F435152

General Info

Members Datasets Scaffolds Average Seq Length
402 263 368 306

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0002838|Ga0439449_0002838_1821_2744
Length 291
Sequence MTRLLRIATRKSPLALWQSEHVAAALRAAHSGLDVVLVPMSTRGDEVLDRSLAAIGGKGLFLKELELAMLRGEADCAVHSLKDVPMELEPGFALPAILQRADHADAFVSNRYDNIDALPLGAVVGTSSLRRQAQLRTRLAKLDAGEYDAIVLACAGLQRLGFDARIRSRMDAPQWLPAPAQGAIAIECRDDDADTRALCAKLDHTATRICVEAERAMNRTLHGSCHVPVAAFARLEGERLHLHGLVGSAADGRAIRAQAEGRGDAPESLGREVAQSLQQQGAGDLIAASGA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
18 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
19 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
20 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
21 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
22 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
23 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
24 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
25 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
26 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
27 2919513703 Luteimonas sp. 3794 Isolate Unclassified
28 2919675420 Luteimonas terrae 4099 Isolate Unclassified
29 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
30 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
31 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
260 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
261 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
262 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
263 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.29
Metatranscriptomes 0.25
Isolates 8.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.43
Nodule 0
Rhizoplane 2.24
Rhizosphere 68.41
Stem 0
Stem Tuber 0
Unclassified 14.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3470979 2162886007 Bacteria 1482
2 MBSR1b_contig_6401888 2162886012 Bacteria 2289
3 JGI24739J22299_10000087 3300001989 Bacteria 26642
4 JGI25157J39369_1001284 3300002741 Bacteria 10096
5 JGI25153J46596_10010132 3300003215 Bacteria 4293
6 rootH1_10097541 3300003316 Bacteria 1941
7 Ga0055527_1000140 3300003760 Bacteria 51402
8 Ga0055535_1000147 3300003761 Bacteria 74557
9 Ga0055535_1000278 3300003761 Bacteria 53724
10 Ga0055542_1000064 3300003762 Bacteria 159853
11 Ga0055542_1000308 3300003762 Bacteria 53724
12 Ga0055529_1000072 3300003763 Bacteria 159853
13 Ga0055524_1007011 3300003775 Bacteria 4840
14 Ga0055524_1010056 3300003775 Bacteria 3793
15 Ga0055536_1000759 3300003781 Bacteria 21507
16 Ga0055536_1005294 3300003781 Bacteria 6349
17 Ga0055536_1006701 3300003781 Bacteria 5295
18 Ga0055536_1014566 3300003781 Bacteria 2748
19 Ga0055530_10001396 3300003791 Bacteria 17854
20 Ga0055530_10003265 3300003791 Bacteria 9433
21 Ga0055531_10004504 3300003794 Bacteria 8459
22 Ga0055531_10006858 3300003794 Bacteria 6349
23 Ga0058692_1000028 3300003856 Bacteria 193757
24 Ga0065704_10072505 3300005289 Bacteria 8411
25 Ga0065704_10144331 3300005289 Bacteria 1482
26 Ga0065715_10094970 3300005293 Bacteria 4199
27 Ga0070690_100000679 3300005330 Bacteria 17392
28 Ga0070670_100009158 3300005331 Bacteria 8463
29 Ga0070670_100011348 3300005331 Bacteria 7614
30 Ga0070670_100073661 3300005331 Bacteria 2933
31 Ga0070670_100347405 3300005331 Bacteria 1303
32 Ga0070660_100044971 3300005339 Bacteria 3378
33 Ga0070687_100002156 3300005343 Bacteria 7279
34 Ga0070661_100033798 3300005344 Bacteria 3707
35 Ga0070669_100008308 3300005353 Bacteria 7414
36 Ga0070669_100058663 3300005353 Bacteria 2825
37 Ga0070675_100001328 3300005354 Bacteria 18093
38 Ga0070671_100018481 3300005355 Bacteria 5663
39 Ga0070671_100303541 3300005355 Bacteria 1359
40 Ga0070673_100001221 3300005364 Bacteria 14852
41 Ga0070688_100046229 3300005365 Bacteria 2695
42 Ga0070659_100124972 3300005366 Bacteria 2087
43 Ga0070667_100316753 3300005367 Bacteria 1407
44 Ga0070701_10018974 3300005438 Bacteria 3242
45 Ga0070705_100028884 3300005440 Bacteria 3043
46 Ga0070700_100002135 3300005441 Bacteria 10025
47 Ga0070663_100181746 3300005455 Bacteria 1632
48 Ga0070678_100030344 3300005456 Bacteria 3716
49 Ga0070662_100321378 3300005457 Bacteria 1262
50 Ga0070684_100000450 3300005535 Bacteria 28151
51 Ga0070672_100041648 3300005543 Bacteria 3532
52 Ga0070672_100106060 3300005543 Bacteria 2285
53 Ga0070686_100000933 3300005544 Bacteria 16821
54 Ga0070696_100176574 3300005546 Bacteria 1582
55 Ga0070693_100038696 3300005547 Bacteria 2667
56 Ga0070665_100015798 3300005548 Bacteria 7582
57 Ga0068855_100009026 3300005563 Bacteria 12046
58 Ga0068855_100092486 3300005563 Bacteria 3488
59 Ga0070664_100001964 3300005564 Bacteria 16503
60 Ga0068857_100001283 3300005577 Bacteria 19730
61 Ga0068854_100002940 3300005578 Bacteria 10567
62 Ga0068854_100038189 3300005578 Bacteria 3376
63 Ga0068856_100038861 3300005614 Bacteria 4672
64 Ga0070702_100054498 3300005615 Bacteria 2301
65 Ga0068852_100038796 3300005616 Bacteria 4006
66 Ga0068859_100006841 3300005617 Bacteria 11584
67 Ga0068864_100000569 3300005618 Bacteria 31341
68 Ga0068866_10042409 3300005718 Bacteria 2264
69 Ga0068861_100020202 3300005719 Bacteria 4766
70 Ga0068851_10000226 3300005834 Bacteria 27072
71 Ga0068863_100001625 3300005841 Bacteria 22204
72 Ga0068858_100054718 3300005842 Bacteria 3690
73 Ga0068862_100004773 3300005844 Bacteria 11408
74 Ga0075364_10000199 3300006051 Bacteria 27820
75 Ga0075434_100205832 3300006871 Bacteria 1988
76 Ga0068865_100035116 3300006881 Bacteria 3369
77 Ga0097620_100006841 3300006931 Bacteria 11584
78 Ga0105251_10000155 3300009011 Bacteria 69872
79 Ga0105251_10002607 3300009011 Bacteria 13945
80 Ga0105244_10020824 3300009036 Bacteria 3635
81 Ga0105240_10005933 3300009093 Bacteria 18089
82 Ga0105240_10030882 3300009093 Bacteria 6959
83 Ga0105240_10047398 3300009093 Bacteria 5438
84 Ga0105240_10051758 3300009093 Bacteria 5166
85 Ga0105243_10031039 3300009148 Bacteria 4119
86 Ga0105248_10001446 3300009177 Bacteria 26459
87 Ga0105248_10144138 3300009177 Bacteria 2688
88 Ga0105248_10350440 3300009177 Bacteria 1662
89 Ga0105248_10700582 3300009177 Bacteria 1143
90 Ga0105237_10000212 3300009545 Bacteria 82465
91 Ga0105237_10000387 3300009545 Bacteria 62716
92 Ga0105237_10097696 3300009545 Bacteria 2927
93 Ga0105249_10008733 3300009553 Bacteria 8839
94 Ga0105032_100139 3300009979 Bacteria 7657
95 Ga0105239_10013080 3300010375 Bacteria 9221
96 Ga0157314_1000003 3300012500 Bacteria 34099
97 Ga0157369_10047874 3300013105 Bacteria 4641
98 Ga0163162_10083756 3300013306 Bacteria 3263
99 Ga0157372_10056422 3300013307 Bacteria 4389
100 Ga0157375_10001177 3300013308 Bacteria 22597
101 Ga0157375_10255886 3300013308 Bacteria 1912
102 Ga0163163_10001913 3300014325 Bacteria 17623
103 Ga0157377_10018572 3300014745 Bacteria 3616
104 Ga0182006_1015236 3300015261 Bacteria 3298
105 Ga0182005_1000676 3300015265 Bacteria 16002
106 Ga0182005_1003051 3300015265 Bacteria 5778
107 Ga0163161_10008609 3300017792 Bacteria 7053
108 Ga0206353_10413103 3300020082 Bacteria 7123
109 Ga0213876_10052435 3300021384 Bacteria 2156
110 Ga0209674_100111 3300025226 Bacteria 143058
111 Ga0209672_100008 3300025228 Bacteria 946876
112 Ga0209258_100004 3300025242 Bacteria 1376422
113 Ga0209258_100008 3300025242 Bacteria 1009355
114 Ga0209258_100217 3300025242 Bacteria 110607
115 Ga0209026_1000384 3300025250 Bacteria 40186
116 Ga0209026_1000437 3300025250 Bacteria 34592
117 Ga0209677_105507 3300025253 Bacteria 3280
118 Ga0209148_1000041 3300025254 Bacteria 469323
119 Ga0209148_1000197 3300025254 Bacteria 109412
120 Ga0209759_1000164 3300025256 Bacteria 113141
121 Ga0209129_1002281 3300025258 Bacteria 9558
122 Ga0209455_1000007 3300025272 Bacteria 1157983
123 Ga0209673_1004308 3300025273 Bacteria 7688
124 Ga0209675_1007371 3300025291 Bacteria 4226
125 Ga0209676_1000018 3300025292 Bacteria 631385
126 Ga0209676_1000501 3300025292 Bacteria 62489
127 Ga0209676_1003012 3300025292 Bacteria 10956
128 Ga0209676_1006481 3300025292 Bacteria 5765
129 Ga0209676_1012381 3300025292 Bacteria 3356
130 Ga0209676_1012770 3300025292 Bacteria 3270
131 Ga0209025_1002579 3300025294 Bacteria 18798
132 Ga0209025_1003420 3300025294 Bacteria 15056
133 Ga0209025_1020582 3300025294 Bacteria 3600
134 Ga0209564_1008102 3300025295 Bacteria 5259
135 Ga0209758_1000408 3300025297 Bacteria 73642
136 Ga0209758_1030868 3300025297 Bacteria 2210
137 Ga0209050_1000424 3300025298 Bacteria 77803
138 Ga0209050_1002116 3300025298 Bacteria 18094
139 Ga0209256_1001986 3300025299 Bacteria 18396
140 Ga0209256_1002614 3300025299 Bacteria 14244
141 Ga0209256_1005972 3300025299 Bacteria 6693
142 Ga0209051_1000809 3300025303 Bacteria 32636
143 Ga0209051_1022773 3300025303 Bacteria 2626
144 Ga0209257_1000035 3300025304 Bacteria 631463
145 Ga0209257_1000414 3300025304 Bacteria 82489
146 Ga0209257_1001475 3300025304 Bacteria 27666
147 Ga0209257_1012708 3300025304 Bacteria 3850
148 Ga0209257_1017247 3300025304 Bacteria 2858
149 Ga0207655_1050401 3300025728 Bacteria 1693
150 Ga0207713_1001387 3300025735 Bacteria 19637
151 Ga0207713_1003492 3300025735 Bacteria 10675
152 Ga0207682_10039412 3300025893 Bacteria 1921
153 Ga0207647_10011817 3300025904 Bacteria 6102
154 Ga0207647_10021906 3300025904 Bacteria 4255
155 Ga0207695_10001617 3300025913 Bacteria 36534
156 Ga0207695_10009925 3300025913 Bacteria 11699
157 Ga0207695_10024489 3300025913 Bacteria 6789
158 Ga0207671_10000009 3300025914 Bacteria 724862
159 Ga0207671_10000327 3300025914 Bacteria 69712
160 Ga0207662_10005373 3300025918 Bacteria 6824
161 Ga0207657_10027100 3300025919 Bacteria 5254
162 Ga0207649_10124953 3300025920 Bacteria 1739
163 Ga0207681_10006279 3300025923 Bacteria 7297
164 Ga0207694_10035353 3300025924 Bacteria 3832
165 Ga0207650_10002717 3300025925 Bacteria 12212
166 Ga0207650_10107187 3300025925 Bacteria 2158
167 Ga0207650_10489729 3300025925 Bacteria 1027
168 Ga0207659_10031698 3300025926 Bacteria 3622
169 Ga0207687_10203985 3300025927 Bacteria 1547
170 Ga0207644_10072150 3300025931 Bacteria 2528
171 Ga0207706_10335702 3300025933 Bacteria 1315
172 Ga0207670_10024203 3300025936 Bacteria 3793
173 Ga0207691_10057156 3300025940 Bacteria 3552
174 Ga0207711_10005954 3300025941 Bacteria 10307
175 Ga0207711_10025341 3300025941 Bacteria 4976
176 Ga0207689_10159212 3300025942 Bacteria 1861
177 Ga0207679_10036818 3300025945 Bacteria 3473
178 Ga0207667_10000063 3300025949 Bacteria 188281
179 Ga0207667_10035763 3300025949 Bacteria 5327
180 Ga0207651_10030405 3300025960 Bacteria 3438
181 Ga0207712_10086311 3300025961 Bacteria 2299
182 Ga0207668_10007764 3300025972 Bacteria 6383
183 Ga0207640_10000746 3300025981 Bacteria 18703
184 Ga0207640_10072491 3300025981 Bacteria 2324
185 Ga0207658_10071560 3300025986 Bacteria 2626
186 Ga0207703_10105125 3300026035 Bacteria 2400
187 Ga0207678_10371963 3300026067 Bacteria 1235
188 Ga0207708_10003483 3300026075 Bacteria 11606
189 Ga0207702_10000985 3300026078 Bacteria 29150
190 Ga0207641_10031430 3300026088 Bacteria 4403
191 Ga0207641_10419153 3300026088 Bacteria 1289
192 Ga0207648_10010963 3300026089 Bacteria 8562
193 Ga0207676_10004368 3300026095 Bacteria 10000
194 Ga0207674_10000123 3300026116 Bacteria 89456
195 Ga0207674_10092901 3300026116 Bacteria 3006
196 Ga0207675_100071135 3300026118 Bacteria 3252
197 Ga0209371_1000025 3300027312 Bacteria 450640
198 Ga0209970_1004485 3300027614 Bacteria 2320
199 Ga0209983_1022754 3300027665 Bacteria 1315
200 Ga0209971_1001501 3300027682 Bacteria 5789
201 Ga0268265_10005173 3300028380 Bacteria 8939
202 Ga0268264_10012065 3300028381 Bacteria 7114
203 Ga0268256_1000027 3300030500 Bacteria 450640
204 Ga0307513_10313635 3300031456 Bacteria 1329
205 Ga0307410_10129331 3300031852 Bacteria 1853
206 Ga0307406_10004711 3300031901 Bacteria 7435
207 Ga0307416_100034678 3300032002 Bacteria 3844
208 Ga0307416_100250482 3300032002 Bacteria 1723
209 Ga0307414_10001239 3300032004 Bacteria 13148
210 Ga0307414_10004652 3300032004 Bacteria 7474
211 Ga0307414_10017956 3300032004 Bacteria 4339
212 Ga0307411_10114401 3300032005 Bacteria 1938
213 Ga0307411_10131552 3300032005 Bacteria 1829
214 Ga0316574_0168259 3300035398 Bacteria 1411
215 Ga0373931_0099822 3300035691 Bacteria 1631
216 Ga0316584_0084340 3300036712 Bacteria 2380
217 Ga0395899_0000057 3300037312 Bacteria 214710
218 Ga0395899_0019444 3300037312 Bacteria 5159
219 Ga0395899_0106379 3300037312 Bacteria 2020
220 Ga0395900_0000035 3300037418 Bacteria 254301
221 Ga0395900_0018823 3300037418 Bacteria 7043
222 Ga0395898_0000045 3300037466 Bacteria 297127
223 Ga0395898_0000150 3300037466 Bacteria 181023
224 Ga0395905_0004974 3300037471 Bacteria 13689
225 Ga0395901_0036036 3300038443 Bacteria 5112
226 Ga0395901_0087858 3300038443 Bacteria 3250
227 Ga0436365_1474399 3300039437 Bacteria 3424
228 Ga0439436_0001192 3300041404 Bacteria 7385
229 Ga0439436_0001844 3300041404 Bacteria 6256
230 Ga0439436_0014671 3300041404 Bacteria 2361
231 Ga0439436_0032814 3300041404 Bacteria 1505
232 Ga0439436_0054857 3300041404 Bacteria 1120
233 Ga0439465_0000271 3300041413 Bacteria 14513
234 Ga0439465_0019999 3300041413 Bacteria 2094
235 Ga0439465_0082944 3300041413 Bacteria 1089
236 Ga0451807_2042735 3300041486 Bacteria 1638
237 Ga0439445_0001921 3300042004 Bacteria 4584
238 Ga0439445_0002572 3300042004 Bacteria 4035
239 Ga0439445_0027085 3300042004 Bacteria 1471
240 Ga0439449_0000094 3300042007 Bacteria 28713
241 Ga0439449_0002733 3300042007 Bacteria 6866
242 Ga0439449_0002838 3300042007 Bacteria 6736
243 Ga0451577_0007856 3300042876 Bacteria 10435
244 Ga0451577_0020907 3300042876 Bacteria 5999
245 Ga0451577_0193836 3300042876 Bacteria 1833
246 Ga0466969_0001986 3300044656 Bacteria 10937
247 Ga0466969_0081193 3300044656 Bacteria 1547
248 Ga0466972_0027472 3300044658 Bacteria 2814
249 Ga0466982_0000006 3300044672 Bacteria 333931
250 Ga0466966_0028677 3300044684 Bacteria 3623
251 Ga0466966_0075700 3300044684 Bacteria 2102
252 Ga0466961_0000201 3300044693 Bacteria 40285
253 Ga0466961_0000758 3300044693 Bacteria 20217
254 Ga0466961_0004623 3300044693 Bacteria 8638
255 Ga0466961_0126727 3300044693 Bacteria 1601
256 Ga0466964_0013641 3300044706 Bacteria 3083
257 Ga0466964_0032921 3300044706 Bacteria 2062
258 Ga0453684_0535231 3300044712 Bacteria 1292
259 Ga0466971_0000539 3300044719 Bacteria 15024
260 Ga0466970_0000399 3300044765 Bacteria 21121
261 Ga0466970_0054801 3300044765 Bacteria 2129
262 Ga0466957_0001246 3300044842 Bacteria 13275
263 Ga0466957_0055809 3300044842 Bacteria 2414
264 Ga0466959_0000038 3300045049 Bacteria 101314
265 Ga0466959_0002947 3300045049 Bacteria 10983
266 Ga0451576_0327842 3300045051 Bacteria 1602
267 Ga0466958_0031969 3300045836 Bacteria 3129
268 Ga0466967_0031492 3300045976 Bacteria 4465
269 Ga0495627_022468 3300046453 Bacteria 2076
270 Ga0495610_0002965 3300046512 Bacteria 13686
271 Ga0495616_0162253 3300046513 Bacteria 1004
272 Ga0495631_0010000 3300046518 Bacteria 4714
273 Ga0495598_0002801 3300046537 Bacteria 3627
274 Ga0495621_0000246 3300046539 Bacteria 12893
275 Ga0495621_0002002 3300046539 Bacteria 5370
276 Ga0495633_0006647 3300046558 Bacteria 6818
277 Ga0495656_0022257 3300046615 Bacteria 2480
278 Ga0495668_0032153 3300046616 Bacteria 2954
279 Ga0495671_0149951 3300046692 Bacteria 1135
280 Ga0495660_0035310 3300046810 Bacteria 2794
281 Ga0495636_0010028 3300047318 Bacteria 3735
282 Ga0495636_0028422 3300047318 Bacteria 2281
283 Ga0495672_0088360 3300047320 Bacteria 1708
284 Ga0495615_0032334 3300048090 Bacteria 1261
285 Ga0495615_0045625 3300048090 Bacteria 1111
286 Ga0496103_0188345 3300048906 Bacteria 1327
287 Ga0496106_0011188 3300048909 Bacteria 6640
288 Ga0496110_0098884 3300048913 Bacteria 2616
289 Ga0496112_0188638 3300048915 Bacteria 2024
290 Ga0496112_0248485 3300048915 Bacteria 1730
291 Ga0496112_0338677 3300048915 Bacteria 1448
292 Ga0496113_0151437 3300048916 Bacteria 1830
293 Ga0496114_0000853 3300048917 Bacteria 22815
294 Ga0496116_0015919 3300048919 Bacteria 5914
295 Ga0496116_0095167 3300048919 Bacteria 1798
296 Ga0496117_0001505 3300048920 Bacteria 33389
297 Ga0496117_0020497 3300048920 Bacteria 5386
298 Ga0496118_0104254 3300048921 Bacteria 1904
299 Ga0496118_0142476 3300048921 Bacteria 1516
300 Ga0496119_0000719 3300048922 Bacteria 44523
301 Ga0496119_0001745 3300048922 Bacteria 25344
302 Ga0496120_0000196 3300048923 Bacteria 103427
303 Ga0496120_0001466 3300048923 Bacteria 28121
304 Ga0496121_0018204 3300048924 Bacteria 7100
305 Ga0496121_0026151 3300048924 Bacteria 5511
306 Ga0496121_0048779 3300048924 Bacteria 3598
307 Ga0496122_0001011 3300048925 Bacteria 49773
308 Ga0496122_0006902 3300048925 Bacteria 12836
309 Ga0496122_0029410 3300048925 Bacteria 4635
310 Ga0496123_0002592 3300048926 Bacteria 21986
311 Ga0496123_0036981 3300048926 Bacteria 3453
312 Ga0496123_0037121 3300048926 Bacteria 3445
313 Ga0496124_0000219 3300048927 Bacteria 111562
314 Ga0496124_0000584 3300048927 Bacteria 61524
315 Ga0496124_0001337 3300048927 Bacteria 37033
316 Ga0496124_0007264 3300048927 Bacteria 11816
317 Ga0496124_0012154 3300048927 Bacteria 8525
318 Ga0496124_0253785 3300048927 Bacteria 1299
319 Ga0496125_0000251 3300048928 Bacteria 110300
320 Ga0496125_0000825 3300048928 Bacteria 49981
321 Ga0496125_0001438 3300048928 Bacteria 34681
322 Ga0496125_0088325 3300048928 Bacteria 2337
323 Ga0496126_0001087 3300048929 Bacteria 45711
324 Ga0496126_0006973 3300048929 Bacteria 12492
325 Ga0496126_0042046 3300048929 Bacteria 4224
326 Ga0501031_0027221 3300049568 Bacteria 3728
327 Ga0501031_0078274 3300049568 Bacteria 2154
328 Ga0501031_0106492 3300049568 Bacteria 1830
329 Ga0501032_0011165 3300049569 Bacteria 6453
330 Ga0501032_0075048 3300049569 Bacteria 2252
331 Ga0501032_0298275 3300049569 Bacteria 1042
332 Ga0501033_0010238 3300049570 Bacteria 7195
333 Ga0501033_0059658 3300049570 Bacteria 2817
334 Ga0501034_0002264 3300049571 Bacteria 23614
335 Ga0501034_0002403 3300049571 Bacteria 22668
336 Ga0501034_0087809 3300049571 Bacteria 3109
337 Ga0501034_0174456 3300049571 Bacteria 2116
338 Ga0501036_0025387 3300049572 Bacteria 4998
339 Ga0501037_0021686 3300049573 Bacteria 4750
340 Ga0501037_0120656 3300049573 Bacteria 1885
341 Ga0501038_0039625 3300049574 Bacteria 4120
342 Ga0501038_0087555 3300049574 Bacteria 2615
343 Ga0501038_0242562 3300049574 Bacteria 1430
344 Ga0501039_0019611 3300049575 Bacteria 5186
345 Ga0501039_0324751 3300049575 Bacteria 1209
346 Ga0501043_0039385 3300049579 Bacteria 3714
347 Ga0501043_0045757 3300049579 Bacteria 3441
348 Ga0501046_0324966 3300049580 Bacteria 1120
349 Ga0501047_0005616 3300049581 Bacteria 11816
350 Ga0501048_0016232 3300049582 Bacteria 5490
351 Ga0501048_0061216 3300049582 Bacteria 2666
352 Ga0501070_0038358 3300049586 Bacteria 3997
353 Ga0501080_0015725 3300049742 Bacteria 6979
354 Ga0501275_000137 3300049772 Bacteria 8171
355 Ga0501035_0006759 3300049822 Bacteria 10719
356 Ga0501035_0055813 3300049822 Bacteria 3526
357 Ga0501035_0080433 3300049822 Bacteria 2877
358 Ga0501035_0163554 3300049822 Bacteria 1925
359 Ga0501035_0234756 3300049822 Bacteria 1562
360 Ga0501044_0016710 3300049823 Bacteria 7878
361 Ga0501044_0059182 3300049823 Bacteria 3926
362 Ga0501044_0142000 3300049823 Bacteria 2389
363 nmdc:mga00v17_154784_c1 3300050491 Bacteria 1474
364 nmdc:mga00v17_574_c1 3300050491 Bacteria 20546
365 nmdc:mga00v17_86307_c1 3300050491 Bacteria 1967
366 Ga0500634_0004804 3300053161 Bacteria 6327
367 Ga0466962_0026292 3300061719 Bacteria 2794
368 Ga0466962_0158633 3300061719 Bacteria 1099

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003775 Ga0055524_1010056 Ga0055524_10100565 284
2 3300003781 Ga0055536_1014566 Ga0055536_10145663 284
3 3300003794 Ga0055531_10004504 Ga0055531_100045045 284
4 3300025273 Ga0209673_1004308 Ga0209673_10043083 284
5 3300025292 Ga0209676_1003012 Ga0209676_10030126 284
6 3300025292 Ga0209676_1012770 Ga0209676_10127703 284
7 3300025294 Ga0209025_1002579 Ga0209025_10025791 284
8 3300025297 Ga0209758_1030868 Ga0209758_10308681 284
9 3300025299 Ga0209256_1005972 Ga0209256_10059722 284
10 3300025304 Ga0209257_1000414 Ga0209257_100041467 284
11 3300025304 Ga0209257_1001475 Ga0209257_100147514 284
12 3300025304 Ga0209257_1017247 Ga0209257_10172473 284
13 3300032004 Ga0307414_10001239 Ga0307414_100012394 284
14 3300032005 Ga0307411_10114401 Ga0307411_101144011 288
15 3300049568 Ga0501031_0027221 Ga0501031_0027221_2779_3696 288
16 3300049573 Ga0501037_0120656 Ga0501037_0120656_216_1133 288
17 3300049574 Ga0501038_0242562 Ga0501038_0242562_179_1096 288
18 3300049579 Ga0501043_0039385 Ga0501043_0039385_2517_3434 288
19 3300049580 Ga0501046_0324966 Ga0501046_0324966_80_997 288
20 3300049581 Ga0501047_0005616 Ga0501047_0005616_1013_1930 288
21 3300049822 Ga0501035_0006759 Ga0501035_0006759_7481_8398 288
22 3300049823 Ga0501044_0059182 Ga0501044_0059182_1417_2334 288
23 3300032002 Ga0307416_100250482 Ga0307416_1002504821 289
24 3300025294 Ga0209025_1020582 Ga0209025_10205823 290
25 3300041404 Ga0439436_0054857 Ga0439436_0054857_61_984 290
26 3300042007 Ga0439449_0002838 Ga0439449_0002838_1821_2744 290
27 3300032005 Ga0307411_10131552 Ga0307411_101315522 291
28 3300042876 Ga0451577_0020907 Ga0451577_0020907_2281_3204 291
29 3300003781 Ga0055536_1000759 Ga0055536_10007597 292
30 3300005355 Ga0070671_100303541 Ga0070671_1003035412 292
31 3300025291 Ga0209675_1007371 Ga0209675_10073716 292
32 3300025292 Ga0209676_1000501 Ga0209676_100050114 292
33 3300048915 Ga0496112_0248485 Ga0496112_0248485_99_1043 292
34 3300009177 Ga0105248_10700582 Ga0105248_107005821 293
35 iso_pu_bacteria 2895498888 2895502852 297
36 iso_pu_bacteria 2895511927 2895512894 297
37 iso_pu_bacteria 2895522137 2895522902 297
38 iso_pu_bacteria 2895525241 2895525326 297
39 iso_pu_bacteria 2894414249 2894414329 298
40 iso_pu_bacteria 2923516293 2923519746 298
41 iso_pu_bacteria 2576861471 2578456872 299
42 iso_pu_bacteria 2852649853 2852652028 299
43 iso_pu_bacteria 2857442823 2857444288 299
44 iso_pu_bacteria 2919513703 2919515553 299
45 iso_pu_bacteria 2919675420 2919678443 299
46 iso_pu_bacteria 2941475908 2941478651 299
47 iso_pu_bacteria 2643221559 2643818209 300
48 iso_pu_bacteria 2643221586 2643937877 300
49 iso_pu_bacteria 2643221612 2644078786 300
50 iso_pu_bacteria 2643221727 2644693563 300
51 iso_pu_bacteria 2747842501 2748018757 300
52 iso_pu_bacteria 8002869464 8002870908 300
53 3300005289 Ga0065704_10072505 Ga0065704_100725056 301
54 3300005546 Ga0070696_100176574 Ga0070696_1001765742 301
55 3300006051 Ga0075364_10000199 Ga0075364_1000019919 301
56 3300009093 Ga0105240_10030882 Ga0105240_100308827 301
57 3300009545 Ga0105237_10000387 Ga0105237_1000038735 301
58 3300020082 Ga0206353_10413103 Ga0206353_104131038 301
59 3300025250 Ga0209026_1000384 Ga0209026_100038435 301
60 3300025904 Ga0207647_10021906 Ga0207647_100219065 301
61 3300025913 Ga0207695_10001617 Ga0207695_1000161729 301
62 3300025914 Ga0207671_10000327 Ga0207671_1000032712 301
63 3300025949 Ga0207667_10035763 Ga0207667_100357632 301
64 3300031456 Ga0307513_10313635 Ga0307513_103136352 301
65 3300037312 Ga0395899_0019444 Ga0395899_0019444_2389_3333 301
66 3300037418 Ga0395900_0018823 Ga0395900_0018823_4045_4989 301
67 3300037471 Ga0395905_0004974 Ga0395905_0004974_1351_2295 301
68 3300038443 Ga0395901_0036036 Ga0395901_0036036_1796_2740 301
69 3300041404 Ga0439436_0014671 Ga0439436_0014671_1324_2229 301
70 3300041486 Ga0451807_2042735 Ga0451807_2042735_653_1558 301
71 3300042004 Ga0439445_0027085 Ga0439445_0027085_332_1237 301
72 3300042007 Ga0439449_0002733 Ga0439449_0002733_3823_4728 301
73 3300046513 Ga0495616_0162253 Ga0495616_0162253_59_964 301
74 3300046692 Ga0495671_0149951 Ga0495671_0149951_59_964 301
75 3300048925 Ga0496122_0029410 Ga0496122_0029410_1703_2608 301
76 3300048926 Ga0496123_0037121 Ga0496123_0037121_180_1085 301
77 3300049568 Ga0501031_0106492 Ga0501031_0106492_823_1734 301
78 3300049569 Ga0501032_0075048 Ga0501032_0075048_877_1788 301
79 3300049570 Ga0501033_0059658 Ga0501033_0059658_795_1706 301
80 3300049574 Ga0501038_0039625 Ga0501038_0039625_353_1264 301
81 3300049575 Ga0501039_0019611 Ga0501039_0019611_3219_4130 301
82 3300049579 Ga0501043_0045757 Ga0501043_0045757_2159_3070 301
83 3300049822 Ga0501035_0055813 Ga0501035_0055813_1208_2119 301
84 3300049822 Ga0501035_0080433 Ga0501035_0080433_93_1004 301
85 3300049823 Ga0501044_0016710 Ga0501044_0016710_108_1019 301
86 3300050491 nmdc:mga00v17_574_c1 nmdc:mga00v17_574_c1_15852_16757 301
87 iso_pu_bacteria 8003014200 8003015509 301
88 3300003781 Ga0055536_1006701 Ga0055536_10067014 302
89 3300025913 Ga0207695_10024489 Ga0207695_100244891 302
90 3300031852 Ga0307410_10129331 Ga0307410_101293312 302
91 3300032004 Ga0307414_10004652 Ga0307414_100046526 302
92 3300037312 Ga0395899_0106379 Ga0395899_0106379_956_1870 302
93 3300041413 Ga0439465_0019999 Ga0439465_0019999_863_1789 302
94 3300042876 Ga0451577_0007856 Ga0451577_0007856_9318_10226 302
95 3300044712 Ga0453684_0535231 Ga0453684_0535231_149_1057 302
96 3300046616 Ga0495668_0032153 Ga0495668_0032153_38_946 302
97 3300047318 Ga0495636_0028422 Ga0495636_0028422_12_920 302
98 3300048917 Ga0496114_0000853 Ga0496114_0000853_727_1653 302
99 3300048929 Ga0496126_0006973 Ga0496126_0006973_1283_2209 302
100 3300049571 Ga0501034_0002264 Ga0501034_0002264_6072_6998 302
101 3300049571 Ga0501034_0087809 Ga0501034_0087809_2168_3082 302
102 3300049772 Ga0501275_000137 Ga0501275_000137_3602_4510 302
103 iso_pu_bacteria 2643221573 2643880397 302
104 iso_pu_bacteria 2643221579 2643906663 302
105 iso_pu_bacteria 2643221581 2643913836 302
106 iso_pu_bacteria 2643221720 2644660972 302
107 iso_pu_bacteria 2643221728 2644699054 302
108 iso_pu_bacteria 2687453130 2687584969 302
109 iso_pu_bacteria 2818991457 2819661379 302
110 3300002741 JGI25157J39369_1001284 JGI25157J39369_10012845 303
111 3300003760 Ga0055527_1000140 Ga0055527_100014023 303
112 3300003761 Ga0055535_1000147 Ga0055535_100014723 303
113 3300003762 Ga0055542_1000064 Ga0055542_100006424 303
114 3300003763 Ga0055529_1000072 Ga0055529_1000072117 303
115 3300003781 Ga0055536_1005294 Ga0055536_10052942 303
116 3300003791 Ga0055530_10003265 Ga0055530_100032658 303
117 3300003794 Ga0055531_10006858 Ga0055531_100068582 303
118 3300005563 Ga0068855_100009026 Ga0068855_1000090266 303
119 3300005578 Ga0068854_100002940 Ga0068854_1000029409 303
120 3300005614 Ga0068856_100038861 Ga0068856_1000388613 303
121 3300009011 Ga0105251_10002607 Ga0105251_100026075 303
122 3300009036 Ga0105244_10020824 Ga0105244_100208244 303
123 3300009093 Ga0105240_10051758 Ga0105240_100517584 303
124 3300015261 Ga0182006_1015236 Ga0182006_10152362 303
125 3300015265 Ga0182005_1000676 Ga0182005_100067612 303
126 3300017792 Ga0163161_10008609 Ga0163161_100086097 303
127 3300025226 Ga0209674_100111 Ga0209674_10011170 303
128 3300025228 Ga0209672_100008 Ga0209672_100008159 303
129 3300025242 Ga0209258_100004 Ga0209258_1000041031 303
130 3300025242 Ga0209258_100008 Ga0209258_100008656 303
131 3300025250 Ga0209026_1000437 Ga0209026_10004375 303
132 3300025253 Ga0209677_105507 Ga0209677_1055072 303
133 3300025254 Ga0209148_1000041 Ga0209148_1000041158 303
134 3300025256 Ga0209759_1000164 Ga0209759_100016416 303
135 3300025272 Ga0209455_1000007 Ga0209455_1000007776 303
136 3300025292 Ga0209676_1000018 Ga0209676_1000018110 303
137 3300025298 Ga0209050_1000424 Ga0209050_100042415 303
138 3300025303 Ga0209051_1000809 Ga0209051_100080912 303
139 3300025304 Ga0209257_1000035 Ga0209257_1000035110 303
140 3300025728 Ga0207655_1050401 Ga0207655_10504011 303
141 3300025735 Ga0207713_1003492 Ga0207713_100349210 303
142 3300025924 Ga0207694_10035353 Ga0207694_100353534 303
143 3300025972 Ga0207668_10007764 Ga0207668_100077645 303
144 3300026078 Ga0207702_10000985 Ga0207702_1000098525 303
145 3300037466 Ga0395898_0000045 Ga0395898_0000045_69472_70389 303
146 3300042876 Ga0451577_0193836 Ga0451577_0193836_219_1130 303
147 3300044656 Ga0466969_0001986 Ga0466969_0001986_2943_3920 303
148 3300044656 Ga0466969_0081193 Ga0466969_0081193_583_1530 303
149 3300044658 Ga0466972_0027472 Ga0466972_0027472_1518_2435 303
150 3300044672 Ga0466982_0000006 Ga0466982_0000006_173989_174906 303
151 3300044684 Ga0466966_0028677 Ga0466966_0028677_918_1835 303
152 3300044684 Ga0466966_0075700 Ga0466966_0075700_972_1949 303
153 3300044693 Ga0466961_0000201 Ga0466961_0000201_26738_27685 303
154 3300044693 Ga0466961_0000758 Ga0466961_0000758_4463_5410 303
155 3300044693 Ga0466961_0004623 Ga0466961_0004623_3631_4608 303
156 3300044693 Ga0466961_0126727 Ga0466961_0126727_489_1406 303
157 3300044706 Ga0466964_0013641 Ga0466964_0013641_1641_2558 303
158 3300044706 Ga0466964_0032921 Ga0466964_0032921_303_1250 303
159 3300044719 Ga0466971_0000539 Ga0466971_0000539_915_1832 303
160 3300044765 Ga0466970_0000399 Ga0466970_0000399_2496_3443 303
161 3300044765 Ga0466970_0054801 Ga0466970_0054801_35_952 303
162 3300044842 Ga0466957_0001246 Ga0466957_0001246_1286_2233 303
163 3300044842 Ga0466957_0055809 Ga0466957_0055809_683_1600 303
164 3300045049 Ga0466959_0000038 Ga0466959_0000038_31772_32749 303
165 3300045049 Ga0466959_0002947 Ga0466959_0002947_4346_5293 303
166 3300045836 Ga0466958_0031969 Ga0466958_0031969_1250_2167 303
167 3300045976 Ga0466967_0031492 Ga0466967_0031492_682_1629 303
168 3300046453 Ga0495627_022468 Ga0495627_022468_368_1279 303
169 3300046512 Ga0495610_0002965 Ga0495610_0002965_3075_3986 303
170 3300046518 Ga0495631_0010000 Ga0495631_0010000_478_1389 303
171 3300046810 Ga0495660_0035310 Ga0495660_0035310_165_1076 303
172 3300047320 Ga0495672_0088360 Ga0495672_0088360_79_990 303
173 3300048919 Ga0496116_0015919 Ga0496116_0015919_1263_2210 303
174 3300048919 Ga0496116_0095167 Ga0496116_0095167_323_1234 303
175 3300048920 Ga0496117_0020497 Ga0496117_0020497_3718_4629 303
176 3300048921 Ga0496118_0104254 Ga0496118_0104254_488_1399 303
177 3300048921 Ga0496118_0142476 Ga0496118_0142476_274_1185 303
178 3300048922 Ga0496119_0001745 Ga0496119_0001745_7703_8641 303
179 3300048923 Ga0496120_0000196 Ga0496120_0000196_16710_17648 303
180 3300048924 Ga0496121_0026151 Ga0496121_0026151_1856_2794 303
181 3300048924 Ga0496121_0048779 Ga0496121_0048779_245_1156 303
182 3300048925 Ga0496122_0006902 Ga0496122_0006902_655_1566 303
183 3300048926 Ga0496123_0036981 Ga0496123_0036981_24_935 303
184 3300048927 Ga0496124_0000584 Ga0496124_0000584_44568_45479 303
185 3300048927 Ga0496124_0001337 Ga0496124_0001337_3001_3912 303
186 3300048927 Ga0496124_0007264 Ga0496124_0007264_1933_2844 303
187 3300048927 Ga0496124_0012154 Ga0496124_0012154_2160_3071 303
188 3300048927 Ga0496124_0253785 Ga0496124_0253785_12_923 303
189 3300048928 Ga0496125_0000825 Ga0496125_0000825_8385_9323 303
190 3300048928 Ga0496125_0001438 Ga0496125_0001438_25264_26175 303
191 3300048928 Ga0496125_0088325 Ga0496125_0088325_788_1735 303
192 3300048929 Ga0496126_0001087 Ga0496126_0001087_16690_17628 303
193 3300049568 Ga0501031_0078274 Ga0501031_0078274_219_1142 303
194 3300049569 Ga0501032_0011165 Ga0501032_0011165_3502_4425 303
195 3300049569 Ga0501032_0298275 Ga0501032_0298275_50_967 303
196 3300049570 Ga0501033_0010238 Ga0501033_0010238_5870_6874 303
197 3300049571 Ga0501034_0174456 Ga0501034_0174456_149_1066 303
198 3300049572 Ga0501036_0025387 Ga0501036_0025387_1997_2920 303
199 3300049573 Ga0501037_0021686 Ga0501037_0021686_476_1399 303
200 3300049574 Ga0501038_0087555 Ga0501038_0087555_1217_2140 303
201 3300049575 Ga0501039_0324751 Ga0501039_0324751_159_1076 303
202 3300049582 Ga0501048_0061216 Ga0501048_0061216_455_1378 303
203 3300049586 Ga0501070_0038358 Ga0501070_0038358_2190_3113 303
204 3300049742 Ga0501080_0015725 Ga0501080_0015725_91_1014 303
205 3300049822 Ga0501035_0163554 Ga0501035_0163554_527_1450 303
206 3300049822 Ga0501035_0234756 Ga0501035_0234756_104_1021 303
207 3300049823 Ga0501044_0142000 Ga0501044_0142000_1216_2139 303
208 3300050491 nmdc:mga00v17_154784_c1 nmdc:mga00v17_154784_c1_107_1018 303
209 3300050491 nmdc:mga00v17_86307_c1 nmdc:mga00v17_86307_c1_591_1502 303
210 3300061719 Ga0466962_0026292 Ga0466962_0026292_1199_2116 303
211 3300061719 Ga0466962_0158633 Ga0466962_0158633_23_970 303
212 iso_pu_bacteria 2643221695 2644528122 303
213 iso_pu_bacteria 2842757796 2842758894 303
214 iso_pu_bacteria 2852684882 2852687249 303
215 iso_pu_bacteria 2919130084 2919130994 303
216 iso_pu_bacteria 2929195423 2929196231 303
217 iso_pu_bacteria 8021622325 8021622525 303
218 iso_pu_bacteria 8021626552 8021628665 303
219 iso_pu_bacteria 8021648035 8021650851 303
220 3300001989 JGI24739J22299_10000087 JGI24739J22299_1000008718 304
221 3300003215 JGI25153J46596_10010132 JGI25153J46596_100101325 304
222 3300003316 rootH1_10097541 rootH1_100975412 304
223 3300003761 Ga0055535_1000278 Ga0055535_100027828 304
224 3300003762 Ga0055542_1000308 Ga0055542_100030824 304
225 3300005331 Ga0070670_100347405 Ga0070670_1003474052 304
226 3300005563 Ga0068855_100092486 Ga0068855_1000924862 304
227 3300005577 Ga0068857_100001283 Ga0068857_10000128314 304
228 3300005578 Ga0068854_100038189 Ga0068854_1000381894 304
229 3300005616 Ga0068852_100038796 Ga0068852_1000387964 304
230 3300005834 Ga0068851_10000226 Ga0068851_1000022620 304
231 3300005842 Ga0068858_100054718 Ga0068858_1000547184 304
232 3300009093 Ga0105240_10005933 Ga0105240_100059339 304
233 3300009545 Ga0105237_10000212 Ga0105237_1000021240 304
234 3300010375 Ga0105239_10013080 Ga0105239_1001308010 304
235 3300012500 Ga0157314_1000003 Ga0157314_100000321 304
236 3300025242 Ga0209258_100217 Ga0209258_10021725 304
237 3300025254 Ga0209148_1000197 Ga0209148_100019724 304
238 3300025258 Ga0209129_1002281 Ga0209129_100228110 304
239 3300025294 Ga0209025_1003420 Ga0209025_10034207 304
240 3300025297 Ga0209758_1000408 Ga0209758_100040821 304
241 3300025904 Ga0207647_10011817 Ga0207647_100118172 304
242 3300025913 Ga0207695_10009925 Ga0207695_100099259 304
243 3300025914 Ga0207671_10000009 Ga0207671_10000009171 304
244 3300025925 Ga0207650_10489729 Ga0207650_104897291 304
245 3300025949 Ga0207667_10000063 Ga0207667_1000006343 304
246 3300025981 Ga0207640_10000746 Ga0207640_1000074612 304
247 3300026035 Ga0207703_10105125 Ga0207703_101051253 304
248 3300026088 Ga0207641_10419153 Ga0207641_104191532 304
249 3300026116 Ga0207674_10000123 Ga0207674_1000012339 304
250 3300027614 Ga0209970_1004485 Ga0209970_10044853 304
251 3300027665 Ga0209983_1022754 Ga0209983_10227542 304
252 3300027682 Ga0209971_1001501 Ga0209971_10015013 304
253 3300041404 Ga0439436_0001192 Ga0439436_0001192_3963_4895 304
254 3300041404 Ga0439436_0001844 Ga0439436_0001844_5143_6057 304
255 3300041413 Ga0439465_0000271 Ga0439465_0000271_8796_9728 304
256 3300041413 Ga0439465_0082944 Ga0439465_0082944_133_1047 304
257 3300042004 Ga0439445_0001921 Ga0439445_0001921_1762_2694 304
258 3300042004 Ga0439445_0002572 Ga0439445_0002572_1281_2195 304
259 3300042007 Ga0439449_0000094 Ga0439449_0000094_27405_28337 304
260 3300046539 Ga0495621_0000246 Ga0495621_0000246_4855_5772 304
261 3300046615 Ga0495656_0022257 Ga0495656_0022257_1148_2080 304
262 3300047318 Ga0495636_0010028 Ga0495636_0010028_383_1300 304
263 3300048090 Ga0495615_0032334 Ga0495615_0032334_331_1248 304
264 3300048906 Ga0496103_0188345 Ga0496103_0188345_100_1032 304
265 3300048915 Ga0496112_0338677 Ga0496112_0338677_162_1094 304
266 3300048924 Ga0496121_0018204 Ga0496121_0018204_1277_2197 304
267 3300048928 Ga0496125_0000251 Ga0496125_0000251_80596_81516 304
268 3300049571 Ga0501034_0002403 Ga0501034_0002403_11902_12816 304
269 3300003775 Ga0055524_1007011 Ga0055524_10070115 305
270 3300003791 Ga0055530_10001396 Ga0055530_100013962 305
271 3300005353 Ga0070669_100008308 Ga0070669_1000083081 305
272 3300009979 Ga0105032_100139 Ga0105032_1001396 305
273 3300021384 Ga0213876_10052435 Ga0213876_100524352 305
274 3300025292 Ga0209676_1006481 Ga0209676_10064816 305
275 3300025292 Ga0209676_1012381 Ga0209676_10123813 305
276 3300025295 Ga0209564_1008102 Ga0209564_10081023 305
277 3300025298 Ga0209050_1002116 Ga0209050_100211616 305
278 3300025299 Ga0209256_1001986 Ga0209256_10019865 305
279 3300025299 Ga0209256_1002614 Ga0209256_10026146 305
280 3300025303 Ga0209051_1022773 Ga0209051_10227733 305
281 3300025304 Ga0209257_1012708 Ga0209257_10127082 305
282 3300025923 Ga0207681_10006279 Ga0207681_100062796 305
283 3300032004 Ga0307414_10017956 Ga0307414_100179565 305
284 3300035398 Ga0316574_0168259 Ga0316574_0168259_360_1286 305
285 3300036712 Ga0316584_0084340 Ga0316584_0084340_1285_2211 305
286 3300039437 Ga0436365_1474399 Ga0436365_1474399_466_1386 305
287 3300046558 Ga0495633_0006647 Ga0495633_0006647_979_1899 305
288 3300049582 Ga0501048_0016232 Ga0501048_0016232_4464_5387 305
289 3300053161 Ga0500634_0004804 Ga0500634_0004804_3078_3998 305
290 3300003856 Ga0058692_1000028 Ga0058692_1000028170 306
291 3300005543 Ga0070672_100106060 Ga0070672_1001060602 306
292 3300027312 Ga0209371_1000025 Ga0209371_100002593 306
293 3300030500 Ga0268256_1000027 Ga0268256_100002793 306
294 2162886007 SwRhRL2b_contig_3470979 SwRhRL2b_0284.00001940 307
295 2162886012 MBSR1b_contig_6401888 MBSR1b_0677.00004930 307
296 3300005289 Ga0065704_10144331 Ga0065704_101443312 307
297 3300005293 Ga0065715_10094970 Ga0065715_100949706 307
298 3300005330 Ga0070690_100000679 Ga0070690_1000006793 307
299 3300005331 Ga0070670_100009158 Ga0070670_1000091585 307
300 3300005331 Ga0070670_100011348 Ga0070670_1000113485 307
301 3300005331 Ga0070670_100073661 Ga0070670_1000736612 307
302 3300005339 Ga0070660_100044971 Ga0070660_1000449712 307
303 3300005343 Ga0070687_100002156 Ga0070687_1000021565 307
304 3300005344 Ga0070661_100033798 Ga0070661_1000337982 307
305 3300005353 Ga0070669_100058663 Ga0070669_1000586632 307
306 3300005354 Ga0070675_100001328 Ga0070675_10000132818 307
307 3300005355 Ga0070671_100018481 Ga0070671_1000184815 307
308 3300005364 Ga0070673_100001221 Ga0070673_1000012215 307
309 3300005365 Ga0070688_100046229 Ga0070688_1000462293 307
310 3300005366 Ga0070659_100124972 Ga0070659_1001249721 307
311 3300005367 Ga0070667_100316753 Ga0070667_1003167532 307
312 3300005438 Ga0070701_10018974 Ga0070701_100189742 307
313 3300005440 Ga0070705_100028884 Ga0070705_1000288843 307
314 3300005441 Ga0070700_100002135 Ga0070700_1000021358 307
315 3300005455 Ga0070663_100181746 Ga0070663_1001817462 307
316 3300005456 Ga0070678_100030344 Ga0070678_1000303442 307
317 3300005457 Ga0070662_100321378 Ga0070662_1003213781 307
318 3300005535 Ga0070684_100000450 Ga0070684_1000004506 307
319 3300005543 Ga0070672_100041648 Ga0070672_1000416482 307
320 3300005544 Ga0070686_100000933 Ga0070686_1000009335 307
321 3300005547 Ga0070693_100038696 Ga0070693_1000386962 307
322 3300005548 Ga0070665_100015798 Ga0070665_1000157988 307
323 3300005564 Ga0070664_100001964 Ga0070664_10000196411 307
324 3300005615 Ga0070702_100054498 Ga0070702_1000544982 307
325 3300005617 Ga0068859_100006841 Ga0068859_1000068416 307
326 3300005618 Ga0068864_100000569 Ga0068864_10000056917 307
327 3300005718 Ga0068866_10042409 Ga0068866_100424092 307
328 3300005719 Ga0068861_100020202 Ga0068861_1000202027 307
329 3300005841 Ga0068863_100001625 Ga0068863_1000016256 307
330 3300005844 Ga0068862_100004773 Ga0068862_1000047738 307
331 3300006871 Ga0075434_100205832 Ga0075434_1002058322 307
332 3300006881 Ga0068865_100035116 Ga0068865_1000351163 307
333 3300006931 Ga0097620_100006841 Ga0097620_10000684110 307
334 3300009011 Ga0105251_10000155 Ga0105251_1000015511 307
335 3300009093 Ga0105240_10047398 Ga0105240_100473984 307
336 3300009148 Ga0105243_10031039 Ga0105243_100310393 307
337 3300009177 Ga0105248_10001446 Ga0105248_1000144610 307
338 3300009177 Ga0105248_10144138 Ga0105248_101441383 307
339 3300009177 Ga0105248_10350440 Ga0105248_103504401 307
340 3300009545 Ga0105237_10097696 Ga0105237_100976964 307
341 3300009553 Ga0105249_10008733 Ga0105249_100087335 307
342 3300013105 Ga0157369_10047874 Ga0157369_100478745 307
343 3300013306 Ga0163162_10083756 Ga0163162_100837562 307
344 3300013307 Ga0157372_10056422 Ga0157372_100564225 307
345 3300013308 Ga0157375_10001177 Ga0157375_1000117716 307
346 3300013308 Ga0157375_10255886 Ga0157375_102558862 307
347 3300014325 Ga0163163_10001913 Ga0163163_100019132 307
348 3300014745 Ga0157377_10018572 Ga0157377_100185723 307
349 3300015265 Ga0182005_1003051 Ga0182005_10030516 307
350 3300025735 Ga0207713_1001387 Ga0207713_10013879 307
351 3300025893 Ga0207682_10039412 Ga0207682_100394122 307
352 3300025918 Ga0207662_10005373 Ga0207662_100053733 307
353 3300025919 Ga0207657_10027100 Ga0207657_100271004 307
354 3300025920 Ga0207649_10124953 Ga0207649_101249532 307
355 3300025925 Ga0207650_10002717 Ga0207650_100027171 307
356 3300025925 Ga0207650_10107187 Ga0207650_101071872 307
357 3300025926 Ga0207659_10031698 Ga0207659_100316984 307
358 3300025927 Ga0207687_10203985 Ga0207687_102039852 307
359 3300025931 Ga0207644_10072150 Ga0207644_100721503 307
360 3300025933 Ga0207706_10335702 Ga0207706_103357022 307
361 3300025936 Ga0207670_10024203 Ga0207670_100242033 307
362 3300025940 Ga0207691_10057156 Ga0207691_100571566 307
363 3300025941 Ga0207711_10005954 Ga0207711_100059542 307
364 3300025941 Ga0207711_10025341 Ga0207711_100253415 307
365 3300025942 Ga0207689_10159212 Ga0207689_101592122 307
366 3300025945 Ga0207679_10036818 Ga0207679_100368182 307
367 3300025960 Ga0207651_10030405 Ga0207651_100304053 307
368 3300025961 Ga0207712_10086311 Ga0207712_100863112 307
369 3300025981 Ga0207640_10072491 Ga0207640_100724912 307
370 3300025986 Ga0207658_10071560 Ga0207658_100715603 307
371 3300026067 Ga0207678_10371963 Ga0207678_103719632 307
372 3300026075 Ga0207708_10003483 Ga0207708_1000348310 307
373 3300026088 Ga0207641_10031430 Ga0207641_100314305 307
374 3300026089 Ga0207648_10010963 Ga0207648_1001096310 307
375 3300026095 Ga0207676_10004368 Ga0207676_100043689 307
376 3300026116 Ga0207674_10092901 Ga0207674_100929013 307
377 3300026118 Ga0207675_100071135 Ga0207675_1000711352 307
378 3300028380 Ga0268265_10005173 Ga0268265_100051739 307
379 3300028381 Ga0268264_10012065 Ga0268264_100120658 307
380 3300031901 Ga0307406_10004711 Ga0307406_100047117 307
381 3300032002 Ga0307416_100034678 Ga0307416_1000346785 307
382 3300035691 Ga0373931_0099822 Ga0373931_0099822_508_1449 307
383 3300037312 Ga0395899_0000057 Ga0395899_0000057_157527_158516 307
384 3300037418 Ga0395900_0000035 Ga0395900_0000035_175126_176115 307
385 3300037466 Ga0395898_0000150 Ga0395898_0000150_77745_78734 307
386 3300038443 Ga0395901_0087858 Ga0395901_0087858_1837_2826 307
387 3300041404 Ga0439436_0032814 Ga0439436_0032814_306_1274 307
388 3300045051 Ga0451576_0327842 Ga0451576_0327842_616_1557 307
389 3300046537 Ga0495598_0002801 Ga0495598_0002801_1063_2007 307
390 3300046539 Ga0495621_0002002 Ga0495621_0002002_3022_3966 307
391 3300048090 Ga0495615_0045625 Ga0495615_0045625_84_1028 307
392 3300048909 Ga0496106_0011188 Ga0496106_0011188_4250_5191 307
393 3300048913 Ga0496110_0098884 Ga0496110_0098884_1309_2250 307
394 3300048915 Ga0496112_0188638 Ga0496112_0188638_99_1040 307
395 3300048916 Ga0496113_0151437 Ga0496113_0151437_550_1491 307
396 3300048920 Ga0496117_0001505 Ga0496117_0001505_21397_22320 307
397 3300048922 Ga0496119_0000719 Ga0496119_0000719_16548_17471 307
398 3300048923 Ga0496120_0001466 Ga0496120_0001466_27149_28072 307
399 3300048925 Ga0496122_0001011 Ga0496122_0001011_27869_28792 307
400 3300048926 Ga0496123_0002592 Ga0496123_0002592_82_1005 307
401 3300048927 Ga0496124_0000219 Ga0496124_0000219_16457_17380 307
402 3300048929 Ga0496126_0042046 Ga0496126_0042046_1974_2897 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01379

Porphobil_deam

Porphobilinogen deaminase, dipyromethane cofactor binding domain

5

197

0.97

PF03900

Porphobil_deamC

Porphobilinogen deaminase, C-terminal domain

208

279

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.923 2 301
5h6o-assembly1.cif.gz_A porphobilinogen deaminase from vibrio cholerae 0.9199 2 301
1ypn-assembly1.cif.gz_A reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction 0.9118 3 301
2ypn-assembly1.cif.gz_A hydroxymethylbilane synthase 0.9105 1 301
4mlq-assembly1.cif.gz_A crystal structure of bacillus megaterium porphobilinogen deaminase 0.9103 1 302
ID Description Score Start End Superfamily
5m7fA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9634 4 95 3.40.190.10
1ah5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9518 99 197 3.40.190.10
af_Q54P93_232_322_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9465 222 301 3.30.160.40
af_F1R6A1_237_360_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.9437 219 301 3.30.160.40
4fajA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.9424 1 40 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A7V9IPV6-F1-model_v4 Hydroxymethylbilane synthase 0.9657 215 303 GO:0004418
GO:0033014
AF-A0A496W235-F1-model_v4 Hydroxymethylbilane synthase 0.9656 221 302 GO:0004418
GO:0005737
GO:0006783
AF-A0A7C7MUS1-F1-model_v4 Hydroxymethylbilane synthase 0.9628 217 301 GO:0004418
GO:0005737
GO:0006783
AF-A0A645FZN3-F1-model_v4 Porphobilinogen deaminase (EC 2.5.1.61) 0.9617 225 301 GO:0004418
GO:0005737
GO:0006783
AF-X1BBZ5-F1-model_v4 Porphobilinogen deaminase C-terminal domain-containing protein 0.9613 226 301 GO:0004418
GO:0005737
GO:0006783

Feature Viewer

pLDDT pTM Quality
93.49 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map