
| 123 | 3300009093 | Ga0105240_10051758 | Ga0105240_100517584 | 303 |
| 124 | 3300015261 | Ga0182006_1015236 | Ga0182006_10152362 | 303 |
| 125 | 3300015265 | Ga0182005_1000676 | Ga0182005_100067612 | 303 |
| 126 | 3300017792 | Ga0163161_10008609 | Ga0163161_100086097 | 303 |
| 127 | 3300025226 | Ga0209674_100111 | Ga0209674_10011170 | 303 |
| 128 | 3300025228 | Ga0209672_100008 | Ga0209672_100008159 | 303 |
| 129 | 3300025242 | Ga0209258_100004 | Ga0209258_1000041031 | 303 |
| 130 | 3300025242 | Ga0209258_100008 | Ga0209258_100008656 | 303 |
| 131 | 3300025250 | Ga0209026_1000437 | Ga0209026_10004375 | 303 |
| 132 | 3300025253 | Ga0209677_105507 | Ga0209677_1055072 | 303 |
| 133 | 3300025254 | Ga0209148_1000041 | Ga0209148_1000041158 | 303 |
| 134 | 3300025256 | Ga0209759_1000164 | Ga0209759_100016416 | 303 |
| 135 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007776 | 303 |
| 136 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018110 | 303 |
| 137 | 3300025298 | Ga0209050_1000424 | Ga0209050_100042415 | 303 |
| 138 | 3300025303 | Ga0209051_1000809 | Ga0209051_100080912 | 303 |
| 139 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035110 | 303 |
| 140 | 3300025728 | Ga0207655_1050401 | Ga0207655_10504011 | 303 |
| 141 | 3300025735 | Ga0207713_1003492 | Ga0207713_100349210 | 303 |
| 142 | 3300025924 | Ga0207694_10035353 | Ga0207694_100353534 | 303 |
| 143 | 3300025972 | Ga0207668_10007764 | Ga0207668_100077645 | 303 |
| 144 | 3300026078 | Ga0207702_10000985 | Ga0207702_1000098525 | 303 |
| 145 | 3300037466 | Ga0395898_0000045 | Ga0395898_0000045_69472_70389 | 303 |
| 146 | 3300042876 | Ga0451577_0193836 | Ga0451577_0193836_219_1130 | 303 |
| 147 | 3300044656 | Ga0466969_0001986 | Ga0466969_0001986_2943_3920 | 303 |
| 148 | 3300044656 | Ga0466969_0081193 | Ga0466969_0081193_583_1530 | 303 |
| 149 | 3300044658 | Ga0466972_0027472 | Ga0466972_0027472_1518_2435 | 303 |
| 150 | 3300044672 | Ga0466982_0000006 | Ga0466982_0000006_173989_174906 | 303 |
| 151 | 3300044684 | Ga0466966_0028677 | Ga0466966_0028677_918_1835 | 303 |
| 152 | 3300044684 | Ga0466966_0075700 | Ga0466966_0075700_972_1949 | 303 |
| 153 | 3300044693 | Ga0466961_0000201 | Ga0466961_0000201_26738_27685 | 303 |
| 154 | 3300044693 | Ga0466961_0000758 | Ga0466961_0000758_4463_5410 | 303 |
| 155 | 3300044693 | Ga0466961_0004623 | Ga0466961_0004623_3631_4608 | 303 |
| 156 | 3300044693 | Ga0466961_0126727 | Ga0466961_0126727_489_1406 | 303 |
| 157 | 3300044706 | Ga0466964_0013641 | Ga0466964_0013641_1641_2558 | 303 |
| 158 | 3300044706 | Ga0466964_0032921 | Ga0466964_0032921_303_1250 | 303 |
| 159 | 3300044719 | Ga0466971_0000539 | Ga0466971_0000539_915_1832 | 303 |
| 160 | 3300044765 | Ga0466970_0000399 | Ga0466970_0000399_2496_3443 | 303 |
| 161 | 3300044765 | Ga0466970_0054801 | Ga0466970_0054801_35_952 | 303 |
| 162 | 3300044842 | Ga0466957_0001246 | Ga0466957_0001246_1286_2233 | 303 |
| 163 | 3300044842 | Ga0466957_0055809 | Ga0466957_0055809_683_1600 | 303 |
| 164 | 3300045049 | Ga0466959_0000038 | Ga0466959_0000038_31772_32749 | 303 |
| 165 | 3300045049 | Ga0466959_0002947 | Ga0466959_0002947_4346_5293 | 303 |
| 166 | 3300045836 | Ga0466958_0031969 | Ga0466958_0031969_1250_2167 | 303 |
| 167 | 3300045976 | Ga0466967_0031492 | Ga0466967_0031492_682_1629 | 303 |
| 168 | 3300046453 | Ga0495627_022468 | Ga0495627_022468_368_1279 | 303 |
| 169 | 3300046512 | Ga0495610_0002965 | Ga0495610_0002965_3075_3986 | 303 |
| 170 | 3300046518 | Ga0495631_0010000 | Ga0495631_0010000_478_1389 | 303 |
| 171 | 3300046810 | Ga0495660_0035310 | Ga0495660_0035310_165_1076 | 303 |
| 172 | 3300047320 | Ga0495672_0088360 | Ga0495672_0088360_79_990 | 303 |
| 173 | 3300048919 | Ga0496116_0015919 | Ga0496116_0015919_1263_2210 | 303 |
| 174 | 3300048919 | Ga0496116_0095167 | Ga0496116_0095167_323_1234 | 303 |
| 175 | 3300048920 | Ga0496117_0020497 | Ga0496117_0020497_3718_4629 | 303 |
| 176 | 3300048921 | Ga0496118_0104254 | Ga0496118_0104254_488_1399 | 303 |
| 177 | 3300048921 | Ga0496118_0142476 | Ga0496118_0142476_274_1185 | 303 |
| 178 | 3300048922 | Ga0496119_0001745 | Ga0496119_0001745_7703_8641 | 303 |
| 179 | 3300048923 | Ga0496120_0000196 | Ga0496120_0000196_16710_17648 | 303 |
| 180 | 3300048924 | Ga0496121_0026151 | Ga0496121_0026151_1856_2794 | 303 |
| 181 | 3300048924 | Ga0496121_0048779 | Ga0496121_0048779_245_1156 | 303 |
| 182 | 3300048925 | Ga0496122_0006902 | Ga0496122_0006902_655_1566 | 303 |
| 183 | 3300048926 | Ga0496123_0036981 | Ga0496123_0036981_24_935 | 303 |
| 184 | 3300048927 | Ga0496124_0000584 | Ga0496124_0000584_44568_45479 | 303 |
| 185 | 3300048927 | Ga0496124_0001337 | Ga0496124_0001337_3001_3912 | 303 |
| 186 | 3300048927 | Ga0496124_0007264 | Ga0496124_0007264_1933_2844 | 303 |
| 187 | 3300048927 | Ga0496124_0012154 | Ga0496124_0012154_2160_3071 | 303 |
| 188 | 3300048927 | Ga0496124_0253785 | Ga0496124_0253785_12_923 | 303 |
| 189 | 3300048928 | Ga0496125_0000825 | Ga0496125_0000825_8385_9323 | 303 |
| 190 | 3300048928 | Ga0496125_0001438 | Ga0496125_0001438_25264_26175 | 303 |
| 191 | 3300048928 | Ga0496125_0088325 | Ga0496125_0088325_788_1735 | 303 |
| 192 | 3300048929 | Ga0496126_0001087 | Ga0496126_0001087_16690_17628 | 303 |
| 193 | 3300049568 | Ga0501031_0078274 | Ga0501031_0078274_219_1142 | 303 |
| 194 | 3300049569 | Ga0501032_0011165 | Ga0501032_0011165_3502_4425 | 303 |
| 195 | 3300049569 | Ga0501032_0298275 | Ga0501032_0298275_50_967 | 303 |
| 196 | 3300049570 | Ga0501033_0010238 | Ga0501033_0010238_5870_6874 | 303 |
| 197 | 3300049571 | Ga0501034_0174456 | Ga0501034_0174456_149_1066 | 303 |
| 198 | 3300049572 | Ga0501036_0025387 | Ga0501036_0025387_1997_2920 | 303 |
| 199 | 3300049573 | Ga0501037_0021686 | Ga0501037_0021686_476_1399 | 303 |
| 200 | 3300049574 | Ga0501038_0087555 | Ga0501038_0087555_1217_2140 | 303 |
| 201 | 3300049575 | Ga0501039_0324751 | Ga0501039_0324751_159_1076 | 303 |
| 202 | 3300049582 | Ga0501048_0061216 | Ga0501048_0061216_455_1378 | 303 |
| 203 | 3300049586 | Ga0501070_0038358 | Ga0501070_0038358_2190_3113 | 303 |
| 204 | 3300049742 | Ga0501080_0015725 | Ga0501080_0015725_91_1014 | 303 |
| 205 | 3300049822 | Ga0501035_0163554 | Ga0501035_0163554_527_1450 | 303 |
| 206 | 3300049822 | Ga0501035_0234756 | Ga0501035_0234756_104_1021 | 303 |
| 207 | 3300049823 | Ga0501044_0142000 | Ga0501044_0142000_1216_2139 | 303 |
| 208 | 3300050491 | nmdc:mga00v17_154784_c1 | nmdc:mga00v17_154784_c1_107_1018 | 303 |
| 209 | 3300050491 | nmdc:mga00v17_86307_c1 | nmdc:mga00v17_86307_c1_591_1502 | 303 |
| 210 | 3300061719 | Ga0466962_0026292 | Ga0466962_0026292_1199_2116 | 303 |
| 211 | 3300061719 | Ga0466962_0158633 | Ga0466962_0158633_23_970 | 303 |
| 212 | iso_pu_bacteria | 2643221695 | 2644528122 | 303 |
| 213 | iso_pu_bacteria | 2842757796 | 2842758894 | 303 |
| 214 | iso_pu_bacteria | 2852684882 | 2852687249 | 303 |
| 215 | iso_pu_bacteria | 2919130084 | 2919130994 | 303 |
| 216 | iso_pu_bacteria | 2929195423 | 2929196231 | 303 |
| 217 | iso_pu_bacteria | 8021622325 | 8021622525 | 303 |
| 218 | iso_pu_bacteria | 8021626552 | 8021628665 | 303 |
| 219 | iso_pu_bacteria | 8021648035 | 8021650851 | 303 |
| 220 | 3300001989 | JGI24739J22299_10000087 | JGI24739J22299_1000008718 | 304 |
| 221 | 3300003215 | JGI25153J46596_10010132 | JGI25153J46596_100101325 | 304 |
| 222 | 3300003316 | rootH1_10097541 | rootH1_100975412 | 304 |
| 223 | 3300003761 | Ga0055535_1000278 | Ga0055535_100027828 | 304 |
| 224 | 3300003762 | Ga0055542_1000308 | Ga0055542_100030824 | 304 |
| 225 | 3300005331 | Ga0070670_100347405 | Ga0070670_1003474052 | 304 |
| 226 | 3300005563 | Ga0068855_100092486 | Ga0068855_1000924862 | 304 |
| 227 | 3300005577 | Ga0068857_100001283 | Ga0068857_10000128314 | 304 |
| 228 | 3300005578 | Ga0068854_100038189 | Ga0068854_1000381894 | 304 |
| 229 | 3300005616 | Ga0068852_100038796 | Ga0068852_1000387964 | 304 |
| 230 | 3300005834 | Ga0068851_10000226 | Ga0068851_1000022620 | 304 |
| 231 | 3300005842 | Ga0068858_100054718 | Ga0068858_1000547184 | 304 |
| 232 | 3300009093 | Ga0105240_10005933 | Ga0105240_100059339 | 304 |
| 233 | 3300009545 | Ga0105237_10000212 | Ga0105237_1000021240 | 304 |
| 234 | 3300010375 | Ga0105239_10013080 | Ga0105239_1001308010 | 304 |
| 235 | 3300012500 | Ga0157314_1000003 | Ga0157314_100000321 | 304 |
| 236 | 3300025242 | Ga0209258_100217 | Ga0209258_10021725 | 304 |
| 237 | 3300025254 | Ga0209148_1000197 | Ga0209148_100019724 | 304 |
| 238 | 3300025258 | Ga0209129_1002281 | Ga0209129_100228110 | 304 |
| 239 | 3300025294 | Ga0209025_1003420 | Ga0209025_10034207 | 304 |
| 240 | 3300025297 | Ga0209758_1000408 | Ga0209758_100040821 | 304 |
| 241 | 3300025904 | Ga0207647_10011817 | Ga0207647_100118172 | 304 |
| 242 | 3300025913 | Ga0207695_10009925 | Ga0207695_100099259 | 304 |
| 243 | 3300025914 | Ga0207671_10000009 | Ga0207671_10000009171 | 304 |
| 244 | 3300025925 | Ga0207650_10489729 | Ga0207650_104897291 | 304 |
| 245 | 3300025949 | Ga0207667_10000063 | Ga0207667_1000006343 | 304 |
| 246 | 3300025981 | Ga0207640_10000746 | Ga0207640_1000074612 | 304 |
| 247 | 3300026035 | Ga0207703_10105125 | Ga0207703_101051253 | 304 |
| 248 | 3300026088 | Ga0207641_10419153 | Ga0207641_104191532 | 304 |
| 249 | 3300026116 | Ga0207674_10000123 | Ga0207674_1000012339 | 304 |
| 250 | 3300027614 | Ga0209970_1004485 | Ga0209970_10044853 | 304 |
| 251 | 3300027665 | Ga0209983_1022754 | Ga0209983_10227542 | 304 |
| 252 | 3300027682 | Ga0209971_1001501 | Ga0209971_10015013 | 304 |
| 253 | 3300041404 | Ga0439436_0001192 | Ga0439436_0001192_3963_4895 | 304 |
| 254 | 3300041404 | Ga0439436_0001844 | Ga0439436_0001844_5143_6057 | 304 |
| 255 | 3300041413 | Ga0439465_0000271 | Ga0439465_0000271_8796_9728 | 304 |
| 256 | 3300041413 | Ga0439465_0082944 | Ga0439465_0082944_133_1047 | 304 |
| 257 | 3300042004 | Ga0439445_0001921 | Ga0439445_0001921_1762_2694 | 304 |
| 258 | 3300042004 | Ga0439445_0002572 | Ga0439445_0002572_1281_2195 | 304 |
| 259 | 3300042007 | Ga0439449_0000094 | Ga0439449_0000094_27405_28337 | 304 |
| 260 | 3300046539 | Ga0495621_0000246 | Ga0495621_0000246_4855_5772 | 304 |
| 261 | 3300046615 | Ga0495656_0022257 | Ga0495656_0022257_1148_2080 | 304 |
| 262 | 3300047318 | Ga0495636_0010028 | Ga0495636_0010028_383_1300 | 304 |
| 263 | 3300048090 | Ga0495615_0032334 | Ga0495615_0032334_331_1248 | 304 |
| 264 | 3300048906 | Ga0496103_0188345 | Ga0496103_0188345_100_1032 | 304 |
| 265 | 3300048915 | Ga0496112_0338677 | Ga0496112_0338677_162_1094 | 304 |
| 266 | 3300048924 | Ga0496121_0018204 | Ga0496121_0018204_1277_2197 | 304 |
| 267 | 3300048928 | Ga0496125_0000251 | Ga0496125_0000251_80596_81516 | 304 |
| 268 | 3300049571 | Ga0501034_0002403 | Ga0501034_0002403_11902_12816 | 304 |
| 269 | 3300003775 | Ga0055524_1007011 | Ga0055524_10070115 | 305 |
| 270 | 3300003791 | Ga0055530_10001396 | Ga0055530_100013962 | 305 |
| 271 | 3300005353 | Ga0070669_100008308 | Ga0070669_1000083081 | 305 |
| 272 | 3300009979 | Ga0105032_100139 | Ga0105032_1001396 | 305 |
| 273 | 3300021384 | Ga0213876_10052435 | Ga0213876_100524352 | 305 |
| 274 | 3300025292 | Ga0209676_1006481 | Ga0209676_10064816 | 305 |
| 275 | 3300025292 | Ga0209676_1012381 | Ga0209676_10123813 | 305 |
| 276 | 3300025295 | Ga0209564_1008102 | Ga0209564_10081023 | 305 |
| 277 | 3300025298 | Ga0209050_1002116 | Ga0209050_100211616 | 305 |
| 278 | 3300025299 | Ga0209256_1001986 | Ga0209256_10019865 | 305 |
| 279 | 3300025299 | Ga0209256_1002614 | Ga0209256_10026146 | 305 |
| 280 | 3300025303 | Ga0209051_1022773 | Ga0209051_10227733 | 305 |
| 281 | 3300025304 | Ga0209257_1012708 | Ga0209257_10127082 | 305 |
| 282 | 3300025923 | Ga0207681_10006279 | Ga0207681_100062796 | 305 |
| 283 | 3300032004 | Ga0307414_10017956 | Ga0307414_100179565 | 305 |
| 284 | 3300035398 | Ga0316574_0168259 | Ga0316574_0168259_360_1286 | 305 |
| 285 | 3300036712 | Ga0316584_0084340 | Ga0316584_0084340_1285_2211 | 305 |
| 286 | 3300039437 | Ga0436365_1474399 | Ga0436365_1474399_466_1386 | 305 |
| 287 | 3300046558 | Ga0495633_0006647 | Ga0495633_0006647_979_1899 | 305 |
| 288 | 3300049582 | Ga0501048_0016232 | Ga0501048_0016232_4464_5387 | 305 |
| 289 | 3300053161 | Ga0500634_0004804 | Ga0500634_0004804_3078_3998 | 305 |
| 290 | 3300003856 | Ga0058692_1000028 | Ga0058692_1000028170 | 306 |
| 291 | 3300005543 | Ga0070672_100106060 | Ga0070672_1001060602 | 306 |
| 292 | 3300027312 | Ga0209371_1000025 | Ga0209371_100002593 | 306 |
| 293 | 3300030500 | Ga0268256_1000027 | Ga0268256_100002793 | 306 |
| 294 | 2162886007 | SwRhRL2b_contig_3470979 | SwRhRL2b_0284.00001940 | 307 |
| 295 | 2162886012 | MBSR1b_contig_6401888 | MBSR1b_0677.00004930 | 307 |
| 296 | 3300005289 | Ga0065704_10144331 | Ga0065704_101443312 | 307 |
| 297 | 3300005293 | Ga0065715_10094970 | Ga0065715_100949706 | 307 |
| 298 | 3300005330 | Ga0070690_100000679 | Ga0070690_1000006793 | 307 |
| 299 | 3300005331 | Ga0070670_100009158 | Ga0070670_1000091585 | 307 |
| 300 | 3300005331 | Ga0070670_100011348 | Ga0070670_1000113485 | 307 |
| 301 | 3300005331 | Ga0070670_100073661 | Ga0070670_1000736612 | 307 |
| 302 | 3300005339 | Ga0070660_100044971 | Ga0070660_1000449712 | 307 |
| 303 | 3300005343 | Ga0070687_100002156 | Ga0070687_1000021565 | 307 |
| 304 | 3300005344 | Ga0070661_100033798 | Ga0070661_1000337982 | 307 |
| 305 | 3300005353 | Ga0070669_100058663 | Ga0070669_1000586632 | 307 |
| 306 | 3300005354 | Ga0070675_100001328 | Ga0070675_10000132818 | 307 |
| 307 | 3300005355 | Ga0070671_100018481 | Ga0070671_1000184815 | 307 |
| 308 | 3300005364 | Ga0070673_100001221 | Ga0070673_1000012215 | 307 |
| 309 | 3300005365 | Ga0070688_100046229 | Ga0070688_1000462293 | 307 |
| 310 | 3300005366 | Ga0070659_100124972 | Ga0070659_1001249721 | 307 |
| 311 | 3300005367 | Ga0070667_100316753 | Ga0070667_1003167532 | 307 |
| 312 | 3300005438 | Ga0070701_10018974 | Ga0070701_100189742 | 307 |
| 313 | 3300005440 | Ga0070705_100028884 | Ga0070705_1000288843 | 307 |
| 314 | 3300005441 | Ga0070700_100002135 | Ga0070700_1000021358 | 307 |
| 315 | 3300005455 | Ga0070663_100181746 | Ga0070663_1001817462 | 307 |
| 316 | 3300005456 | Ga0070678_100030344 | Ga0070678_1000303442 | 307 |
| 317 | 3300005457 | Ga0070662_100321378 | Ga0070662_1003213781 | 307 |
| 318 | 3300005535 | Ga0070684_100000450 | Ga0070684_1000004506 | 307 |
| 319 | 3300005543 | Ga0070672_100041648 | Ga0070672_1000416482 | 307 |
| 320 | 3300005544 | Ga0070686_100000933 | Ga0070686_1000009335 | 307 |
| 321 | 3300005547 | Ga0070693_100038696 | Ga0070693_1000386962 | 307 |
| 322 | 3300005548 | Ga0070665_100015798 | Ga0070665_1000157988 | 307 |
| 323 | 3300005564 | Ga0070664_100001964 | Ga0070664_10000196411 | 307 |
| 324 | 3300005615 | Ga0070702_100054498 | Ga0070702_1000544982 | 307 |
| 325 | 3300005617 | Ga0068859_100006841 | Ga0068859_1000068416 | 307 |
| 326 | 3300005618 | Ga0068864_100000569 | Ga0068864_10000056917 | 307 |
| 327 | 3300005718 | Ga0068866_10042409 | Ga0068866_100424092 | 307 |
| 328 | 3300005719 | Ga0068861_100020202 | Ga0068861_1000202027 | 307 |
| 329 | 3300005841 | Ga0068863_100001625 | Ga0068863_1000016256 | 307 |
| 330 | 3300005844 | Ga0068862_100004773 | Ga0068862_1000047738 | 307 |
| 331 | 3300006871 | Ga0075434_100205832 | Ga0075434_1002058322 | 307 |
| 332 | 3300006881 | Ga0068865_100035116 | Ga0068865_1000351163 | 307 |
| 333 | 3300006931 | Ga0097620_100006841 | Ga0097620_10000684110 | 307 |
| 334 | 3300009011 | Ga0105251_10000155 | Ga0105251_1000015511 | 307 |
| 335 | 3300009093 | Ga0105240_10047398 | Ga0105240_100473984 | 307 |
| 336 | 3300009148 | Ga0105243_10031039 | Ga0105243_100310393 | 307 |
| 337 | 3300009177 | Ga0105248_10001446 | Ga0105248_1000144610 | 307 |
| 338 | 3300009177 | Ga0105248_10144138 | Ga0105248_101441383 | 307 |
| 339 | 3300009177 | Ga0105248_10350440 | Ga0105248_103504401 | 307 |
| 340 | 3300009545 | Ga0105237_10097696 | Ga0105237_100976964 | 307 |
| 341 | 3300009553 | Ga0105249_10008733 | Ga0105249_100087335 | 307 |
| 342 | 3300013105 | Ga0157369_10047874 | Ga0157369_100478745 | 307 |
| 343 | 3300013306 | Ga0163162_10083756 | Ga0163162_100837562 | 307 |
| 344 | 3300013307 | Ga0157372_10056422 | Ga0157372_100564225 | 307 |
| 345 | 3300013308 | Ga0157375_10001177 | Ga0157375_1000117716 | 307 |
| 346 | 3300013308 | Ga0157375_10255886 | Ga0157375_102558862 | 307 |
| 347 | 3300014325 | Ga0163163_10001913 | Ga0163163_100019132 | 307 |
| 348 | 3300014745 | Ga0157377_10018572 | Ga0157377_100185723 | 307 |
| 349 | 3300015265 | Ga0182005_1003051 | Ga0182005_10030516 | 307 |
| 350 | 3300025735 | Ga0207713_1001387 | Ga0207713_10013879 | 307 |
| 351 | 3300025893 | Ga0207682_10039412 | Ga0207682_100394122 | 307 |
| 352 | 3300025918 | Ga0207662_10005373 | Ga0207662_100053733 | 307 |
| 353 | 3300025919 | Ga0207657_10027100 | Ga0207657_100271004 | 307 |
| 354 | 3300025920 | Ga0207649_10124953 | Ga0207649_101249532 | 307 |
| 355 | 3300025925 | Ga0207650_10002717 | Ga0207650_100027171 | 307 |
| 356 | 3300025925 | Ga0207650_10107187 | Ga0207650_101071872 | 307 |
| 357 | 3300025926 | Ga0207659_10031698 | Ga0207659_100316984 | 307 |
| 358 | 3300025927 | Ga0207687_10203985 | Ga0207687_102039852 | 307 |
| 359 | 3300025931 | Ga0207644_10072150 | Ga0207644_100721503 | 307 |
| 360 | 3300025933 | Ga0207706_10335702 | Ga0207706_103357022 | 307 |
| 361 | 3300025936 | Ga0207670_10024203 | Ga0207670_100242033 | 307 |
| 362 | 3300025940 | Ga0207691_10057156 | Ga0207691_100571566 | 307 |
| 363 | 3300025941 | Ga0207711_10005954 | Ga0207711_100059542 | 307 |
| 364 | 3300025941 | Ga0207711_10025341 | Ga0207711_100253415 | 307 |
| 365 | 3300025942 | Ga0207689_10159212 | Ga0207689_101592122 | 307 |
| 366 | 3300025945 | Ga0207679_10036818 | Ga0207679_100368182 | 307 |
| 367 | 3300025960 | Ga0207651_10030405 | Ga0207651_100304053 | 307 |
| 368 | 3300025961 | Ga0207712_10086311 | Ga0207712_100863112 | 307 |
| 369 | 3300025981 | Ga0207640_10072491 | Ga0207640_100724912 | 307 |
| 370 | 3300025986 | Ga0207658_10071560 | Ga0207658_100715603 | 307 |
| 371 | 3300026067 | Ga0207678_10371963 | Ga0207678_103719632 | 307 |
| 372 | 3300026075 | Ga0207708_10003483 | Ga0207708_1000348310 | 307 |
| 373 | 3300026088 | Ga0207641_10031430 | Ga0207641_100314305 | 307 |
| 374 | 3300026089 | Ga0207648_10010963 | Ga0207648_1001096310 | 307 |
| 375 | 3300026095 | Ga0207676_10004368 | Ga0207676_100043689 | 307 |
| 376 | 3300026116 | Ga0207674_10092901 | Ga0207674_100929013 | 307 |
| 377 | 3300026118 | Ga0207675_100071135 | Ga0207675_1000711352 | 307 |
| 378 | 3300028380 | Ga0268265_10005173 | Ga0268265_100051739 | 307 |
| 379 | 3300028381 | Ga0268264_10012065 | Ga0268264_100120658 | 307 |
| 380 | 3300031901 | Ga0307406_10004711 | Ga0307406_100047117 | 307 |
| 381 | 3300032002 | Ga0307416_100034678 | Ga0307416_1000346785 | 307 |
| 382 | 3300035691 | Ga0373931_0099822 | Ga0373931_0099822_508_1449 | 307 |
| 383 | 3300037312 | Ga0395899_0000057 | Ga0395899_0000057_157527_158516 | 307 |
| 384 | 3300037418 | Ga0395900_0000035 | Ga0395900_0000035_175126_176115 | 307 |
| 385 | 3300037466 | Ga0395898_0000150 | Ga0395898_0000150_77745_78734 | 307 |
| 386 | 3300038443 | Ga0395901_0087858 | Ga0395901_0087858_1837_2826 | 307 |
| 387 | 3300041404 | Ga0439436_0032814 | Ga0439436_0032814_306_1274 | 307 |
| 388 | 3300045051 | Ga0451576_0327842 | Ga0451576_0327842_616_1557 | 307 |
| 389 | 3300046537 | Ga0495598_0002801 | Ga0495598_0002801_1063_2007 | 307 |
| 390 | 3300046539 | Ga0495621_0002002 | Ga0495621_0002002_3022_3966 | 307 |
| 391 | 3300048090 | Ga0495615_0045625 | Ga0495615_0045625_84_1028 | 307 |
| 392 | 3300048909 | Ga0496106_0011188 | Ga0496106_0011188_4250_5191 | 307 |
| 393 | 3300048913 | Ga0496110_0098884 | Ga0496110_0098884_1309_2250 | 307 |
| 394 | 3300048915 | Ga0496112_0188638 | Ga0496112_0188638_99_1040 | 307 |
| 395 | 3300048916 | Ga0496113_0151437 | Ga0496113_0151437_550_1491 | 307 |
| 396 | 3300048920 | Ga0496117_0001505 | Ga0496117_0001505_21397_22320 | 307 |
| 397 | 3300048922 | Ga0496119_0000719 | Ga0496119_0000719_16548_17471 | 307 |
| 398 | 3300048923 | Ga0496120_0001466 | Ga0496120_0001466_27149_28072 | 307 |
| 399 | 3300048925 | Ga0496122_0001011 | Ga0496122_0001011_27869_28792 | 307 |
| 400 | 3300048926 | Ga0496123_0002592 | Ga0496123_0002592_82_1005 | 307 |
| 401 | 3300048927 | Ga0496124_0000219 | Ga0496124_0000219_16457_17380 | 307 |
| 402 | 3300048929 | Ga0496126_0042046 | Ga0496126_0042046_1974_2897 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h6o-assembly1.cif.gz_A | porphobilinogen deaminase from vibrio cholerae | 0.923 | 2 | 301 |
| 5h6o-assembly1.cif.gz_A | porphobilinogen deaminase from vibrio cholerae | 0.9199 | 2 | 301 |
| 1ypn-assembly1.cif.gz_A | reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction | 0.9118 | 3 | 301 |
| 2ypn-assembly1.cif.gz_A | hydroxymethylbilane synthase | 0.9105 | 1 | 301 |
| 4mlq-assembly1.cif.gz_A | crystal structure of bacillus megaterium porphobilinogen deaminase | 0.9103 | 1 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5m7fA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9634 | 4 | 95 | 3.40.190.10 |
| 1ah5A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9518 | 99 | 197 | 3.40.190.10 |
| af_Q54P93_232_322_3.30.160.40 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9465 | 222 | 301 | 3.30.160.40 |
| af_F1R6A1_237_360_3.30.160.40 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain | 0.9437 | 219 | 301 | 3.30.160.40 |
| 4fajA03 | Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 | 0.9424 | 1 | 40 | 3.10.105.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9IPV6-F1-model_v4 | Hydroxymethylbilane synthase | 0.9657 | 215 | 303 |
GO:0004418
GO:0033014 |
| AF-A0A496W235-F1-model_v4 | Hydroxymethylbilane synthase | 0.9656 | 221 | 302 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-A0A7C7MUS1-F1-model_v4 | Hydroxymethylbilane synthase | 0.9628 | 217 | 301 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-A0A645FZN3-F1-model_v4 | Porphobilinogen deaminase (EC 2.5.1.61) | 0.9617 | 225 | 301 |
GO:0004418
GO:0005737 GO:0006783 |
| AF-X1BBZ5-F1-model_v4 | Porphobilinogen deaminase C-terminal domain-containing protein | 0.9613 | 226 | 301 |
GO:0004418
GO:0005737 GO:0006783 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar