F435125

General Info

Members Datasets Scaffolds Average Seq Length
402 150 804 162

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10032552|Ga0307413_100325522
Length 171
Sequence VADKTLSLQDQFLNSVRRSKTPVTVFLMKGVKLQGIITWFDAFSMLLRRDGAVQLLYKHAVSTIMPATPPDGLPEPALQEGKKTTLQDTFLAAAHRQQESMTLFLVNGVMLQGAVRGFDQFCLLLERGGQVQIVYKHAISTLQPAQALDLGGVQGGEGDDDGGAATEGSAA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
108 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
109 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.77
Stem 0
Stem Tuber 0.25
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10032552 3300031824 Bacteria 2957
2 MBSR1b_contig_5460102 2162886012 Bacteria 1014
3 JGI24741J21665_1002610 3300001915 Bacteria 4620
4 JGI24740J21852_10003295 3300001979 Bacteria 7118
5 JGI24740J21852_10005067 3300001979 Bacteria 5591
6 JGI24740J21852_10070202 3300001979 Bacteria 940
7 JGI24740J21852_10079282 3300001979 Bacteria 863
8 JGI24739J22299_10030140 3300001989 Bacteria 1882
9 JGI24737J22298_10008947 3300001990 Bacteria 3340
10 JGI24737J22298_10029943 3300001990 Bacteria 1705
11 JGI24735J21928_10008004 3300002067 Bacteria 3433
12 JGI24735J21928_10018906 3300002067 Bacteria 2122
13 JGI24735J21928_10088798 3300002067 Bacteria 886
14 JGI24735J21928_10093985 3300002067 Bacteria 860
15 Ga0065712_10140041 3300005290 Bacteria 1459
16 Ga0065712_10155163 3300005290 Bacteria 1340
17 Ga0065712_10296086 3300005290 Bacteria 863
18 Ga0065715_10018001 3300005293 Bacteria 2307
19 Ga0065715_10165571 3300005293 Bacteria 1590
20 Ga0065715_10564849 3300005293 Bacteria 731
21 Ga0070658_10055890 3300005327 Bacteria 3207
22 Ga0070658_10789586 3300005327 Bacteria 825
23 Ga0070658_10863569 3300005327 Bacteria 786
24 Ga0070658_11154612 3300005327 Bacteria 673
25 Ga0070676_10913404 3300005328 Bacteria 654
26 Ga0070676_11026865 3300005328 Bacteria 620
27 Ga0070683_100063373 3300005329 Bacteria 3438
28 Ga0070683_100070461 3300005329 Bacteria 3261
29 Ga0070683_100174855 3300005329 Bacteria 2038
30 Ga0070683_100549256 3300005329 Bacteria 1104
31 Ga0070670_100076340 3300005331 Bacteria 2879
32 Ga0070670_100209784 3300005331 Bacteria 1693
33 Ga0070670_100646027 3300005331 Bacteria 949
34 Ga0070677_10104830 3300005333 Bacteria 1253
35 Ga0070677_10144377 3300005333 Bacteria 1101
36 Ga0068869_100054041 3300005334 Bacteria 2922
37 Ga0068869_100540904 3300005334 Bacteria 977
38 Ga0070680_100004678 3300005336 Bacteria 10294
39 Ga0070680_100009305 3300005336 Bacteria 7544
40 Ga0070680_100050618 3300005336 Bacteria 3388
41 Ga0070680_100093797 3300005336 Bacteria 2487
42 Ga0070680_100548800 3300005336 Bacteria 990
43 Ga0070682_100020277 3300005337 Bacteria 3910
44 Ga0070682_100038318 3300005337 Bacteria 2940
45 Ga0070660_100006275 3300005339 Bacteria 8236
46 Ga0070660_100094392 3300005339 Bacteria 2363
47 Ga0070660_100282709 3300005339 Bacteria 1358
48 Ga0070660_100340317 3300005339 Bacteria 1234
49 Ga0070660_100349909 3300005339 Bacteria 1217
50 Ga0070660_100385296 3300005339 Bacteria 1157
51 Ga0070661_100017786 3300005344 Bacteria 5045
52 Ga0070661_100072793 3300005344 Bacteria 2529
53 Ga0070661_100079013 3300005344 Bacteria 2427
54 Ga0070661_100416422 3300005344 Bacteria 1064
55 Ga0070692_10193132 3300005345 Bacteria 1188
56 Ga0070692_10504514 3300005345 Bacteria 785
57 Ga0070668_100336624 3300005347 Bacteria 1274
58 Ga0070668_101577771 3300005347 Bacteria 601
59 Ga0070669_100074017 3300005353 Bacteria 2524
60 Ga0070669_100074052 3300005353 Bacteria 2524
61 Ga0070675_100222648 3300005354 Bacteria 1644
62 Ga0070675_100439486 3300005354 Bacteria 1169
63 Ga0070671_100212925 3300005355 Bacteria 1639
64 Ga0070671_100305241 3300005355 Bacteria 1355
65 Ga0070674_100539778 3300005356 Bacteria 977
66 Ga0070659_100074505 3300005366 Bacteria 2704
67 Ga0070659_100097216 3300005366 Bacteria 2366
68 Ga0070659_100127813 3300005366 Bacteria 2063
69 Ga0070659_100354424 3300005366 Bacteria 1232
70 Ga0070714_100404057 3300005435 Bacteria 1292
71 Ga0070663_100124681 3300005455 Bacteria 1950
72 Ga0070663_100332770 3300005455 Bacteria 1224
73 Ga0070663_100470394 3300005455 Bacteria 1039
74 Ga0070663_100661077 3300005455 Bacteria 885
75 Ga0070678_100397711 3300005456 Bacteria 1196
76 Ga0070678_100832048 3300005456 Bacteria 840
77 Ga0070662_100076218 3300005457 Bacteria 2485
78 Ga0070662_100081963 3300005457 Bacteria 2404
79 Ga0070662_100196751 3300005457 Bacteria 1597
80 Ga0070681_10458462 3300005458 Bacteria 1187
81 Ga0070681_10880244 3300005458 Bacteria 814
82 Ga0070685_10852542 3300005466 Bacteria 675
83 Ga0070679_100486892 3300005530 Bacteria 1178
84 Ga0070679_100811464 3300005530 Bacteria 879
85 Ga0070684_100035285 3300005535 Bacteria 4280
86 Ga0070684_100079754 3300005535 Bacteria 2894
87 Ga0070684_100085613 3300005535 Bacteria 2795
88 Ga0070684_100666319 3300005535 Bacteria 969
89 Ga0068853_100103265 3300005539 Bacteria 2523
90 Ga0068853_100107185 3300005539 Bacteria 2477
91 Ga0070672_100098588 3300005543 Bacteria 2367
92 Ga0070693_100055294 3300005547 Bacteria 2286
93 Ga0070665_100025282 3300005548 Bacteria 5982
94 Ga0070665_100103037 3300005548 Bacteria 2857
95 Ga0070704_100915086 3300005549 Bacteria 789
96 Ga0068855_100211123 3300005563 Bacteria 2181
97 Ga0070664_100022520 3300005564 Bacteria 5196
98 Ga0070664_100035373 3300005564 Bacteria 4193
99 Ga0070664_100047102 3300005564 Bacteria 3642
100 Ga0070664_100059841 3300005564 Bacteria 3242
101 Ga0070664_100398963 3300005564 Bacteria 1257
102 Ga0068857_100146774 3300005577 Bacteria 2134
103 Ga0068857_100496895 3300005577 Bacteria 1144
104 Ga0068857_100547972 3300005577 Bacteria 1089
105 Ga0068854_100020151 3300005578 Bacteria 4506
106 Ga0068854_100037342 3300005578 Bacteria 3409
107 Ga0068854_100086774 3300005578 Bacteria 2320
108 Ga0068854_100940589 3300005578 Bacteria 762
109 Ga0068854_101180812 3300005578 Bacteria 685
110 Ga0068856_100239547 3300005614 Bacteria 1830
111 Ga0068856_100367363 3300005614 Bacteria 1458
112 Ga0068852_100119850 3300005616 Bacteria 2406
113 Ga0068859_101742003 3300005617 Bacteria 688
114 Ga0068864_100168778 3300005618 Bacteria 1994
115 Ga0068851_10024724 3300005834 Bacteria 2942
116 Ga0068851_10053802 3300005834 Bacteria 2050
117 Ga0068858_100168395 3300005842 Bacteria 2065
118 Ga0097621_100246807 3300006237 Bacteria 1562
119 Ga0068871_100156725 3300006358 Bacteria 1945
120 Ga0097620_101741733 3300006931 Bacteria 688
121 Ga0105240_10152840 3300009093 Bacteria 2747
122 Ga0105240_10660058 3300009093 Bacteria 1145
123 Ga0105241_10048453 3300009174 Bacteria 3234
124 Ga0105241_10291589 3300009174 Bacteria 1397
125 Ga0105248_10114621 3300009177 Bacteria 3040
126 Ga0105248_11669463 3300009177 Bacteria 722
127 Ga0105237_10056723 3300009545 Bacteria 3920
128 Ga0105238_10020608 3300009551 Bacteria 6716
129 Ga0157373_10007643 3300013100 Bacteria 8029
130 Ga0157373_10076285 3300013100 Bacteria 2365
131 Ga0157373_10076634 3300013100 Bacteria 2359
132 Ga0157373_10093007 3300013100 Bacteria 2124
133 Ga0157373_10116908 3300013100 Bacteria 1874
134 Ga0157373_10179156 3300013100 Bacteria 1492
135 Ga0157373_10192783 3300013100 Bacteria 1436
136 Ga0157371_10035464 3300013102 Bacteria 3574
137 Ga0157371_10040108 3300013102 Bacteria 3346
138 Ga0157371_10052646 3300013102 Bacteria 2891
139 Ga0157371_10073090 3300013102 Bacteria 2428
140 Ga0157371_10087848 3300013102 Bacteria 2201
141 Ga0157371_10156348 3300013102 Bacteria 1627
142 Ga0157371_10166266 3300013102 Bacteria 1575
143 Ga0157371_10208048 3300013102 Bacteria 1403
144 Ga0157370_10119968 3300013104 Bacteria 2455
145 Ga0157370_10215395 3300013104 Bacteria 1779
146 Ga0157370_10276623 3300013104 Bacteria 1551
147 Ga0157370_10772951 3300013104 Bacteria 875
148 Ga0157369_10006781 3300013105 Bacteria 13211
149 Ga0157369_10182399 3300013105 Bacteria 2208
150 Ga0157369_10828786 3300013105 Bacteria 950
151 Ga0157369_11050208 3300013105 Bacteria 833
152 Ga0163162_10163897 3300013306 Bacteria 2346
153 Ga0157372_10282891 3300013307 Bacteria 1928
154 Ga0157372_10555102 3300013307 Bacteria 1339
155 Ga0157372_10922580 3300013307 Bacteria 1013
156 Ga0157372_11224087 3300013307 Bacteria 867
157 Ga0157375_10011820 3300013308 Bacteria 7719
158 Ga0157375_10084640 3300013308 Bacteria 3220
159 Ga0163163_10209259 3300014325 Bacteria 1999
160 Ga0157380_10012472 3300014326 Bacteria 6166
161 Ga0157380_10054515 3300014326 Bacteria 3173
162 Ga0157380_10175168 3300014326 Bacteria 1879
163 Ga0157379_10972074 3300014968 Bacteria 808
164 Ga0163161_10004933 3300017792 Bacteria 9282
165 Ga0206354_10677733 3300020081 Bacteria 783
166 Ga0207656_10011782 3300025321 Bacteria 3309
167 Ga0207656_10017469 3300025321 Bacteria 2812
168 Ga0207688_10367127 3300025901 Bacteria 889
169 Ga0207688_10380593 3300025901 Bacteria 873
170 Ga0207647_10001941 3300025904 Bacteria 15811
171 Ga0207647_10024422 3300025904 Bacteria 3985
172 Ga0207647_10057355 3300025904 Bacteria 2387
173 Ga0207643_10054435 3300025908 Bacteria 2274
174 Ga0207643_10082551 3300025908 Bacteria 1863
175 Ga0207705_10005902 3300025909 Bacteria 9107
176 Ga0207705_10100948 3300025909 Bacteria 2122
177 Ga0207705_10223067 3300025909 Bacteria 1432
178 Ga0207705_10580554 3300025909 Bacteria 871
179 Ga0207693_10028136 3300025915 Bacteria 4441
180 Ga0207660_10035665 3300025917 Bacteria 3454
181 Ga0207660_10060771 3300025917 Bacteria 2718
182 Ga0207660_10285374 3300025917 Bacteria 1311
183 Ga0207660_10529738 3300025917 Bacteria 957
184 Ga0207657_10000827 3300025919 Bacteria 32729
185 Ga0207657_10029152 3300025919 Bacteria 5028
186 Ga0207657_10087728 3300025919 Bacteria 2602
187 Ga0207657_10104369 3300025919 Bacteria 2348
188 Ga0207657_10139647 3300025919 Bacteria 1980
189 Ga0207649_10024094 3300025920 Bacteria 3533
190 Ga0207649_10037232 3300025920 Bacteria 2937
191 Ga0207649_10398646 3300025920 Bacteria 1029
192 Ga0207652_10120274 3300025921 Bacteria 2336
193 Ga0207652_10418725 3300025921 Bacteria 1208
194 Ga0207652_10838084 3300025921 Bacteria 815
195 Ga0207652_11593943 3300025921 Bacteria 557
196 Ga0207681_10230655 3300025923 Bacteria 1437
197 Ga0207694_10092831 3300025924 Bacteria 2383
198 Ga0207650_10034268 3300025925 Bacteria 3682
199 Ga0207650_10447188 3300025925 Bacteria 1075
200 Ga0207659_10174252 3300025926 Bacteria 1699
201 Ga0207644_10112371 3300025931 Bacteria 2062
202 Ga0207690_10019834 3300025932 Bacteria 4144
203 Ga0207690_10049357 3300025932 Bacteria 2805
204 Ga0207690_10115898 3300025932 Bacteria 1937
205 Ga0207690_10157734 3300025932 Bacteria 1689
206 Ga0207690_10376277 3300025932 Bacteria 1128
207 Ga0207690_10443441 3300025932 Bacteria 1042
208 Ga0207690_10457839 3300025932 Bacteria 1026
209 Ga0207706_10001415 3300025933 Bacteria 24005
210 Ga0207706_10050803 3300025933 Bacteria 3663
211 Ga0207706_10160644 3300025933 Bacteria 1975
212 Ga0207706_10991574 3300025933 Bacteria 706
213 Ga0207691_10057701 3300025940 Bacteria 3532
214 Ga0207711_10145303 3300025941 Bacteria 2137
215 Ga0207689_10146683 3300025942 Bacteria 1944
216 Ga0207661_10003254 3300025944 Bacteria 11259
217 Ga0207661_10109413 3300025944 Bacteria 2334
218 Ga0207661_10208400 3300025944 Bacteria 1722
219 Ga0207661_10293909 3300025944 Bacteria 1455
220 Ga0207661_10458664 3300025944 Bacteria 1161
221 Ga0207679_10054277 3300025945 Bacteria 2949
222 Ga0207679_10055127 3300025945 Bacteria 2929
223 Ga0207679_10073381 3300025945 Bacteria 2589
224 Ga0207679_10162327 3300025945 Bacteria 1830
225 Ga0207679_10270489 3300025945 Bacteria 1453
226 Ga0207679_10389525 3300025945 Bacteria 1223
227 Ga0207679_11197127 3300025945 Bacteria 697
228 Ga0207667_10017849 3300025949 Bacteria 7977
229 Ga0207667_10226831 3300025949 Bacteria 1913
230 Ga0207651_10511391 3300025960 Bacteria 1040
231 Ga0207668_10096785 3300025972 Bacteria 2183
232 Ga0207703_10664770 3300026035 Bacteria 989
233 Ga0207639_10074887 3300026041 Bacteria 2660
234 Ga0207639_10329401 3300026041 Bacteria 1358
235 Ga0207678_10008982 3300026067 Bacteria 8796
236 Ga0207678_10031328 3300026067 Bacteria 4639
237 Ga0207678_10054839 3300026067 Bacteria 3433
238 Ga0207678_10106779 3300026067 Bacteria 2388
239 Ga0207678_10250804 3300026067 Bacteria 1516
240 Ga0207702_10094059 3300026078 Bacteria 2630
241 Ga0207702_10221177 3300026078 Bacteria 1764
242 Ga0207702_10484826 3300026078 Bacteria 1204
243 Ga0207648_10331169 3300026089 Bacteria 1370
244 Ga0207674_10001776 3300026116 Bacteria 27533
245 Ga0207674_10013717 3300026116 Bacteria 8972
246 Ga0207674_10033165 3300026116 Bacteria 5407
247 Ga0207674_10095219 3300026116 Bacteria 2964
248 Ga0207683_10211642 3300026121 Bacteria 1765
249 Ga0207683_11016441 3300026121 Bacteria 769
250 Ga0207698_10002079 3300026142 Bacteria 11802
251 Ga0207698_10003442 3300026142 Bacteria 9530
252 Ga0207698_10008841 3300026142 Bacteria 6385
253 Ga0207698_10155267 3300026142 Bacteria 1993
254 Ga0207698_10310208 3300026142 Bacteria 1473
255 Ga0207698_10386858 3300026142 Bacteria 1332
256 Ga0207698_11653372 3300026142 Bacteria 656
257 Ga0209967_1039091 3300027364 Bacteria 719
258 Ga0209983_1015503 3300027665 Bacteria 1573
259 Ga0209974_10011750 3300027876 Bacteria 2936
260 Ga0209974_10048793 3300027876 Bacteria 1420
261 Ga0268266_10020422 3300028379 Bacteria 5645
262 Ga0268266_10053280 3300028379 Bacteria 3475
263 Ga0316177_1071430 3300030731 Bacteria 883
264 Ga0316176_1093634 3300030732 Bacteria 981
265 Ga0316178_1085417 3300030735 Bacteria 835
266 Ga0307408_100124838 3300031548 Bacteria 2000
267 Ga0307408_100270868 3300031548 Bacteria 1410
268 Ga0307408_100564797 3300031548 Bacteria 1006
269 Ga0307408_101705010 3300031548 Bacteria 600
270 Ga0307405_10053132 3300031731 Bacteria 2522
271 Ga0307405_10081529 3300031731 Bacteria 2115
272 Ga0307405_10153727 3300031731 Bacteria 1621
273 Ga0307405_10279459 3300031731 Bacteria 1256
274 Ga0307413_10043130 3300031824 Bacteria 2656
275 Ga0307413_10100917 3300031824 Bacteria 1907
276 Ga0307413_10104176 3300031824 Bacteria 1883
277 Ga0307413_10104823 3300031824 Bacteria 1878
278 Ga0307413_10191988 3300031824 Bacteria 1467
279 Ga0307410_10000926 3300031852 Bacteria 12543
280 Ga0307410_10033361 3300031852 Bacteria 3323
281 Ga0307410_10212624 3300031852 Bacteria 1483
282 Ga0307410_10448167 3300031852 Bacteria 1052
283 Ga0307410_11567253 3300031852 Bacteria 581
284 Ga0307406_10082305 3300031901 Bacteria 2143
285 Ga0307406_10265131 3300031901 Bacteria 1302
286 Ga0307406_10407855 3300031901 Bacteria 1079
287 Ga0307406_11166953 3300031901 Bacteria 667
288 Ga0307407_10043431 3300031903 Bacteria 2527
289 Ga0307407_10083941 3300031903 Bacteria 1934
290 Ga0307407_10089494 3300031903 Bacteria 1883
291 Ga0307407_10112255 3300031903 Bacteria 1713
292 Ga0307407_10128161 3300031903 Bacteria 1619
293 Ga0307407_10179704 3300031903 Bacteria 1401
294 Ga0307407_10279918 3300031903 Bacteria 1155
295 Ga0307407_10729119 3300031903 Bacteria 749
296 Ga0307412_10196068 3300031911 Bacteria 1530
297 Ga0307412_10296391 3300031911 Bacteria 1276
298 Ga0307412_10301286 3300031911 Bacteria 1267
299 Ga0307412_10969486 3300031911 Bacteria 749
300 Ga0307409_100018749 3300031995 Bacteria 4663
301 Ga0307409_100029938 3300031995 Bacteria 3904
302 Ga0307409_100068305 3300031995 Bacteria 2810
303 Ga0307409_100250614 3300031995 Bacteria 1619
304 Ga0307409_100310439 3300031995 Bacteria 1471
305 Ga0307416_100096891 3300032002 Bacteria 2552
306 Ga0307416_100207990 3300032002 Bacteria 1864
307 Ga0307416_100243196 3300032002 Bacteria 1745
308 Ga0307416_100483179 3300032002 Bacteria 1299
309 Ga0307416_100946224 3300032002 Bacteria 963
310 Ga0307414_10012570 3300032004 Bacteria 5011
311 Ga0307414_10074024 3300032004 Bacteria 2466
312 Ga0307414_10213596 3300032004 Bacteria 1579
313 Ga0307414_10286353 3300032004 Bacteria 1387
314 Ga0307414_10382138 3300032004 Bacteria 1218
315 Ga0307414_10578693 3300032004 Bacteria 1004
316 Ga0307414_10789367 3300032004 Bacteria 865
317 Ga0307411_10045431 3300032005 Bacteria 2825
318 Ga0307411_10045808 3300032005 Bacteria 2815
319 Ga0307411_10048989 3300032005 Bacteria 2742
320 Ga0307411_10181088 3300032005 Bacteria 1599
321 Ga0307411_10734023 3300032005 Bacteria 863
322 Ga0307411_10889416 3300032005 Bacteria 790
323 Ga0307415_100218338 3300032126 Bacteria 1526
324 Ga0307415_100262469 3300032126 Bacteria 1410
325 Ga0307415_100323010 3300032126 Bacteria 1288
326 Ga0373923_0178066 3300035111 Bacteria 976
327 Ga0373943_0256631 3300035170 Bacteria 983
328 Ga0373935_0020536 3300035692 Bacteria 4037
329 Ga0395899_0028864 3300037312 Bacteria 4175
330 Ga0395899_0081069 3300037312 Bacteria 2361
331 Ga0395899_0289556 3300037312 Bacteria 1111
332 Ga0395899_0341140 3300037312 Bacteria 1004
333 Ga0395899_0415337 3300037312 Bacteria 887
334 Ga0395899_0790357 3300037312 Bacteria 587
335 Ga0395900_0000814 3300037418 Bacteria 41259
336 Ga0395900_0120519 3300037418 Bacteria 2692
337 Ga0395900_0144895 3300037418 Bacteria 2429
338 Ga0395900_0153976 3300037418 Bacteria 2348
339 Ga0395900_0263411 3300037418 Bacteria 1721
340 Ga0395900_0276485 3300037418 Bacteria 1672
341 Ga0395900_0636193 3300037418 Bacteria 1004
342 Ga0395900_1123503 3300037418 Bacteria 703
343 Ga0395898_0022903 3300037466 Bacteria 6316
344 Ga0395898_0068551 3300037466 Bacteria 3433
345 Ga0395898_0074083 3300037466 Bacteria 3289
346 Ga0395898_0113380 3300037466 Bacteria 2598
347 Ga0395898_1350355 3300037466 Bacteria 641
348 Ga0395905_0016184 3300037471 Bacteria 7088
349 Ga0395905_0018900 3300037471 Bacteria 6535
350 Ga0395905_0045915 3300037471 Bacteria 4097
351 Ga0395905_0078790 3300037471 Bacteria 3088
352 Ga0395905_0136271 3300037471 Bacteria 2309
353 Ga0395905_0347986 3300037471 Bacteria 1374
354 Ga0395905_0377042 3300037471 Bacteria 1312
355 Ga0395905_0456122 3300037471 Bacteria 1176
356 Ga0395905_0620058 3300037471 Bacteria 983
357 Ga0395905_0670104 3300037471 Bacteria 939
358 Ga0395905_0701640 3300037471 Bacteria 914
359 Ga0395905_1172685 3300037471 Bacteria 672
360 Ga0395905_1384872 3300037471 Bacteria 607
361 Ga0395901_0140304 3300038443 Bacteria 2540
362 Ga0395901_0544674 3300038443 Bacteria 1176
363 Ga0395901_1354641 3300038443 Bacteria 671
364 Ga0395901_1510064 3300038443 Bacteria 627
365 Ga0439432_026713 3300042006 Bacteria 1889
366 Ga0451577_0327376 3300042876 Bacteria 1390
367 Ga0466972_0083223 3300044658 Bacteria 1522
368 Ga0466963_0011561 3300044694 Bacteria 5374
369 Ga0466963_0032860 3300044694 Bacteria 3363
370 Ga0466963_0558378 3300044694 Bacteria 808
371 Ga0453684_1477712 3300044712 Bacteria 702
372 Ga0466957_0002219 3300044842 Bacteria 10414
373 Ga0466957_0227224 3300044842 Bacteria 1234
374 Ga0466958_0000273 3300045836 Bacteria 19923
375 Ga0466958_0294025 3300045836 Bacteria 1042
376 Ga0466967_0003472 3300045976 Bacteria 10291
377 Ga0466967_0082324 3300045976 Bacteria 2908
378 Ga0466967_0297939 3300045976 Bacteria 1551
379 Ga0466967_0327010 3300045976 Bacteria 1480
380 Ga0466967_0512132 3300045976 Bacteria 1178
381 Ga0466967_0540396 3300045976 Bacteria 1146
382 Ga0466967_0591844 3300045976 Bacteria 1094
383 Ga0466967_1175486 3300045976 Bacteria 764
384 Ga0495669_0068824 3300046684 Bacteria 1611
385 Ga0495669_0206578 3300046684 Bacteria 940
386 Ga0496100_1595227 3300048903 Bacteria 516
387 Ga0496101_0119542 3300048904 Bacteria 1991
388 Ga0496102_0224567 3300048905 Bacteria 1771
389 Ga0496108_0942052 3300048911 Bacteria 740
390 Ga0496109_0049904 3300048912 Bacteria 3811
391 Ga0496109_0207421 3300048912 Bacteria 1843
392 Ga0496110_0026901 3300048913 Bacteria 4927
393 Ga0496110_0064355 3300048913 Bacteria 3241
394 Ga0496111_0074176 3300048914 Bacteria 2478
395 Ga0496113_0565353 3300048916 Bacteria 912
396 Ga0496114_0000021 3300048917 Bacteria 227038
397 Ga0496114_0062297 3300048917 Bacteria 3122
398 Ga0501223_060671 3300049663 Bacteria 739
399 Ga0501212_105195 3300049851 Bacteria 534
400 Ga0466962_0036451 3300061719 Bacteria 2354
401 Ga0466962_0523920 3300061719 Bacteria 601
402 2885428177 2885427238 Bacteria 2291351
403 Ga0307413_10032552
404 MBSR1b_contig_5460102
405 JGI24741J21665_1002610
406 JGI24740J21852_10003295
407 JGI24740J21852_10005067
408 JGI24740J21852_10070202
409 JGI24740J21852_10079282
410 JGI24739J22299_10030140
411 JGI24737J22298_10008947
412 JGI24737J22298_10029943
413 JGI24735J21928_10008004
414 JGI24735J21928_10018906
415 JGI24735J21928_10088798
416 JGI24735J21928_10093985
417 Ga0065712_10140041
418 Ga0065712_10155163
419 Ga0065712_10296086
420 Ga0065715_10018001
421 Ga0065715_10165571
422 Ga0065715_10564849
423 Ga0070658_10055890
424 Ga0070658_10789586
425 Ga0070658_10863569
426 Ga0070658_11154612
427 Ga0070676_10913404
428 Ga0070676_11026865
429 Ga0070683_100063373
430 Ga0070683_100070461
431 Ga0070683_100174855
432 Ga0070683_100549256
433 Ga0070670_100076340
434 Ga0070670_100209784
435 Ga0070670_100646027
436 Ga0070677_10104830
437 Ga0070677_10144377
438 Ga0068869_100054041
439 Ga0068869_100540904
440 Ga0070680_100004678
441 Ga0070680_100009305
442 Ga0070680_100050618
443 Ga0070680_100093797
444 Ga0070680_100548800
445 Ga0070682_100020277
446 Ga0070682_100038318
447 Ga0070660_100006275
448 Ga0070660_100094392
449 Ga0070660_100282709
450 Ga0070660_100340317
451 Ga0070660_100349909
452 Ga0070660_100385296
453 Ga0070661_100017786
454 Ga0070661_100072793
455 Ga0070661_100079013
456 Ga0070661_100416422
457 Ga0070692_10193132
458 Ga0070692_10504514
459 Ga0070668_100336624
460 Ga0070668_101577771
461 Ga0070669_100074017
462 Ga0070669_100074052
463 Ga0070675_100222648
464 Ga0070675_100439486
465 Ga0070671_100212925
466 Ga0070671_100305241
467 Ga0070674_100539778
468 Ga0070659_100074505
469 Ga0070659_100097216
470 Ga0070659_100127813
471 Ga0070659_100354424
472 Ga0070714_100404057
473 Ga0070663_100124681
474 Ga0070663_100332770
475 Ga0070663_100470394
476 Ga0070663_100661077
477 Ga0070678_100397711
478 Ga0070678_100832048
479 Ga0070662_100076218
480 Ga0070662_100081963
481 Ga0070662_100196751
482 Ga0070681_10458462
483 Ga0070681_10880244
484 Ga0070685_10852542
485 Ga0070679_100486892
486 Ga0070679_100811464
487 Ga0070684_100035285
488 Ga0070684_100079754
489 Ga0070684_100085613
490 Ga0070684_100666319
491 Ga0068853_100103265
492 Ga0068853_100107185
493 Ga0070672_100098588
494 Ga0070693_100055294
495 Ga0070665_100025282
496 Ga0070665_100103037
497 Ga0070704_100915086
498 Ga0068855_100211123
499 Ga0070664_100022520
500 Ga0070664_100035373
501 Ga0070664_100047102
502 Ga0070664_100059841
503 Ga0070664_100398963
504 Ga0068857_100146774
505 Ga0068857_100496895
506 Ga0068857_100547972
507 Ga0068854_100020151
508 Ga0068854_100037342
509 Ga0068854_100086774
510 Ga0068854_100940589
511 Ga0068854_101180812
512 Ga0068856_100239547
513 Ga0068856_100367363
514 Ga0068852_100119850
515 Ga0068859_101742003
516 Ga0068864_100168778
517 Ga0068851_10024724
518 Ga0068851_10053802
519 Ga0068858_100168395
520 Ga0097621_100246807
521 Ga0068871_100156725
522 Ga0097620_101741733
523 Ga0105240_10152840
524 Ga0105240_10660058
525 Ga0105241_10048453
526 Ga0105241_10291589
527 Ga0105248_10114621
528 Ga0105248_11669463
529 Ga0105237_10056723
530 Ga0105238_10020608
531 Ga0157373_10007643
532 Ga0157373_10076285
533 Ga0157373_10076634
534 Ga0157373_10093007
535 Ga0157373_10116908
536 Ga0157373_10179156
537 Ga0157373_10192783
538 Ga0157371_10035464
539 Ga0157371_10040108
540 Ga0157371_10052646
541 Ga0157371_10073090
542 Ga0157371_10087848
543 Ga0157371_10156348
544 Ga0157371_10166266
545 Ga0157371_10208048
546 Ga0157370_10119968
547 Ga0157370_10215395
548 Ga0157370_10276623
549 Ga0157370_10772951
550 Ga0157369_10006781
551 Ga0157369_10182399
552 Ga0157369_10828786
553 Ga0157369_11050208
554 Ga0163162_10163897
555 Ga0157372_10282891
556 Ga0157372_10555102
557 Ga0157372_10922580
558 Ga0157372_11224087
559 Ga0157375_10011820
560 Ga0157375_10084640
561 Ga0163163_10209259
562 Ga0157380_10012472
563 Ga0157380_10054515
564 Ga0157380_10175168
565 Ga0157379_10972074
566 Ga0163161_10004933
567 Ga0206354_10677733
568 Ga0207656_10011782
569 Ga0207656_10017469
570 Ga0207688_10367127
571 Ga0207688_10380593
572 Ga0207647_10001941
573 Ga0207647_10024422
574 Ga0207647_10057355
575 Ga0207643_10054435
576 Ga0207643_10082551
577 Ga0207705_10005902
578 Ga0207705_10100948
579 Ga0207705_10223067
580 Ga0207705_10580554
581 Ga0207693_10028136
582 Ga0207660_10035665
583 Ga0207660_10060771
584 Ga0207660_10285374
585 Ga0207660_10529738
586 Ga0207657_10000827
587 Ga0207657_10029152
588 Ga0207657_10087728
589 Ga0207657_10104369
590 Ga0207657_10139647
591 Ga0207649_10024094
592 Ga0207649_10037232
593 Ga0207649_10398646
594 Ga0207652_10120274
595 Ga0207652_10418725
596 Ga0207652_10838084
597 Ga0207652_11593943
598 Ga0207681_10230655
599 Ga0207694_10092831
600 Ga0207650_10034268
601 Ga0207650_10447188
602 Ga0207659_10174252
603 Ga0207644_10112371
604 Ga0207690_10019834
605 Ga0207690_10049357
606 Ga0207690_10115898
607 Ga0207690_10157734
608 Ga0207690_10376277
609 Ga0207690_10443441
610 Ga0207690_10457839
611 Ga0207706_10001415
612 Ga0207706_10050803
613 Ga0207706_10160644
614 Ga0207706_10991574
615 Ga0207691_10057701
616 Ga0207711_10145303
617 Ga0207689_10146683
618 Ga0207661_10003254
619 Ga0207661_10109413
620 Ga0207661_10208400
621 Ga0207661_10293909
622 Ga0207661_10458664
623 Ga0207679_10054277
624 Ga0207679_10055127
625 Ga0207679_10073381
626 Ga0207679_10162327
627 Ga0207679_10270489
628 Ga0207679_10389525
629 Ga0207679_11197127
630 Ga0207667_10017849
631 Ga0207667_10226831
632 Ga0207651_10511391
633 Ga0207668_10096785
634 Ga0207703_10664770
635 Ga0207639_10074887
636 Ga0207639_10329401
637 Ga0207678_10008982
638 Ga0207678_10031328
639 Ga0207678_10054839
640 Ga0207678_10106779
641 Ga0207678_10250804
642 Ga0207702_10094059
643 Ga0207702_10221177
644 Ga0207702_10484826
645 Ga0207648_10331169
646 Ga0207674_10001776
647 Ga0207674_10013717
648 Ga0207674_10033165
649 Ga0207674_10095219
650 Ga0207683_10211642
651 Ga0207683_11016441
652 Ga0207698_10002079
653 Ga0207698_10003442
654 Ga0207698_10008841
655 Ga0207698_10155267
656 Ga0207698_10310208
657 Ga0207698_10386858
658 Ga0207698_11653372
659 Ga0209967_1039091
660 Ga0209983_1015503
661 Ga0209974_10011750
662 Ga0209974_10048793
663 Ga0268266_10020422
664 Ga0268266_10053280
665 Ga0316177_1071430
666 Ga0316176_1093634
667 Ga0316178_1085417
668 Ga0307408_100124838
669 Ga0307408_100270868
670 Ga0307408_100564797
671 Ga0307408_101705010
672 Ga0307405_10053132
673 Ga0307405_10081529
674 Ga0307405_10153727
675 Ga0307405_10279459
676 Ga0307413_10043130
677 Ga0307413_10100917
678 Ga0307413_10104176
679 Ga0307413_10104823
680 Ga0307413_10191988
681 Ga0307410_10000926
682 Ga0307410_10033361
683 Ga0307410_10212624
684 Ga0307410_10448167
685 Ga0307410_11567253
686 Ga0307406_10082305
687 Ga0307406_10265131
688 Ga0307406_10407855
689 Ga0307406_11166953
690 Ga0307407_10043431
691 Ga0307407_10083941
692 Ga0307407_10089494
693 Ga0307407_10112255
694 Ga0307407_10128161
695 Ga0307407_10179704
696 Ga0307407_10279918
697 Ga0307407_10729119
698 Ga0307412_10196068
699 Ga0307412_10296391
700 Ga0307412_10301286
701 Ga0307412_10969486
702 Ga0307409_100018749
703 Ga0307409_100029938
704 Ga0307409_100068305
705 Ga0307409_100250614
706 Ga0307409_100310439
707 Ga0307416_100096891
708 Ga0307416_100207990
709 Ga0307416_100243196
710 Ga0307416_100483179
711 Ga0307416_100946224
712 Ga0307414_10012570
713 Ga0307414_10074024
714 Ga0307414_10213596
715 Ga0307414_10286353
716 Ga0307414_10382138
717 Ga0307414_10578693
718 Ga0307414_10789367
719 Ga0307411_10045431
720 Ga0307411_10045808
721 Ga0307411_10048989
722 Ga0307411_10181088
723 Ga0307411_10734023
724 Ga0307411_10889416
725 Ga0307415_100218338
726 Ga0307415_100262469
727 Ga0307415_100323010
728 Ga0373923_0178066
729 Ga0373943_0256631
730 Ga0373935_0020536
731 Ga0395899_0028864
732 Ga0395899_0081069
733 Ga0395899_0289556
734 Ga0395899_0341140
735 Ga0395899_0415337
736 Ga0395899_0790357
737 Ga0395900_0000814
738 Ga0395900_0120519
739 Ga0395900_0144895
740 Ga0395900_0153976
741 Ga0395900_0263411
742 Ga0395900_0276485
743 Ga0395900_0636193
744 Ga0395900_1123503
745 Ga0395898_0022903
746 Ga0395898_0068551
747 Ga0395898_0074083
748 Ga0395898_0113380
749 Ga0395898_1350355
750 Ga0395905_0016184
751 Ga0395905_0018900
752 Ga0395905_0045915
753 Ga0395905_0078790
754 Ga0395905_0136271
755 Ga0395905_0347986
756 Ga0395905_0377042
757 Ga0395905_0456122
758 Ga0395905_0620058
759 Ga0395905_0670104
760 Ga0395905_0701640
761 Ga0395905_1172685
762 Ga0395905_1384872
763 Ga0395901_0140304
764 Ga0395901_0544674
765 Ga0395901_1354641
766 Ga0395901_1510064
767 Ga0439432_026713
768 Ga0451577_0327376
769 Ga0466972_0083223
770 Ga0466963_0011561
771 Ga0466963_0032860
772 Ga0466963_0558378
773 Ga0453684_1477712
774 Ga0466957_0002219
775 Ga0466957_0227224
776 Ga0466958_0000273
777 Ga0466958_0294025
778 Ga0466967_0003472
779 Ga0466967_0082324
780 Ga0466967_0297939
781 Ga0466967_0327010
782 Ga0466967_0512132
783 Ga0466967_0540396
784 Ga0466967_0591844
785 Ga0466967_1175486
786 Ga0495669_0068824
787 Ga0495669_0206578
788 Ga0496100_1595227
789 Ga0496101_0119542
790 Ga0496102_0224567
791 Ga0496108_0942052
792 Ga0496109_0049904
793 Ga0496109_0207421
794 Ga0496110_0026901
795 Ga0496110_0064355
796 Ga0496111_0074176
797 Ga0496113_0565353
798 Ga0496114_0000021
799 Ga0496114_0062297
800 Ga0501223_060671
801 Ga0501212_105195
802 Ga0466962_0036451
803 Ga0466962_0523920
804 2885428177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17209

Hfq

Hfq protein

8

71

0.98

PF17209

Hfq

Hfq protein

86

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gwk-assembly4.cif.gz_W the crystal structure of hfq from caulobacter crescentus 1.002 8 70
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 1.001 9 66
6gwk-assembly2.cif.gz_G the crystal structure of hfq from caulobacter crescentus 0.9972 9 68
4jrk-assembly1.cif.gz_C-2 crystal structure of escherichia coli hfq surface mutant 0.994 10 70
4juv-assembly1.cif.gz_F crystal structure of escherichia coli hfq distal face 1 mutant 0.9933 10 71
ID Description Score Start End Superfamily
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.9921 9 66 2.30.30.100
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.9733 89 153 2.30.30.100
3hfnB00 Mainly Beta;Roll;SH3 type barrels.; 0.9605 11 69 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.9438 9 66 2.30.30.100
af_Q2FXT3_1_64_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9358 35 59 2.40.50.140
ID Description Score Start End GO Terms
AF-R7L4Y8-F1-model_v4 deleted 1.004 11 68
AF-A0A4R0X453-F1-model_v4 RNA chaperone Hfq 1.003 92 147 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974
AF-B2VAE5-F1-model_v4 deleted 1.001 8 69
AF-A0A1Z8S0Q2-F1-model_v4 RNA chaperone Hfq 0.9963 11 71 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974
AF-R8UHF6-F1-model_v4 deleted 0.9939 7 66

Map