F435099

General Info

Members Datasets Scaffolds Average Seq Length
402 240 342 334

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10075243|Ga0224712_100752431
Length 399
Sequence MFSALIKNYSKIAQSSSFLAPTSSRFFSAAKVANPQQLNTGKQAKKAPALKVALFSSQPYDRRSFDAVNEKYGFELIYHPAPLNAKAAALTEGVDAVCAFVNDAIDASVLKTMHEQGVKAVALRCAGFNNVDLEVAKLLGIEVSRVPAYSPEAVAEHAIALAMTLNRRTHKAFNRVREGNFALEGLLGFTLHGKTAGVVGTGKIGLATAKILKGFGCRVIAYDPYCSEEFKAIGTPVSLEELLKESDIVTLHCPLMPQTHHMFDDAAFKMMKKGAMLINTSRGGLVDTGAAIKALKSKHLGGLAIDVYEQESNLFFRDLSGDIIEDDVFERLMTFPNVLVTGHQGFFTQEALSEIAEVTLSNLSCLANNIPCGNALVHRGTKPVHTVGAAAEAAQKAKI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
3 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
6 2643221645 Massilia sp. Root351 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
9 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
10 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
11 2738541284 Pedobacter sp. YR016 Isolate Unclassified
12 2738541300 Massilia sp. GV016 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543023 Pedobacter sp. OK628 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2739367656 Pedobacter sp. CF523 Isolate Unclassified
17 2739367663 Pedobacter sp. YR510 Isolate Unclassified
18 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
19 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
20 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
21 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
22 2821131069 Duganella sp. 1224 Isolate Unclassified
23 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
26 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
27 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
28 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
29 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
30 2857558681 Duganella sp. R-74565 Isolate Unclassified
31 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
32 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
33 2904424332 Duganella sp. 1411 Isolate Rhizosphere
34 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
35 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
36 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
37 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
38 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
39 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
40 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
41 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
42 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
43 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
44 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
45 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
46 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
47 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
48 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
49 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
50 2952252522 Salinicola sp. DM10 Isolate Unclassified
51 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
52 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
53 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
54 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
55 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
56 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
57 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
58 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
61 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
62 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
63 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
66 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
67 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
68 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
69 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
239 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
240 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.83
Metatranscriptomes 1.24
Isolates 14.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 16.67
Nodule 1.74
Rhizoplane 1.49
Rhizosphere 54.98
Stem 0
Stem Tuber 0
Unclassified 24.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_952651 2162886007 Bacteria 31811
2 JGI25154J39366_1001055 3300002738 Bacteria 10927
3 JGI25152J39213_1000371 3300002773 Bacteria 27576
4 JGI25152J39213_1012715 3300002773 Bacteria 1790
5 JGI25150J39212_1000002 3300002774 Bacteria 537631
6 JGI25151J46595_10000003 3300003187 Bacteria 715330
7 JGI25153J46596_10000003 3300003215 Bacteria 553253
8 JGI25153J46596_10031375 3300003215 Bacteria 1790
9 rootH2_10030707 3300003320 Bacteria 10843
10 rootH2_10269479 3300003320 Bacteria 1486
11 rootL2_10008326 3300003322 Bacteria 12118
12 rootL2_10288228 3300003322 Bacteria 1266
13 rootH1_10049738 3300003323 Bacteria 1313
14 rootH1_10290814 3300003323 Bacteria 3646
15 Ga0055529_1000414 3300003763 Bacteria 44462
16 Ga0055526_1000042 3300003771 Bacteria 124886
17 Ga0055526_1000125 3300003771 Bacteria 67941
18 Ga0055526_1006141 3300003771 Bacteria 6617
19 Ga0055537_1000169 3300003773 Bacteria 48599
20 Ga0055537_1001004 3300003773 Bacteria 12769
21 Ga0055524_1016034 3300003775 Bacteria 2706
22 Ga0055536_1000012 3300003781 Bacteria 263217
23 Ga0055536_1003383 3300003781 Bacteria 8600
24 Ga0055536_1007706 3300003781 Bacteria 4769
25 Ga0055534_1000404 3300003784 Bacteria 26598
26 Ga0055530_10000025 3300003791 Bacteria 130359
27 Ga0055530_10001875 3300003791 Bacteria 14448
28 Ga0055530_10005870 3300003791 Bacteria 5674
29 Ga0055531_10010018 3300003794 Bacteria 4769
30 Ga0055531_10017057 3300003794 Bacteria 3089
31 Ga0058692_1000564 3300003856 Bacteria 15780
32 Ga0065165_1002332 3300005262 Bacteria 16563
33 Ga0065714_10002370 3300005288 Bacteria 35316
34 Ga0065714_10090291 3300005288 Bacteria 1949
35 Ga0065704_10000237 3300005289 Bacteria 90089
36 Ga0065704_10080703 3300005289 Bacteria 3896
37 Ga0070658_10007267 3300005327 Bacteria 8944
38 Ga0068869_100229498 3300005334 Bacteria 1474
39 Ga0070680_100014731 3300005336 Bacteria 6116
40 Ga0070660_100002811 3300005339 Bacteria 11975
41 Ga0070660_100042524 3300005339 Unclassified 3468
42 Ga0070659_100036834 3300005366 Unclassified 3814
43 Ga0070663_100007390 3300005455 Bacteria 6684
44 Ga0070678_100339316 3300005456 Bacteria 1288
45 Ga0068867_100026300 3300005459 Bacteria 4178
46 Ga0068867_100073954 3300005459 Bacteria 2553
47 Ga0070679_100009232 3300005530 Bacteria 9320
48 Ga0070679_100016287 3300005530 Bacteria 7164
49 Ga0070679_100154146 3300005530 Bacteria 2273
50 Ga0070665_100085930 3300005548 Bacteria 3152
51 Ga0068855_100067082 3300005563 Bacteria 4182
52 Ga0068854_100395768 3300005578 Unclassified 1142
53 Ga0068856_100073444 3300005614 Bacteria 3387
54 Ga0068852_100002781 3300005616 Bacteria 12117
55 Ga0068852_100008040 3300005616 Bacteria 7738
56 Ga0068863_100607583 3300005841 Bacteria 1083
57 Ga0068858_100117451 3300005842 Bacteria 2486
58 Ga0068860_100141742 3300005843 Bacteria 2311
59 Ga0081539_10019925 3300005985 Bacteria 4565
60 Ga0097621_100302841 3300006237 Bacteria 1412
61 Ga0068871_100067479 3300006358 Bacteria 2934
62 Ga0079104_1000021 3300006946 Bacteria 247219
63 Ga0079104_1000065 3300006946 Bacteria 158192
64 Ga0105251_10000086 3300009011 Bacteria 88725
65 Ga0105251_10000109 3300009011 Bacteria 81396
66 Ga0105251_10015386 3300009011 Bacteria 4185
67 Ga0105244_10004177 3300009036 Bacteria 10048
68 Ga0105250_10000059 3300009092 Bacteria 109549
69 Ga0105240_10013397 3300009093 Bacteria 11260
70 Ga0105237_10006879 3300009545 Bacteria 12536
71 Ga0105249_10010399 3300009553 Bacteria 8177
72 Ga0105239_10055383 3300010375 Unclassified 4349
73 Ga0157373_10000021 3300013100 Bacteria 165522
74 Ga0157373_10056949 3300013100 Bacteria 2773
75 Ga0157371_10001017 3300013102 Bacteria 30742
76 Ga0157371_10001503 3300013102 Bacteria 24118
77 Ga0157371_10017401 3300013102 Bacteria 5341
78 Ga0157371_10093090 3300013102 Bacteria 2135
79 Ga0157370_10006973 3300013104 Bacteria 12340
80 Ga0157370_10019521 3300013104 Bacteria 6795
81 Ga0157370_10019651 3300013104 Bacteria 6766
82 Ga0163162_10072271 3300013306 Bacteria 3505
83 Ga0163162_10129865 3300013306 Bacteria 2628
84 Ga0163162_10131680 3300013306 Bacteria 2609
85 Ga0163162_10386950 3300013306 Bacteria 1532
86 Ga0157372_10043573 3300013307 Bacteria 4968
87 Ga0157372_10069117 3300013307 Bacteria 3972
88 Ga0157372_10153329 3300013307 Unclassified 2660
89 Ga0157375_10071695 3300013308 Bacteria 3479
90 Ga0157375_10174574 3300013308 Unclassified 2298
91 Ga0182008_10000017 3300014497 Bacteria 235130
92 Ga0157376_10057318 3300014969 Bacteria 3258
93 Ga0157376_10078796 3300014969 Bacteria 2822
94 Ga0157376_10145749 3300014969 Unclassified 2129
95 Ga0157376_10502337 3300014969 Bacteria 1192
96 Ga0182006_1000051 3300015261 Bacteria 183089
97 Ga0182006_1001464 3300015261 Bacteria 14221
98 Ga0182006_1002565 3300015261 Bacteria 9842
99 Ga0182006_1004287 3300015261 Bacteria 7057
100 Ga0182006_1012620 3300015261 Bacteria 3694
101 Ga0182005_1000410 3300015265 Bacteria 23273
102 Ga0182005_1003968 3300015265 Bacteria 4880
103 Ga0163161_10001410 3300017792 Bacteria 17753
104 Ga0163161_10011481 3300017792 Bacteria 6146
105 Ga0163161_10023225 3300017792 Bacteria 4373
106 Ga0163161_10025517 3300017792 Bacteria 4182
107 Ga0163161_10060994 3300017792 Bacteria 2746
108 Ga0163161_10112319 3300017792 Bacteria 2038
109 Ga0163161_10179040 3300017792 Bacteria 1624
110 Ga0206349_1366757 3300020075 Unclassified 1318
111 Ga0206351_10745931 3300020077 Bacteria 1331
112 Ga0206353_10807783 3300020082 Bacteria 1246
113 Ga0213872_10000420 3300021361 Bacteria 34732
114 Ga0213872_10007808 3300021361 Bacteria 5227
115 Ga0224712_10075243 3300022467 Bacteria 1381
116 Ga0224712_10096110 3300022467 Bacteria 1249
117 Ga0209437_101775 3300025233 Bacteria 4673
118 Ga0207425_1000004 3300025245 Bacteria 1092421
119 Ga0209646_1000097 3300025246 Bacteria 181432
120 Ga0209129_1000005 3300025258 Bacteria 777812
121 Ga0209129_1002802 3300025258 Bacteria 8105
122 Ga0209565_1000014 3300025263 Bacteria 530302
123 Ga0209565_1000081 3300025263 Bacteria 155639
124 Ga0209455_1000047 3300025272 Bacteria 379709
125 Ga0209673_1000484 3300025273 Bacteria 66361
126 Ga0209675_1001577 3300025291 Bacteria 12908
127 Ga0209676_1000001 3300025292 Bacteria 1852142
128 Ga0209676_1000093 3300025292 Bacteria 250231
129 Ga0209676_1000225 3300025292 Bacteria 124018
130 Ga0209676_1001452 3300025292 Bacteria 22273
131 Ga0209676_1003114 3300025292 Bacteria 10656
132 Ga0209025_1000009 3300025294 Bacteria 1092561
133 Ga0209025_1005863 3300025294 Bacteria 9822
134 Ga0209564_1000032 3300025295 Bacteria 464041
135 Ga0209564_1000464 3300025295 Bacteria 67994
136 Ga0209564_1000547 3300025295 Bacteria 60759
137 Ga0209758_1000010 3300025297 Bacteria 1092782
138 Ga0209758_1000928 3300025297 Bacteria 39646
139 Ga0209050_1000018 3300025298 Bacteria 723263
140 Ga0209050_1000201 3300025298 Bacteria 134028
141 Ga0209050_1001448 3300025298 Bacteria 25493
142 Ga0209050_1039031 3300025298 Bacteria 1344
143 Ga0209256_1001381 3300025299 Bacteria 25407
144 Ga0209051_1005647 3300025303 Bacteria 7244
145 Ga0209257_1000208 3300025304 Bacteria 141393
146 Ga0209257_1007544 3300025304 Bacteria 6532
147 Ga0209257_1008238 3300025304 Bacteria 6002
148 Ga0207696_1000005 3300025711 Bacteria 642078
149 Ga0207655_1022575 3300025728 Bacteria 3148
150 Ga0207713_1000002 3300025735 Bacteria 1061749
151 Ga0207713_1000003 3300025735 Bacteria 860698
152 Ga0207705_10004729 3300025909 Bacteria 10259
153 Ga0207705_10005862 3300025909 Bacteria 9144
154 Ga0207660_10022286 3300025917 Bacteria 4267
155 Ga0207657_10020541 3300025919 Bacteria 6238
156 Ga0207657_10081135 3300025919 Bacteria 2725
157 Ga0207657_10108193 3300025919 Bacteria 2298
158 Ga0207652_10006816 3300025921 Bacteria 9207
159 Ga0207690_10218994 3300025932 Unclassified 1456
160 Ga0207689_10245246 3300025942 Bacteria 1481
161 Ga0207667_10134050 3300025949 Bacteria 2551
162 Ga0207712_10269272 3300025961 Bacteria 1385
163 Ga0207668_10263974 3300025972 Bacteria 1404
164 Ga0207678_10005084 3300026067 Bacteria 11794
165 Ga0207702_10020982 3300026078 Bacteria 5406
166 Ga0207648_10098633 3300026089 Bacteria 2558
167 Ga0207674_10109990 3300026116 Bacteria 2731
168 Ga0207683_10047630 3300026121 Bacteria 3754
169 Ga0207683_10171085 3300026121 Bacteria 1967
170 Ga0207698_10079625 3300026142 Bacteria 2636
171 Ga0207698_10267788 3300026142 Unclassified 1573
172 Ga0209281_1000001 3300027111 Bacteria 1933496
173 Ga0209281_1000050 3300027111 Bacteria 320102
174 Ga0209371_1000004 3300027312 Bacteria 1098197
175 Ga0209371_1005039 3300027312 Bacteria 5437
176 Ga0268256_1000005 3300030500 Bacteria 1082342
177 Ga0268256_1004862 3300030500 Bacteria 5437
178 Ga0316183_1055730 3300030742 Bacteria 30787
179 Ga0316183_1148384 3300030742 Bacteria 4112
180 Ga0316181_1005186 3300030744 Bacteria 15670
181 Ga0316181_1228120 3300030744 Bacteria 2883
182 Ga0316181_1288521 3300030744 Bacteria 1628
183 Ga0316182_1320828 3300030745 Bacteria 4466
184 Ga0316182_1433444 3300030745 Bacteria 2823
185 Ga0265327_10005855 3300031251 Bacteria 10057
186 Ga0307405_10139503 3300031731 Bacteria 1688
187 Ga0307412_10000214 3300031911 Bacteria 39283
188 Ga0307412_10000601 3300031911 Bacteria 21257
189 Ga0307414_10000192 3300032004 Bacteria 41192
190 Ga0307414_10001039 3300032004 Bacteria 14204
191 Ga0307414_10045696 3300032004 Bacteria 3001
192 Ga0307414_10053648 3300032004 Bacteria 2813
193 Ga0373927_0070694 3300035695 Bacteria 2259
194 Ga0373933_0235794 3300035724 Bacteria 1176
195 Ga0395899_0031400 3300037312 Bacteria 3991
196 Ga0395898_0010978 3300037466 Bacteria 9441
197 Ga0395901_0010319 3300038443 Bacteria 9461
198 Ga0436361_0036409 3300039447 Bacteria 23805
199 Ga0436361_0643651 3300039447 Bacteria 9114
200 Ga0436361_0803316 3300039447 Bacteria 5949
201 Ga0451841_0253590 3300041498 Bacteria 2987
202 Ga0439432_006246 3300042006 Bacteria 4263
203 Ga0439452_000002 3300042010 Bacteria 1377577
204 Ga0439446_0001961 3300042156 Bacteria 4857
205 Ga0466974_0000298 3300044660 Eukaryota 14426
206 Ga0466970_0022245 3300044765 Bacteria 3309
207 Ga0495617_000593 3300046452 Bacteria 18444
208 Ga0495590_0000011 3300046457 Bacteria 307470
209 Ga0495638_0000080 3300046460 Bacteria 155967
210 Ga0495638_0001449 3300046460 Bacteria 21460
211 Ga0495638_0016741 3300046460 Bacteria 4901
212 Ga0495650_0000748 3300046471 Bacteria 40639
213 Ga0495580_0322764 3300046472 Bacteria 1049
214 Ga0495607_0000295 3300046501 Bacteria 52177
215 Ga0495607_0006453 3300046501 Bacteria 8254
216 Ga0495583_0000076 3300046506 Bacteria 174154
217 Ga0495606_0000188 3300046507 Bacteria 108100
218 Ga0495606_0000251 3300046507 Bacteria 94515
219 Ga0495606_0000452 3300046507 Bacteria 67182
220 Ga0495606_0001662 3300046507 Bacteria 28894
221 Ga0495606_0007441 3300046507 Bacteria 9797
222 Ga0495606_0047092 3300046507 Bacteria 2845
223 Ga0495606_0113015 3300046507 Bacteria 1635
224 Ga0495610_0002267 3300046512 Bacteria 16255
225 Ga0495610_0014293 3300046512 Bacteria 4671
226 Ga0495610_0039394 3300046512 Bacteria 2390
227 Ga0495616_0026371 3300046513 Bacteria 3094
228 Ga0495631_0001762 3300046518 Bacteria 12834
229 Ga0495637_0007857 3300046520 Bacteria 5262
230 Ga0495643_0000119 3300046522 Bacteria 127740
231 Ga0495643_0001267 3300046522 Bacteria 24200
232 Ga0495648_0000010 3300046524 Bacteria 307259
233 Ga0495663_0001201 3300046525 Bacteria 8340
234 Ga0495663_0001683 3300046525 Bacteria 6894
235 Ga0495642_0000269 3300046528 Bacteria 29337
236 Ga0495642_0113574 3300046528 Bacteria 1159
237 Ga0495622_0000012 3300046557 Bacteria 189011
238 Ga0495622_0001291 3300046557 Bacteria 12854
239 Ga0495622_0079983 3300046557 Bacteria 1504
240 Ga0495622_0084583 3300046557 Bacteria 1459
241 Ga0495633_0000076 3300046558 Bacteria 129915
242 Ga0495633_0000830 3300046558 Bacteria 27272
243 Ga0495633_0000986 3300046558 Bacteria 23373
244 Ga0495633_0005337 3300046558 Bacteria 7881
245 Ga0495633_0092190 3300046558 Bacteria 1408
246 Ga0495667_0178139 3300046559 Unclassified 1365
247 Ga0495668_0000045 3300046616 Bacteria 225145
248 Ga0495668_0000110 3300046616 Bacteria 132291
249 Ga0495625_0000365 3300046660 Bacteria 69161
250 Ga0495625_0009297 3300046660 Bacteria 8238
251 Ga0495625_0025216 3300046660 Bacteria 4512
252 Ga0495625_0070633 3300046660 Bacteria 2451
253 Ga0495671_0023576 3300046692 Bacteria 3214
254 Ga0495660_0001909 3300046810 Bacteria 13617
255 Ga0495660_0003654 3300046810 Bacteria 9472
256 Ga0495672_0000113 3300047320 Bacteria 129189
257 Ga0495672_0001346 3300047320 Bacteria 24356
258 Ga0495687_014842 3300047443 Bacteria 3984
259 Ga0495677_0042125 3300047445 Bacteria 1672
260 Ga0495677_0076532 3300047445 Bacteria 1251
261 Ga0495686_0012674 3300047472 Bacteria 5892
262 Ga0496103_0001490 3300048906 Bacteria 15648
263 Ga0496104_0061663 3300048907 Bacteria 3555
264 Ga0496105_0051051 3300048908 Bacteria 3417
265 Ga0496114_0174146 3300048917 Bacteria 1877
266 Ga0496116_0002334 3300048919 Bacteria 20087
267 Ga0496116_0002534 3300048919 Bacteria 19133
268 Ga0496116_0119519 3300048919 Bacteria 1528
269 Ga0496117_0001068 3300048920 Bacteria 41562
270 Ga0496117_0001484 3300048920 Bacteria 33643
271 Ga0496117_0003922 3300048920 Bacteria 16848
272 Ga0496117_0004623 3300048920 Bacteria 14996
273 Ga0496118_0001160 3300048921 Bacteria 40619
274 Ga0496118_0001249 3300048921 Bacteria 39060
275 Ga0496118_0003682 3300048921 Bacteria 19006
276 Ga0496118_0006497 3300048921 Bacteria 12817
277 Ga0496118_0021720 3300048921 Bacteria 5638
278 Ga0496118_0026218 3300048921 Bacteria 4971
279 Ga0496118_0035907 3300048921 Bacteria 4016
280 Ga0496119_0000929 3300048922 Bacteria 37913
281 Ga0496119_0003450 3300048922 Bacteria 16412
282 Ga0496120_0000943 3300048923 Bacteria 39981
283 Ga0496120_0002180 3300048923 Bacteria 20766
284 Ga0496121_0001922 3300048924 Bacteria 33169
285 Ga0496121_0015610 3300048924 Bacteria 7931
286 Ga0496122_0000112 3300048925 Bacteria 187099
287 Ga0496122_0001959 3300048925 Bacteria 30816
288 Ga0496122_0002318 3300048925 Bacteria 27475
289 Ga0496122_0003950 3300048925 Bacteria 18945
290 Ga0496122_0004091 3300048925 Bacteria 18478
291 Ga0496122_0007511 3300048925 Bacteria 12089
292 Ga0496122_0017121 3300048925 Bacteria 6798
293 Ga0496122_0031549 3300048925 Bacteria 4407
294 Ga0496122_0102684 3300048925 Bacteria 1905
295 Ga0496123_0001677 3300048926 Bacteria 29647
296 Ga0496123_0002372 3300048926 Bacteria 23618
297 Ga0496123_0003084 3300048926 Bacteria 19139
298 Ga0496123_0023397 3300048926 Bacteria 4729
299 Ga0496123_0039186 3300048926 Bacteria 3317
300 Ga0496123_0042499 3300048926 Bacteria 3135
301 Ga0496124_0001753 3300048927 Bacteria 30327
302 Ga0496124_0001946 3300048927 Bacteria 28229
303 Ga0496124_0004289 3300048927 Bacteria 16749
304 Ga0496124_0013367 3300048927 Bacteria 8016
305 Ga0496124_0017951 3300048927 Bacteria 6648
306 Ga0496124_0024842 3300048927 Bacteria 5439
307 Ga0496124_0033206 3300048927 Bacteria 4541
308 Ga0496124_0045553 3300048927 Bacteria 3759
309 Ga0496124_0082843 3300048927 Bacteria 2632
310 Ga0496125_0003620 3300048928 Bacteria 18553
311 Ga0496125_0005409 3300048928 Bacteria 14225
312 Ga0496125_0005558 3300048928 Bacteria 13942
313 Ga0496125_0006517 3300048928 Bacteria 12592
314 Ga0496125_0026067 3300048928 Bacteria 5338
315 Ga0496125_0119916 3300048928 Bacteria 1879
316 Ga0496126_0004357 3300048929 Bacteria 16974
317 Ga0496126_0007866 3300048929 Bacteria 11609
318 Ga0496126_0008339 3300048929 Bacteria 11182
319 Ga0496126_0104923 3300048929 Bacteria 2469
320 Ga0495678_000111 3300049459 Bacteria 97182
321 Ga0495678_028531 3300049459 Bacteria 2353
322 Ga0501034_0000416 3300049571 Bacteria 71648
323 Ga0501034_0002009 3300049571 Bacteria 25673
324 Ga0501034_0007563 3300049571 Bacteria 11562
325 Ga0501037_0422651 3300049573 Bacteria 912
326 Ga0501043_0139617 3300049579 Bacteria 1898
327 Ga0501047_0163045 3300049581 Bacteria 2101
328 Ga0501269_000048 3300049766 Bacteria 37893
329 nmdc:mga00v17_449_c1 3300050491 Bacteria 23134
330 nmdc:mga00v17_52634_c1 3300050491 Bacteria 2478
331 nmdc:mga0k408_55484_c1 3300050493 Bacteria 2297
332 Ga0500644_0001979 3300053088 Bacteria 5225
333 Ga0500651_0000910 3300053093 Bacteria 14480
334 Ga0500562_000051 3300053108 Bacteria 59249
335 Ga0500559_0008635 3300053136 Bacteria 4455
336 Ga0500577_0005917 3300053142 Bacteria 3334
337 Ga0500604_0000588 3300053151 Bacteria 9971
338 Ga0500622_0001262 3300053156 Bacteria 20657
339 Ga0500622_0001361 3300053156 Bacteria 19740
340 Ga0500622_0066923 3300053156 Bacteria 1823
341 Ga0500645_055648 3300053730 Bacteria 1149
342 Ga0500661_011910 3300055283 Bacteria 1573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0178139 Ga0495667_0178139_33_866 274
2 3300049573 Ga0501037_0422651 Ga0501037_0422651_56_889 274
3 3300049579 Ga0501043_0139617 Ga0501043_0139617_1054_1887 274
4 3300047445 Ga0495677_0076532 Ga0495677_0076532_15_863 279
5 3300005339 Ga0070660_100042524 Ga0070660_1000425242 294
6 3300005366 Ga0070659_100036834 Ga0070659_1000368342 294
7 3300005530 Ga0070679_100016287 Ga0070679_1000162875 294
8 3300025919 Ga0207657_10020541 Ga0207657_100205413 294
9 3300025932 Ga0207690_10218994 Ga0207690_102189942 295
10 3300046460 Ga0495638_0016741 Ga0495638_0016741_724_1743 317
11 iso_pu_bacteria 2842903701 2842907057 317
12 3300046460 Ga0495638_0000080 Ga0495638_0000080_10494_11486 318
13 3300046557 Ga0495622_0001291 Ga0495622_0001291_1454_2446 318
14 3300046558 Ga0495633_0000076 Ga0495633_0000076_118430_119422 318
15 3300030742 Ga0316183_1055730 Ga0316183_105573021 321
16 3300030744 Ga0316181_1005186 Ga0316181_10051869 321
17 3300030744 Ga0316181_1288521 Ga0316181_12885212 321
18 3300030745 Ga0316182_1320828 Ga0316182_13208282 321
19 iso_pu_bacteria 2952252522 2952255126 321
20 iso_pu_bacteria 2513237088 2513598186 322
21 iso_pu_bacteria 2576861471 2578459150 322
22 iso_pu_bacteria 2600255292 2601668647 322
23 iso_pu_bacteria 2643221645 2644252200 322
24 iso_pu_bacteria 2643221664 2644360857 322
25 iso_pu_bacteria 2738541300 2738843643 322
26 iso_pu_bacteria 2738543018 2739275283 322
27 iso_pu_bacteria 2738543030 2739344327 322
28 iso_pu_bacteria 2747842428 2747949917 322
29 iso_pu_bacteria 2765235840 2765578165 322
30 iso_pu_bacteria 2816332141 2816516230 322
31 iso_pu_bacteria 2821131069 2821134725 322
32 iso_pu_bacteria 2842391507 2842393585 322
33 iso_pu_bacteria 2842747753 2842753092 322
34 iso_pu_bacteria 2842757796 2842759391 322
35 iso_pu_bacteria 2852649853 2852651506 322
36 iso_pu_bacteria 2857442823 2857443018 322
37 iso_pu_bacteria 2857547612 2857551341 322
38 iso_pu_bacteria 2857558681 2857560644 322
39 iso_pu_bacteria 2874220319 2874220821 322
40 iso_pu_bacteria 2904424332 2904430074 322
41 iso_pu_bacteria 2919089067 2919090851 322
42 iso_pu_bacteria 2919134579 2919136959 322
43 iso_pu_bacteria 2928496128 2928496835 322
44 iso_pu_bacteria 2931380184 2931381557 322
45 iso_pu_bacteria 2932410948 2932414200 322
46 iso_pu_bacteria 2932416698 2932416809 322
47 iso_pu_bacteria 2939622612 2939626393 322
48 iso_pu_bacteria 2939626828 2939627586 322
49 iso_pu_bacteria 2941475908 2941476938 322
50 iso_pu_bacteria 2961047084 2961047586 322
51 iso_pu_bacteria 2961064222 2961068416 322
52 iso_pu_bacteria 2974307012 2974309587 322
53 iso_pu_bacteria 2977247770 2977250325 322
54 iso_pu_bacteria 2984514374 2984515200 322
55 iso_pu_bacteria 3005445848 3005449100 322
56 iso_pu_bacteria 8046767195 8046771367 322
57 iso_pu_bacteria 8057160832 8057163470 322
58 iso_pu_bacteria 8057575449 8057578349 322
59 iso_pu_bacteria 2554235234 2555258150 323
60 iso_pu_bacteria 2671180115 2671585765 323
61 iso_pu_bacteria 2690315857 2691331820 323
62 iso_pu_bacteria 2711768156 2712469713 323
63 iso_pu_bacteria 2738541284 2738763707 323
64 iso_pu_bacteria 2738543023 2739301463 323
65 iso_pu_bacteria 2739367656 2739614279 323
66 iso_pu_bacteria 2739367663 2739646008 323
67 iso_pu_bacteria 2775506987 2776614854 323
68 iso_pu_bacteria 2857627736 2857630095 323
69 iso_pu_bacteria 2919108558 2919109389 323
70 iso_pu_bacteria 2919534386 2919537113 323
71 iso_pu_bacteria 2929154850 2929158523 323
72 iso_pu_bacteria 2939568625 2939569095 323
73 iso_pu_bacteria 2939669807 2939671359 323
74 iso_pu_bacteria 2971820967 2971823945 323
75 iso_pu_bacteria 3000376612 3000379236 323
76 3300046457 Ga0495590_0000011 Ga0495590_0000011_192980_193972 324
77 3300046471 Ga0495650_0000748 Ga0495650_0000748_10130_11122 324
78 3300046501 Ga0495607_0000295 Ga0495607_0000295_23324_24316 324
79 3300046506 Ga0495583_0000076 Ga0495583_0000076_61214_62206 324
80 3300046507 Ga0495606_0000188 Ga0495606_0000188_17516_18508 324
81 3300046524 Ga0495648_0000010 Ga0495648_0000010_88601_89593 324
82 3300046528 Ga0495642_0000269 Ga0495642_0000269_10435_11427 324
83 3300046616 Ga0495668_0000045 Ga0495668_0000045_174036_175028 324
84 3300046660 Ga0495625_0000365 Ga0495625_0000365_57683_58675 324
85 3300046810 Ga0495660_0001909 Ga0495660_0001909_3114_4106 324
86 3300047443 Ga0495687_014842 Ga0495687_014842_895_1887 324
87 3300049459 Ga0495678_028531 Ga0495678_028531_534_1526 324
88 3300050493 nmdc:mga0k408_55484_c1 nmdc:mga0k408_55484_c1_877_1869 324
89 3300003771 Ga0055526_1000125 Ga0055526_100012570 325
90 3300025295 Ga0209564_1000464 Ga0209564_10004644 325
91 3300046507 Ga0495606_0000251 Ga0495606_0000251_33070_34062 325
92 3300046507 Ga0495606_0000452 Ga0495606_0000452_11412_12401 325
93 3300046512 Ga0495610_0014293 Ga0495610_0014293_311_1303 325
94 3300046616 Ga0495668_0000110 Ga0495668_0000110_40030_41022 325
95 3300047472 Ga0495686_0012674 Ga0495686_0012674_2850_3842 325
96 3300049571 Ga0501034_0000416 Ga0501034_0000416_20247_21251 325
97 3300002738 JGI25154J39366_1001055 JGI25154J39366_10010552 326
98 3300002773 JGI25152J39213_1012715 JGI25152J39213_10127152 326
99 3300003215 JGI25153J46596_10031375 JGI25153J46596_100313752 326
100 3300003320 rootH2_10269479 rootH2_102694792 326
101 3300003322 rootL2_10008326 rootL2_1000832611 326
102 3300003323 rootH1_10049738 rootH1_100497382 326
103 3300003763 Ga0055529_1000414 Ga0055529_100041415 326
104 3300003771 Ga0055526_1000042 Ga0055526_100004274 326
105 3300003771 Ga0055526_1006141 Ga0055526_10061413 326
106 3300003773 Ga0055537_1000169 Ga0055537_100016929 326
107 3300003775 Ga0055524_1016034 Ga0055524_10160342 326
108 3300003781 Ga0055536_1003383 Ga0055536_10033832 326
109 3300003781 Ga0055536_1007706 Ga0055536_10077064 326
110 3300003784 Ga0055534_1000404 Ga0055534_100040421 326
111 3300003791 Ga0055530_10001875 Ga0055530_1000187518 326
112 3300003794 Ga0055531_10010018 Ga0055531_100100184 326
113 3300003794 Ga0055531_10017057 Ga0055531_100170572 326
114 3300003856 Ga0058692_1000564 Ga0058692_10005642 326
115 3300005327 Ga0070658_10007267 Ga0070658_100072675 326
116 3300005336 Ga0070680_100014731 Ga0070680_1000147317 326
117 3300005339 Ga0070660_100002811 Ga0070660_1000028119 326
118 3300005455 Ga0070663_100007390 Ga0070663_1000073905 326
119 3300005530 Ga0070679_100009232 Ga0070679_1000092328 326
120 3300005530 Ga0070679_100154146 Ga0070679_1001541462 326
121 3300005548 Ga0070665_100085930 Ga0070665_1000859302 326
122 3300005563 Ga0068855_100067082 Ga0068855_1000670823 326
123 3300005578 Ga0068854_100395768 Ga0068854_1003957681 326
124 3300005614 Ga0068856_100073444 Ga0068856_1000734443 326
125 3300005616 Ga0068852_100002781 Ga0068852_10000278112 326
126 3300005616 Ga0068852_100008040 Ga0068852_1000080404 326
127 3300005985 Ga0081539_10019925 Ga0081539_100199252 326
128 3300009011 Ga0105251_10015386 Ga0105251_100153863 326
129 3300009036 Ga0105244_10004177 Ga0105244_100041775 326
130 3300009093 Ga0105240_10013397 Ga0105240_1001339712 326
131 3300013100 Ga0157373_10056949 Ga0157373_100569493 326
132 3300013102 Ga0157371_10001503 Ga0157371_100015033 326
133 3300013102 Ga0157371_10017401 Ga0157371_100174015 326
134 3300013102 Ga0157371_10093090 Ga0157371_100930901 326
135 3300013306 Ga0163162_10131680 Ga0163162_101316804 326
136 3300013307 Ga0157372_10069117 Ga0157372_100691172 326
137 3300015261 Ga0182006_1001464 Ga0182006_10014642 326
138 3300015265 Ga0182005_1000410 Ga0182005_10004103 326
139 3300017792 Ga0163161_10001410 Ga0163161_100014104 326
140 3300017792 Ga0163161_10023225 Ga0163161_100232253 326
141 3300017792 Ga0163161_10060994 Ga0163161_100609942 326
142 3300017792 Ga0163161_10112319 Ga0163161_101123194 326
143 3300017792 Ga0163161_10179040 Ga0163161_101790402 326
144 3300020075 Ga0206349_1366757 Ga0206349_13667571 326
145 3300020077 Ga0206351_10745931 Ga0206351_107459311 326
146 3300020082 Ga0206353_10807783 Ga0206353_108077831 326
147 3300021361 Ga0213872_10000420 Ga0213872_1000042013 326
148 3300021361 Ga0213872_10007808 Ga0213872_100078082 326
149 3300022467 Ga0224712_10075243 Ga0224712_100752431 326
150 3300022467 Ga0224712_10096110 Ga0224712_100961101 326
151 3300025233 Ga0209437_101775 Ga0209437_1017753 326
152 3300025246 Ga0209646_1000097 Ga0209646_1000097128 326
153 3300025258 Ga0209129_1002802 Ga0209129_10028028 326
154 3300025263 Ga0209565_1000014 Ga0209565_1000014489 326
155 3300025263 Ga0209565_1000081 Ga0209565_10000812 326
156 3300025272 Ga0209455_1000047 Ga0209455_100004723 326
157 3300025273 Ga0209673_1000484 Ga0209673_100048460 326
158 3300025291 Ga0209675_1001577 Ga0209675_100157712 326
159 3300025292 Ga0209676_1000093 Ga0209676_100009372 326
160 3300025292 Ga0209676_1000225 Ga0209676_100022598 326
161 3300025292 Ga0209676_1001452 Ga0209676_10014526 326
162 3300025292 Ga0209676_1003114 Ga0209676_10031146 326
163 3300025294 Ga0209025_1005863 Ga0209025_10058634 326
164 3300025295 Ga0209564_1000032 Ga0209564_1000032116 326
165 3300025295 Ga0209564_1000547 Ga0209564_10005473 326
166 3300025297 Ga0209758_1000928 Ga0209758_100092833 326
167 3300025298 Ga0209050_1000201 Ga0209050_1000201124 326
168 3300025298 Ga0209050_1001448 Ga0209050_100144822 326
169 3300025298 Ga0209050_1039031 Ga0209050_10390311 326
170 3300025299 Ga0209256_1001381 Ga0209256_100138120 326
171 3300025303 Ga0209051_1005647 Ga0209051_10056472 326
172 3300025304 Ga0209257_1000208 Ga0209257_1000208127 326
173 3300025304 Ga0209257_1007544 Ga0209257_10075444 326
174 3300025304 Ga0209257_1008238 Ga0209257_10082383 326
175 3300025728 Ga0207655_1022575 Ga0207655_10225752 326
176 3300025909 Ga0207705_10004729 Ga0207705_100047299 326
177 3300025909 Ga0207705_10005862 Ga0207705_100058625 326
178 3300025917 Ga0207660_10022286 Ga0207660_100222862 326
179 3300025919 Ga0207657_10081135 Ga0207657_100811351 326
180 3300025919 Ga0207657_10108193 Ga0207657_101081933 326
181 3300025921 Ga0207652_10006816 Ga0207652_100068168 326
182 3300025949 Ga0207667_10134050 Ga0207667_101340503 326
183 3300025972 Ga0207668_10263974 Ga0207668_102639741 326
184 3300026067 Ga0207678_10005084 Ga0207678_1000508414 326
185 3300026078 Ga0207702_10020982 Ga0207702_100209822 326
186 3300026121 Ga0207683_10047630 Ga0207683_100476303 326
187 3300026142 Ga0207698_10079625 Ga0207698_100796252 326
188 3300026142 Ga0207698_10267788 Ga0207698_102677882 326
189 3300027312 Ga0209371_1000004 Ga0209371_1000004692 326
190 3300027312 Ga0209371_1005039 Ga0209371_10050392 326
191 3300030500 Ga0268256_1000005 Ga0268256_1000005355 326
192 3300030500 Ga0268256_1004862 Ga0268256_10048623 326
193 3300030742 Ga0316183_1148384 Ga0316183_11483843 326
194 3300030744 Ga0316181_1228120 Ga0316181_12281202 326
195 3300030745 Ga0316182_1433444 Ga0316182_14334442 326
196 3300031251 Ga0265327_10005855 Ga0265327_100058559 326
197 3300031911 Ga0307412_10000601 Ga0307412_1000060110 326
198 3300032004 Ga0307414_10001039 Ga0307414_100010392 326
199 3300037312 Ga0395899_0031400 Ga0395899_0031400_2038_3069 326
200 3300037466 Ga0395898_0010978 Ga0395898_0010978_3267_4343 326
201 3300038443 Ga0395901_0010319 Ga0395901_0010319_7508_8539 326
202 3300039447 Ga0436361_0036409 Ga0436361_0036409_5139_6152 326
203 3300039447 Ga0436361_0643651 Ga0436361_0643651_1859_2872 326
204 3300039447 Ga0436361_0803316 Ga0436361_0803316_3889_4908 326
205 3300041498 Ga0451841_0253590 Ga0451841_0253590_485_1489 326
206 3300042006 Ga0439432_006246 Ga0439432_006246_2684_3688 326
207 3300044660 Ga0466974_0000298 Ga0466974_0000298_4280_5320 326
208 3300044765 Ga0466970_0022245 Ga0466970_0022245_1713_2741 326
209 3300046452 Ga0495617_000593 Ga0495617_000593_9907_10908 326
210 3300046507 Ga0495606_0001662 Ga0495606_0001662_7685_8710 326
211 3300046507 Ga0495606_0007441 Ga0495606_0007441_7172_8176 326
212 3300046507 Ga0495606_0047092 Ga0495606_0047092_566_1579 326
213 3300046512 Ga0495610_0002267 Ga0495610_0002267_13420_14424 326
214 3300046512 Ga0495610_0039394 Ga0495610_0039394_451_1455 326
215 3300046518 Ga0495631_0001762 Ga0495631_0001762_2098_3102 326
216 3300046520 Ga0495637_0007857 Ga0495637_0007857_3575_4576 326
217 3300046522 Ga0495643_0000119 Ga0495643_0000119_84406_85407 326
218 3300046522 Ga0495643_0001267 Ga0495643_0001267_19694_20698 326
219 3300046525 Ga0495663_0001201 Ga0495663_0001201_3304_4308 326
220 3300046525 Ga0495663_0001683 Ga0495663_0001683_2504_3508 326
221 3300046528 Ga0495642_0113574 Ga0495642_0113574_106_1131 326
222 3300046557 Ga0495622_0000012 Ga0495622_0000012_184595_185602 326
223 3300046557 Ga0495622_0079983 Ga0495622_0079983_410_1414 326
224 3300046558 Ga0495633_0000830 Ga0495633_0000830_16250_17254 326
225 3300046558 Ga0495633_0000986 Ga0495633_0000986_17972_18976 326
226 3300046558 Ga0495633_0005337 Ga0495633_0005337_4626_5663 326
227 3300046558 Ga0495633_0092190 Ga0495633_0092190_263_1267 326
228 3300046660 Ga0495625_0009297 Ga0495625_0009297_4440_5444 326
229 3300046660 Ga0495625_0025216 Ga0495625_0025216_1211_2215 326
230 3300046660 Ga0495625_0070633 Ga0495625_0070633_540_1544 326
231 3300046810 Ga0495660_0003654 Ga0495660_0003654_1244_2242 326
232 3300047320 Ga0495672_0000113 Ga0495672_0000113_63723_64724 326
233 3300047320 Ga0495672_0001346 Ga0495672_0001346_3649_4653 326
234 3300047445 Ga0495677_0042125 Ga0495677_0042125_525_1526 326
235 3300048906 Ga0496103_0001490 Ga0496103_0001490_5332_6363 326
236 3300048907 Ga0496104_0061663 Ga0496104_0061663_184_1188 326
237 3300048908 Ga0496105_0051051 Ga0496105_0051051_542_1546 326
238 3300048917 Ga0496114_0174146 Ga0496114_0174146_221_1252 326
239 3300048919 Ga0496116_0002334 Ga0496116_0002334_221_1252 326
240 3300048919 Ga0496116_0002534 Ga0496116_0002534_6718_7755 326
241 3300048919 Ga0496116_0119519 Ga0496116_0119519_167_1237 326
242 3300048920 Ga0496117_0001068 Ga0496117_0001068_36997_38001 326
243 3300048920 Ga0496117_0001484 Ga0496117_0001484_28420_29430 326
244 3300048920 Ga0496117_0003922 Ga0496117_0003922_3205_4209 326
245 3300048920 Ga0496117_0004623 Ga0496117_0004623_11963_12967 326
246 3300048921 Ga0496118_0001160 Ga0496118_0001160_4232_5242 326
247 3300048921 Ga0496118_0001249 Ga0496118_0001249_1658_2662 326
248 3300048921 Ga0496118_0003682 Ga0496118_0003682_14314_15318 326
249 3300048921 Ga0496118_0006497 Ga0496118_0006497_10156_11160 326
250 3300048921 Ga0496118_0021720 Ga0496118_0021720_899_1903 326
251 3300048921 Ga0496118_0026218 Ga0496118_0026218_1542_2579 326
252 3300048921 Ga0496118_0035907 Ga0496118_0035907_1644_2696 326
253 3300048922 Ga0496119_0000929 Ga0496119_0000929_2075_3079 326
254 3300048923 Ga0496120_0000943 Ga0496120_0000943_36870_37874 326
255 3300048924 Ga0496121_0001922 Ga0496121_0001922_29784_30788 326
256 3300048924 Ga0496121_0015610 Ga0496121_0015610_4835_5848 326
257 3300048925 Ga0496122_0001959 Ga0496122_0001959_1510_2514 326
258 3300048925 Ga0496122_0002318 Ga0496122_0002318_7732_8736 326
259 3300048925 Ga0496122_0003950 Ga0496122_0003950_1511_2515 326
260 3300048925 Ga0496122_0004091 Ga0496122_0004091_16134_17138 326
261 3300048925 Ga0496122_0007511 Ga0496122_0007511_8843_9880 326
262 3300048925 Ga0496122_0017121 Ga0496122_0017121_642_1646 326
263 3300048925 Ga0496122_0031549 Ga0496122_0031549_1600_2604 326
264 3300048926 Ga0496123_0001677 Ga0496123_0001677_27134_28138 326
265 3300048926 Ga0496123_0002372 Ga0496123_0002372_1511_2515 326
266 3300048926 Ga0496123_0003084 Ga0496123_0003084_12078_13082 326
267 3300048926 Ga0496123_0023397 Ga0496123_0023397_1599_2603 326
268 3300048926 Ga0496123_0039186 Ga0496123_0039186_587_1624 326
269 3300048927 Ga0496124_0001753 Ga0496124_0001753_28911_29915 326
270 3300048927 Ga0496124_0001946 Ga0496124_0001946_24513_25523 326
271 3300048927 Ga0496124_0004289 Ga0496124_0004289_2451_3455 326
272 3300048927 Ga0496124_0013367 Ga0496124_0013367_2158_3162 326
273 3300048927 Ga0496124_0017951 Ga0496124_0017951_5381_6412 326
274 3300048927 Ga0496124_0024842 Ga0496124_0024842_1616_2620 326
275 3300048927 Ga0496124_0033206 Ga0496124_0033206_1533_2621 326
276 3300048927 Ga0496124_0082843 Ga0496124_0082843_414_1418 326
277 3300048928 Ga0496125_0003620 Ga0496125_0003620_17147_18178 326
278 3300048928 Ga0496125_0005409 Ga0496125_0005409_2564_3601 326
279 3300048928 Ga0496125_0005558 Ga0496125_0005558_392_1396 326
280 3300048928 Ga0496125_0006517 Ga0496125_0006517_11309_12313 326
281 3300048928 Ga0496125_0026067 Ga0496125_0026067_3258_4262 326
282 3300048928 Ga0496125_0119916 Ga0496125_0119916_667_1671 326
283 3300048929 Ga0496126_0004357 Ga0496126_0004357_13858_14862 326
284 3300048929 Ga0496126_0007866 Ga0496126_0007866_126_1130 326
285 3300048929 Ga0496126_0104923 Ga0496126_0104923_595_1599 326
286 3300049459 Ga0495678_000111 Ga0495678_000111_35088_36089 326
287 3300049571 Ga0501034_0002009 Ga0501034_0002009_2624_3616 326
288 3300049766 Ga0501269_000048 Ga0501269_000048_34693_35724 326
289 3300050491 nmdc:mga00v17_449_c1 nmdc:mga00v17_449_c1_9554_10558 326
290 3300050491 nmdc:mga00v17_52634_c1 nmdc:mga00v17_52634_c1_1344_2348 326
291 3300053088 Ga0500644_0001979 Ga0500644_0001979_587_1585 326
292 3300053156 Ga0500622_0001262 Ga0500622_0001262_9032_10030 326
293 3300053156 Ga0500622_0066923 Ga0500622_0066923_613_1602 326
294 iso_pu_bacteria 2937610967 2937611651 326
295 iso_pu_bacteria 2939589442 2939592234 326
296 2162886007 SwRhRL2b_contig_952651 SwRhRL2b_0200.00002550 327
297 3300002773 JGI25152J39213_1000371 JGI25152J39213_10003716 327
298 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002318 327
299 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003339 327
300 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003171 327
301 3300003320 rootH2_10030707 rootH2_1003070712 327
302 3300003322 rootL2_10288228 rootL2_102882281 327
303 3300003323 rootH1_10290814 rootH1_102908142 327
304 3300003773 Ga0055537_1001004 Ga0055537_100100410 327
305 3300003781 Ga0055536_1000012 Ga0055536_100001277 327
306 3300003791 Ga0055530_10000025 Ga0055530_1000002592 327
307 3300003791 Ga0055530_10005870 Ga0055530_100058706 327
308 3300005262 Ga0065165_1002332 Ga0065165_10023327 327
309 3300005288 Ga0065714_10002370 Ga0065714_1000237026 327
310 3300005288 Ga0065714_10090291 Ga0065714_100902912 327
311 3300005289 Ga0065704_10000237 Ga0065704_1000023745 327
312 3300005289 Ga0065704_10080703 Ga0065704_100807033 327
313 3300005334 Ga0068869_100229498 Ga0068869_1002294981 327
314 3300005456 Ga0070678_100339316 Ga0070678_1003393161 327
315 3300005459 Ga0068867_100026300 Ga0068867_1000263003 327
316 3300005459 Ga0068867_100073954 Ga0068867_1000739543 327
317 3300005841 Ga0068863_100607583 Ga0068863_1006075831 327
318 3300005842 Ga0068858_100117451 Ga0068858_1001174513 327
319 3300005843 Ga0068860_100141742 Ga0068860_1001417422 327
320 3300006237 Ga0097621_100302841 Ga0097621_1003028412 327
321 3300006358 Ga0068871_100067479 Ga0068871_1000674792 327
322 3300006946 Ga0079104_1000021 Ga0079104_1000021113 327
323 3300006946 Ga0079104_1000065 Ga0079104_100006590 327
324 3300009011 Ga0105251_10000086 Ga0105251_1000008680 327
325 3300009011 Ga0105251_10000109 Ga0105251_1000010962 327
326 3300009092 Ga0105250_10000059 Ga0105250_1000005911 327
327 3300009545 Ga0105237_10006879 Ga0105237_1000687911 327
328 3300009553 Ga0105249_10010399 Ga0105249_100103992 327
329 3300010375 Ga0105239_10055383 Ga0105239_100553835 327
330 3300013100 Ga0157373_10000021 Ga0157373_1000002118 327
331 3300013102 Ga0157371_10001017 Ga0157371_100010178 327
332 3300013104 Ga0157370_10006973 Ga0157370_100069739 327
333 3300013104 Ga0157370_10019521 Ga0157370_100195217 327
334 3300013104 Ga0157370_10019651 Ga0157370_100196512 327
335 3300013306 Ga0163162_10072271 Ga0163162_100722714 327
336 3300013306 Ga0163162_10129865 Ga0163162_101298653 327
337 3300013306 Ga0163162_10386950 Ga0163162_103869502 327
338 3300013307 Ga0157372_10043573 Ga0157372_100435734 327
339 3300013307 Ga0157372_10153329 Ga0157372_101533292 327
340 3300013308 Ga0157375_10071695 Ga0157375_100716955 327
341 3300013308 Ga0157375_10174574 Ga0157375_101745742 327
342 3300014497 Ga0182008_10000017 Ga0182008_10000017122 327
343 3300014969 Ga0157376_10057318 Ga0157376_100573183 327
344 3300014969 Ga0157376_10078796 Ga0157376_100787964 327
345 3300014969 Ga0157376_10145749 Ga0157376_101457491 327
346 3300014969 Ga0157376_10502337 Ga0157376_105023371 327
347 3300015261 Ga0182006_1000051 Ga0182006_100005195 327
348 3300015261 Ga0182006_1002565 Ga0182006_10025653 327
349 3300015261 Ga0182006_1004287 Ga0182006_10042874 327
350 3300015261 Ga0182006_1012620 Ga0182006_10126201 327
351 3300015265 Ga0182005_1003968 Ga0182005_10039684 327
352 3300017792 Ga0163161_10011481 Ga0163161_100114812 327
353 3300017792 Ga0163161_10025517 Ga0163161_100255172 327
354 3300025245 Ga0207425_1000004 Ga0207425_1000004628 327
355 3300025258 Ga0209129_1000005 Ga0209129_1000005314 327
356 3300025292 Ga0209676_1000001 Ga0209676_10000011507 327
357 3300025294 Ga0209025_1000009 Ga0209025_1000009628 327
358 3300025297 Ga0209758_1000010 Ga0209758_1000010629 327
359 3300025298 Ga0209050_1000018 Ga0209050_100001874 327
360 3300025711 Ga0207696_1000005 Ga0207696_100000547 327
361 3300025735 Ga0207713_1000002 Ga0207713_1000002290 327
362 3300025735 Ga0207713_1000003 Ga0207713_1000003771 327
363 3300025942 Ga0207689_10245246 Ga0207689_102452462 327
364 3300025961 Ga0207712_10269272 Ga0207712_102692721 327
365 3300026089 Ga0207648_10098633 Ga0207648_100986333 327
366 3300026116 Ga0207674_10109990 Ga0207674_101099902 327
367 3300026121 Ga0207683_10171085 Ga0207683_101710853 327
368 3300027111 Ga0209281_1000001 Ga0209281_1000001574 327
369 3300027111 Ga0209281_1000050 Ga0209281_100005051 327
370 3300031731 Ga0307405_10139503 Ga0307405_101395032 327
371 3300031911 Ga0307412_10000214 Ga0307412_100002144 327
372 3300032004 Ga0307414_10000192 Ga0307414_1000019223 327
373 3300032004 Ga0307414_10045696 Ga0307414_100456961 327
374 3300032004 Ga0307414_10053648 Ga0307414_100536482 327
375 3300035695 Ga0373927_0070694 Ga0373927_0070694_637_1635 327
376 3300035724 Ga0373933_0235794 Ga0373933_0235794_16_1014 327
377 3300042010 Ga0439452_000002 Ga0439452_000002_961649_962638 327
378 3300042156 Ga0439446_0001961 Ga0439446_0001961_2163_3182 327
379 3300046460 Ga0495638_0001449 Ga0495638_0001449_957_1988 327
380 3300046472 Ga0495580_0322764 Ga0495580_0322764_34_1032 327
381 3300046501 Ga0495607_0006453 Ga0495607_0006453_4401_5414 327
382 3300046507 Ga0495606_0113015 Ga0495606_0113015_449_1462 327
383 3300046513 Ga0495616_0026371 Ga0495616_0026371_536_1567 327
384 3300046557 Ga0495622_0084583 Ga0495622_0084583_52_1059 327
385 3300046692 Ga0495671_0023576 Ga0495671_0023576_1246_2253 327
386 3300048922 Ga0496119_0003450 Ga0496119_0003450_6068_7057 327
387 3300048923 Ga0496120_0002180 Ga0496120_0002180_12414_13403 327
388 3300048925 Ga0496122_0000112 Ga0496122_0000112_185712_186770 327
389 3300048925 Ga0496122_0102684 Ga0496122_0102684_11_1000 327
390 3300048926 Ga0496123_0042499 Ga0496123_0042499_1386_2444 327
391 3300048927 Ga0496124_0045553 Ga0496124_0045553_2203_3261 327
392 3300048929 Ga0496126_0008339 Ga0496126_0008339_8634_9623 327
393 3300049571 Ga0501034_0007563 Ga0501034_0007563_4376_5374 327
394 3300049581 Ga0501047_0163045 Ga0501047_0163045_661_1659 327
395 3300053093 Ga0500651_0000910 Ga0500651_0000910_9795_10778 327
396 3300053108 Ga0500562_000051 Ga0500562_000051_5088_6086 327
397 3300053136 Ga0500559_0008635 Ga0500559_0008635_2480_3535 327
398 3300053142 Ga0500577_0005917 Ga0500577_0005917_1680_2699 327
399 3300053151 Ga0500604_0000588 Ga0500604_0000588_8094_9086 327
400 3300053156 Ga0500622_0001361 Ga0500622_0001361_4260_5258 327
401 3300053730 Ga0500645_055648 Ga0500645_055648_91_1089 327
402 3300055283 Ga0500661_011910 Ga0500661_011910_40_1038 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

52

377

0.97

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

159

345

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8grv-assembly1.cif.gz_A dictyostelium discoideum lactate dehydrogenase (dicldha)with nad 0.9765 1 327
8grv-assembly1.cif.gz_A dictyostelium discoideum lactate dehydrogenase (dicldha)with nad 0.9736 1 327
5z1z-assembly1.cif.gz_C the apo-structure of d-lactate dehydrogenase from escherichia coli 0.9663 1 327
5z1z-assembly1.cif.gz_C the apo-structure of d-lactate dehydrogenase from escherichia coli 0.9633 1 327
4zgs-assembly1.cif.gz_B identification of the pyruvate reductase of chlamydomonas reinhardtii 0.9619 1 324
ID Description Score Start End Superfamily
af_Q9P7Q1_142_301_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9913 141 298 3.40.50.720
af_P52643_3_101_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9909 4 99 3.40.50.720
af_Q9P7P8_108_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9907 107 293 3.40.50.720
af_P52643_123_325_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9891 121 322 3.30.360.10
3wx0D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9885 4 99 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6A6NX06-F1-model_v4 D-lactate dehydrogenase 0.994 2 326 GO:0008720
GO:0051287
AF-A0A3E0DK35-F1-model_v4 D-lactate dehydrogenase 0.994 1 326 GO:0016616
GO:0051287
AF-A0A1M5NME9-F1-model_v4 D-lactate dehydrogenase 0.9936 1 327 GO:0008720
GO:0051287
AF-A0A1V5Q1Y7-F1-model_v4 D-lactate dehydrogenase (EC 1.1.1.28) 0.9929 1 327 GO:0008720
GO:0051287
AF-A0A7Y3J333-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9926 2 327 GO:0016616
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.72 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map