F434894

General Info

Members Datasets Scaffolds Average Seq Length
401 243 802 140

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0499090|Ga0395905_0499090_187_693
Length 168
Sequence MGNAQFQCSTTNNKLQTIMSLEQKVMAEMKEAMKSKDEAGLRALRAIKAEIIKAKTEPGAAGEVTTEKELSLLQKMMKQRKDSLEIYQQQNREDLAKKEQEEIAIIEKFLPKQLSGEELKAELQQIISETGASSPADLGKVMGAATKKLAGRADGKAISAMVKELLAK

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
206 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
213 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 2
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 20.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0499090 3300037471 Bacteria 1117
2 rootH1_10003938 3300003316 Bacteria 1441
3 rootH1_10154358 3300003316 Bacteria 1470
4 rootL2_10180038 3300003322 Bacteria 2945
5 JGI25405J52794_10044811 3300003911 Bacteria 941
6 Ga0065714_10087926 3300005288 Unclassified 2038
7 Ga0065714_10234706 3300005288 Bacteria 808
8 Ga0065712_10084013 3300005290 Bacteria 2795
9 Ga0065712_10455107 3300005290 Bacteria 671
10 Ga0065715_10293641 3300005293 Bacteria 1057
11 Ga0065715_10383791 3300005293 Unclassified 899
12 Ga0070683_100061333 3300005329 Unclassified 3497
13 Ga0070683_100641030 3300005329 Bacteria 1017
14 Ga0070683_101851013 3300005329 Bacteria 580
15 Ga0070690_100003978 3300005330 Bacteria 8171
16 Ga0070670_100034177 3300005331 Unclassified 4376
17 Ga0070670_100049563 3300005331 Bacteria 3610
18 Ga0070670_100049882 3300005331 Bacteria 3598
19 Ga0070670_100060961 3300005331 Bacteria 3239
20 Ga0070670_100145634 3300005331 Bacteria 2049
21 Ga0070677_10113294 3300005333 Bacteria 1214
22 Ga0070677_10289779 3300005333 Bacteria 828
23 Ga0068869_100039716 3300005334 Bacteria 3362
24 Ga0070666_10010770 3300005335 Bacteria 5722
25 Ga0070682_100560733 3300005337 Unclassified 895
26 Ga0070682_100934524 3300005337 Bacteria 715
27 Ga0068868_100019003 3300005338 Bacteria 5143
28 Ga0068868_100096153 3300005338 Unclassified 2392
29 Ga0068868_100106200 3300005338 Unclassified 2277
30 Ga0070660_100254501 3300005339 Unclassified 1433
31 Ga0070689_100096100 3300005340 Unclassified 2341
32 Ga0070689_100168193 3300005340 Unclassified 1775
33 Ga0070687_100408401 3300005343 Bacteria 892
34 Ga0070661_100323257 3300005344 Bacteria 1205
35 Ga0070661_100429619 3300005344 Bacteria 1048
36 Ga0070661_100448948 3300005344 Unclassified 1026
37 Ga0070661_101480227 3300005344 Bacteria 572
38 Ga0070669_100056553 3300005353 Bacteria 2876
39 Ga0070669_100400122 3300005353 Bacteria 1123
40 Ga0070675_100008405 3300005354 Bacteria 8010
41 Ga0070675_100192294 3300005354 Bacteria 1768
42 Ga0070671_100013595 3300005355 Bacteria 6565
43 Ga0070671_100176189 3300005355 Unclassified 1810
44 Ga0070671_100241520 3300005355 Bacteria 1533
45 Ga0070673_100005773 3300005364 Bacteria 7967
46 Ga0070673_100022702 3300005364 Unclassified 4571
47 Ga0070673_100168198 3300005364 Unclassified 1870
48 Ga0070688_100044744 3300005365 Bacteria 2732
49 Ga0070659_100007387 3300005366 Bacteria 7983
50 Ga0070667_100017871 3300005367 Bacteria 5878
51 Ga0070667_102340240 3300005367 Bacteria 503
52 Ga0070713_100055688 3300005436 Bacteria 3287
53 Ga0070701_10163327 3300005438 Unclassified 1292
54 Ga0070711_100068510 3300005439 Bacteria 2493
55 Ga0070700_101536557 3300005441 Bacteria 567
56 Ga0070678_100011580 3300005456 Bacteria 5447
57 Ga0070662_100971877 3300005457 Unclassified 726
58 Ga0070681_10203659 3300005458 Unclassified 1897
59 Ga0068867_100560620 3300005459 Bacteria 991
60 Ga0070685_10047750 3300005466 Unclassified 2463
61 Ga0070685_10067614 3300005466 Unclassified 2108
62 Ga0070685_10347723 3300005466 Bacteria 1013
63 Ga0070706_100888842 3300005467 Bacteria 823
64 Ga0070707_100156482 3300005468 Unclassified 2220
65 Ga0070698_100004771 3300005471 Bacteria 14879
66 Ga0070699_100175645 3300005518 Unclassified 1899
67 Ga0070684_100025672 3300005535 Bacteria 4956
68 Ga0068853_100362238 3300005539 Bacteria 1351
69 Ga0068853_100965761 3300005539 Bacteria 820
70 Ga0070672_100070554 3300005543 Unclassified 2776
71 Ga0070672_100812308 3300005543 Bacteria 823
72 Ga0070665_102328508 3300005548 Bacteria 538
73 Ga0070704_100102316 3300005549 Bacteria 2161
74 Ga0070664_100004753 3300005564 Bacteria 10893
75 Ga0070664_100159319 3300005564 Bacteria 1996
76 Ga0068857_100046329 3300005577 Bacteria 3859
77 Ga0068857_101995098 3300005577 Bacteria 569
78 Ga0068854_100004832 3300005578 Bacteria 8502
79 Ga0068856_100131776 3300005614 Bacteria 2505
80 Ga0068852_100011448 3300005616 Bacteria 6679
81 Ga0068852_100104879 3300005616 Bacteria 2560
82 Ga0068852_100669003 3300005616 Bacteria 1047
83 Ga0068852_101613670 3300005616 Unclassified 671
84 Ga0068859_100015329 3300005617 Bacteria 7698
85 Ga0068859_100309258 3300005617 Bacteria 1674
86 Ga0068859_101117848 3300005617 Bacteria 867
87 Ga0068859_101442191 3300005617 Unclassified 759
88 Ga0068864_100184807 3300005618 Bacteria 1907
89 Ga0068866_10004497 3300005718 Bacteria 5715
90 Ga0068861_100171717 3300005719 Bacteria 1798
91 Ga0068861_100180780 3300005719 Unclassified 1756
92 Ga0068861_101410101 3300005719 Bacteria 681
93 Ga0068861_101505003 3300005719 Unclassified 660
94 Ga0068851_10669220 3300005834 Bacteria 637
95 Ga0068870_10025643 3300005840 Bacteria 2929
96 Ga0068870_10084595 3300005840 Bacteria 1761
97 Ga0068870_10131150 3300005840 Bacteria 1456
98 Ga0068870_10962612 3300005840 Unclassified 607
99 Ga0068863_101088623 3300005841 Unclassified 803
100 Ga0068858_100073111 3300005842 Unclassified 3183
101 Ga0068860_100174962 3300005843 Unclassified 2074
102 Ga0068860_100474829 3300005843 Bacteria 1246
103 Ga0068860_100539573 3300005843 Bacteria 1168
104 Ga0068862_100941087 3300005844 Bacteria 851
105 Ga0068862_101132009 3300005844 Bacteria 779
106 Ga0068862_101806263 3300005844 Unclassified 621
107 Ga0081455_10006272 3300005937 Bacteria 12786
108 Ga0081455_10235165 3300005937 Bacteria 1350
109 Ga0081538_10020992 3300005981 Bacteria 4787
110 Ga0081538_10122769 3300005981 Bacteria 1243
111 Ga0081540_1058078 3300005983 Bacteria 1866
112 Ga0081539_10001948 3300005985 Bacteria 31581
113 Ga0070717_10045575 3300006028 Bacteria 3585
114 Ga0070715_10005672 3300006163 Bacteria 4184
115 Ga0070715_10098373 3300006163 Bacteria 1360
116 Ga0070716_100008442 3300006173 Bacteria 5109
117 Ga0070712_100082237 3300006175 Bacteria 2336
118 Ga0070712_100325243 3300006175 Bacteria 1251
119 Ga0075366_10001437 3300006195 Bacteria 11874
120 Ga0075366_10008435 3300006195 Bacteria 5730
121 Ga0097621_101169832 3300006237 Bacteria 724
122 Ga0075370_10352545 3300006353 Bacteria 879
123 Ga0068871_100085561 3300006358 Unclassified 2618
124 Ga0075428_100006050 3300006844 Bacteria 13444
125 Ga0075428_100330805 3300006844 Bacteria 1636
126 Ga0075428_100836608 3300006844 Bacteria 978
127 Ga0075430_100001157 3300006846 Bacteria 21067
128 Ga0075430_100365908 3300006846 Bacteria 1190
129 Ga0075431_100010980 3300006847 Bacteria 9115
130 Ga0075431_100135827 3300006847 Bacteria 2536
131 Ga0075429_100035235 3300006880 Bacteria 4352
132 Ga0068865_100189932 3300006881 Bacteria 1588
133 Ga0097620_100015329 3300006931 Bacteria 7698
134 Ga0097620_100309237 3300006931 Bacteria 1674
135 Ga0097620_101117775 3300006931 Bacteria 867
136 Ga0111539_11076839 3300009094 Bacteria 934
137 Ga0114129_10046449 3300009147 Bacteria 6102
138 Ga0114129_10654161 3300009147 Bacteria 1356
139 Ga0105242_10015262 3300009176 Bacteria 5966
140 Ga0105242_10057858 3300009176 Bacteria 3176
141 Ga0105242_10387300 3300009176 Bacteria 1301
142 Ga0105248_11677112 3300009177 Bacteria 720
143 Ga0105237_10020903 3300009545 Bacteria 6738
144 Ga0105238_12462167 3300009551 Bacteria 556
145 Ga0105249_10002727 3300009553 Bacteria 15273
146 Ga0105249_10513552 3300009553 Unclassified 1245
147 Ga0105249_10728561 3300009553 Bacteria 1053
148 Ga0105239_10126690 3300010375 Unclassified 2838
149 Ga0105239_12346787 3300010375 Unclassified 621
150 Ga0157373_10226583 3300013100 Unclassified 1319
151 Ga0157371_10104239 3300013102 Bacteria 2013
152 Ga0157371_10844669 3300013102 Bacteria 692
153 Ga0157369_10041671 3300013105 Bacteria 5011
154 Ga0157369_11957399 3300013105 Bacteria 595
155 Ga0157374_10001221 3300013296 Bacteria 21951
156 Ga0157374_10141547 3300013296 Bacteria 2335
157 Ga0157374_10231029 3300013296 Bacteria 1817
158 Ga0157374_10308602 3300013296 Unclassified 1566
159 Ga0157378_10307433 3300013297 Bacteria 1536
160 Ga0157378_12638193 3300013297 Bacteria 555
161 Ga0163162_10107364 3300013306 Bacteria 2887
162 Ga0163162_10209570 3300013306 Bacteria 2078
163 Ga0163162_10512875 3300013306 Bacteria 1329
164 Ga0163162_11027950 3300013306 Unclassified 932
165 Ga0157372_10003396 3300013307 Bacteria 17186
166 Ga0157372_10115033 3300013307 Bacteria 3084
167 Ga0157372_10218144 3300013307 Unclassified 2211
168 Ga0157372_10513209 3300013307 Bacteria 1397
169 Ga0157375_10001388 3300013308 Bacteria 20910
170 Ga0157375_10221622 3300013308 Bacteria 2050
171 Ga0163163_10136346 3300014325 Bacteria 2495
172 Ga0163163_10284603 3300014325 Bacteria 1705
173 Ga0163163_10309195 3300014325 Bacteria 1633
174 Ga0163163_10518545 3300014325 Bacteria 1254
175 Ga0163163_10992778 3300014325 Bacteria 903
176 Ga0163163_12075113 3300014325 Bacteria 628
177 Ga0157380_10026885 3300014326 Bacteria 4372
178 Ga0157380_10072778 3300014326 Bacteria 2785
179 Ga0157380_10208185 3300014326 Unclassified 1741
180 Ga0157377_10009315 3300014745 Bacteria 4811
181 Ga0157377_10036820 3300014745 Bacteria 2693
182 Ga0157377_10243157 3300014745 Unclassified 1163
183 Ga0157379_10080416 3300014968 Bacteria 2919
184 Ga0157379_10329736 3300014968 Unclassified 1394
185 Ga0157376_10001409 3300014969 Bacteria 15807
186 Ga0157376_10269636 3300014969 Bacteria 1598
187 Ga0157376_10320188 3300014969 Bacteria 1474
188 Ga0157376_10915999 3300014969 Bacteria 895
189 Ga0163161_10266484 3300017792 Bacteria 1339
190 Ga0209646_1001012 3300025246 Bacteria 8602
191 Ga0207692_10267827 3300025898 Bacteria 1029
192 Ga0207688_10027969 3300025901 Archaea 3102
193 Ga0207680_10011416 3300025903 Bacteria 4489
194 Ga0207685_10045819 3300025905 Bacteria 1661
195 Ga0207643_10018101 3300025908 Bacteria 3859
196 Ga0207643_10088315 3300025908 Bacteria 1804
197 Ga0207684_11191846 3300025910 Bacteria 631
198 Ga0207693_10002958 3300025915 Bacteria 14705
199 Ga0207663_10102643 3300025916 Bacteria 1924
200 Ga0207663_10648542 3300025916 Bacteria 833
201 Ga0207662_10004129 3300025918 Bacteria 7594
202 Ga0207662_10429661 3300025918 Bacteria 900
203 Ga0207657_10131145 3300025919 Unclassified 2054
204 Ga0207649_10070227 3300025920 Unclassified 2233
205 Ga0207649_10215798 3300025920 Bacteria 1364
206 Ga0207649_10399799 3300025920 Bacteria 1028
207 Ga0207649_10614752 3300025920 Bacteria 837
208 Ga0207681_10356829 3300025923 Bacteria 1171
209 Ga0207650_10014306 3300025925 Bacteria 5513
210 Ga0207650_10059698 3300025925 Unclassified 2844
211 Ga0207650_10086682 3300025925 Bacteria 2384
212 Ga0207650_10113938 3300025925 Bacteria 2097
213 Ga0207650_10150039 3300025925 Bacteria 1839
214 Ga0207650_10152813 3300025925 Bacteria 1823
215 Ga0207659_10005109 3300025926 Bacteria 7954
216 Ga0207659_10029935 3300025926 Bacteria 3715
217 Ga0207659_10112663 3300025926 Unclassified 2071
218 Ga0207659_10291584 3300025926 Bacteria 1337
219 Ga0207700_10084920 3300025928 Bacteria 2483
220 Ga0207690_10064440 3300025932 Bacteria 2502
221 Ga0207690_11671969 3300025932 Bacteria 532
222 Ga0207686_10139126 3300025934 Bacteria 1675
223 Ga0207686_10256035 3300025934 Bacteria 1281
224 Ga0207670_10096835 3300025936 Unclassified 2099
225 Ga0207691_10036901 3300025940 Bacteria 4527
226 Ga0207691_10098657 3300025940 Unclassified 2609
227 Ga0207691_11169801 3300025940 Bacteria 638
228 Ga0207689_10006451 3300025942 Bacteria 10371
229 Ga0207689_10013331 3300025942 Bacteria 7013
230 Ga0207689_10335690 3300025942 Unclassified 1255
231 Ga0207661_10095786 3300025944 Bacteria 2482
232 Ga0207679_10020334 3300025945 Bacteria 4479
233 Ga0207679_10028022 3300025945 Bacteria 3904
234 Ga0207667_10129227 3300025949 Bacteria 2602
235 Ga0207667_11180872 3300025949 Bacteria 746
236 Ga0207651_10450494 3300025960 Unclassified 1104
237 Ga0207651_10661921 3300025960 Bacteria 917
238 Ga0207712_10004856 3300025961 Bacteria 8497
239 Ga0207712_10604563 3300025961 Bacteria 949
240 Ga0207640_10002135 3300025981 Bacteria 10617
241 Ga0207658_10008454 3300025986 Bacteria 7006
242 Ga0207658_11365023 3300025986 Bacteria 648
243 Ga0207658_11735981 3300025986 Bacteria 570
244 Ga0207677_10016612 3300026023 Bacteria 4364
245 Ga0207677_10056150 3300026023 Unclassified 2696
246 Ga0207703_10068179 3300026035 Unclassified 2931
247 Ga0207702_10128249 3300026078 Bacteria 2280
248 Ga0207641_10902350 3300026088 Unclassified 877
249 Ga0207648_10117816 3300026089 Bacteria 2334
250 Ga0207648_10182528 3300026089 Unclassified 1857
251 Ga0207676_10131707 3300026095 Bacteria 2127
252 Ga0207674_10656629 3300026116 Bacteria 1013
253 Ga0207675_100116667 3300026118 Bacteria 2523
254 Ga0207675_100209826 3300026118 Bacteria 1873
255 Ga0207675_100228085 3300026118 Bacteria 1796
256 Ga0207675_101455148 3300026118 Unclassified 706
257 Ga0207675_101487486 3300026118 Bacteria 698
258 Ga0207683_10020499 3300026121 Bacteria 5654
259 Ga0207683_10030804 3300026121 Unclassified 4651
260 Ga0207683_10274021 3300026121 Bacteria 1542
261 Ga0207698_10004400 3300026142 Bacteria 8582
262 Ga0207698_10020442 3300026142 Unclassified 4557
263 Ga0207698_10109177 3300026142 Bacteria 2314
264 Ga0207698_10247819 3300026142 Unclassified 1628
265 Ga0207698_10507899 3300026142 Bacteria 1174
266 Ga0207698_11691024 3300026142 Bacteria 648
267 Ga0209984_1015211 3300027424 Bacteria 1021
268 Ga0209974_10047073 3300027876 Bacteria 1444
269 Ga0207428_10895045 3300027907 Bacteria 627
270 Ga0268266_11793424 3300028379 Bacteria 588
271 Ga0268265_10226972 3300028380 Unclassified 1638
272 Ga0268265_10289873 3300028380 Bacteria 1469
273 Ga0268265_10947485 3300028380 Bacteria 848
274 Ga0268264_10310541 3300028381 Bacteria 1488
275 Ga0268264_10626199 3300028381 Unclassified 1063
276 Ga0307517_10268737 3300028786 Bacteria 983
277 Ga0265327_10013842 3300031251 Bacteria 5327
278 Ga0307513_10093118 3300031456 Bacteria 3064
279 Ga0307513_10264772 3300031456 Bacteria 1506
280 Ga0307405_11046587 3300031731 Bacteria 699
281 Ga0307413_10236005 3300031824 Bacteria 1347
282 Ga0307413_10289115 3300031824 Bacteria 1237
283 Ga0307410_10163386 3300031852 Bacteria 1671
284 Ga0307410_10244348 3300031852 Bacteria 1393
285 Ga0307407_10058500 3300031903 Bacteria 2241
286 Ga0307407_11173872 3300031903 Unclassified 599
287 Ga0307414_10915963 3300032004 Unclassified 804
288 Ga0307411_10240864 3300032005 Bacteria 1416
289 Ga0307411_10499775 3300032005 Bacteria 1028
290 Ga0307415_100477594 3300032126 Bacteria 1084
291 Ga0307415_100730621 3300032126 Bacteria 897
292 Ga0307415_100778696 3300032126 Unclassified 871
293 Ga0373936_0207986 3300035113 Bacteria 865
294 Ga0373945_0507899 3300035116 Unclassified 538
295 Ga0373953_0172219 3300035117 Bacteria 932
296 Ga0373943_0756664 3300035170 Bacteria 577
297 Ga0373935_0542558 3300035692 Bacteria 847
298 Ga0373935_0957936 3300035692 Bacteria 635
299 Ga0373937_0772959 3300036401 Bacteria 908
300 Ga0395898_1314811 3300037466 Unclassified 652
301 Ga0395905_0002365 3300037471 Bacteria 21010
302 Ga0395901_0597918 3300038443 Bacteria 1113
303 Ga0436363_0264372 3300039450 Bacteria 1201
304 Ga0451789_0639076 3300041443 Bacteria 612
305 Ga0451802_0620780 3300041460 Bacteria 589
306 Ga0451807_2725283 3300041486 Bacteria 795
307 Ga0451839_0192391 3300041496 Bacteria 597
308 Ga0451851_1029880 3300041507 Unclassified 550
309 Ga0453683_0032235 3300044673 Bacteria 3307
310 Ga0453683_0157690 3300044673 Unclassified 1435
311 Ga0453683_0508810 3300044673 Bacteria 782
312 Ga0453684_0027037 3300044712 Bacteria 8251
313 Ga0453684_0062864 3300044712 Bacteria 4752
314 Ga0466968_0120761 3300044735 Bacteria 1185
315 Ga0466959_0276650 3300045049 Unclassified 1153
316 Ga0466959_0374130 3300045049 Bacteria 970
317 Ga0451576_0405347 3300045051 Bacteria 1430
318 Ga0495629_0110499 3300046459 Bacteria 1916
319 Ga0495662_0039562 3300046476 Bacteria 2278
320 Ga0495664_0366602 3300046477 Bacteria 867
321 Ga0495630_0036815 3300046517 Bacteria 3658
322 Ga0495632_0058425 3300046519 Bacteria 1880
323 Ga0495663_0175707 3300046525 Unclassified 740
324 Ga0495666_0375420 3300046526 Unclassified 640
325 Ga0495642_0125112 3300046528 Bacteria 1105
326 Ga0495652_0129380 3300046529 Bacteria 2001
327 Ga0495586_0044181 3300046535 Bacteria 2400
328 Ga0495621_0025798 3300046539 Bacteria 1977
329 Ga0495667_0177929 3300046559 Bacteria 1366
330 Ga0495657_0146968 3300046675 Bacteria 1466
331 Ga0495658_0003256 3300046683 Bacteria 8075
332 Ga0495600_0851601 3300046809 Bacteria 540
333 Ga0495581_0246039 3300047315 Bacteria 1046
334 Ga0495672_0071954 3300047320 Bacteria 1955
335 Ga0495672_0246644 3300047320 Unclassified 869
336 Ga0495676_0121563 3300047321 Unclassified 1899
337 Ga0495677_0433804 3300047445 Unclassified 520
338 Ga0496100_0208931 3300048903 Bacteria 1427
339 Ga0496101_0130400 3300048904 Bacteria 1909
340 Ga0496106_0096197 3300048909 Bacteria 2291
341 Ga0496106_0125051 3300048909 Unclassified 2013
342 Ga0496115_0620487 3300048918 Bacteria 858
343 Ga0496124_0021144 3300048927 Bacteria 5999
344 Ga0501299_201778 3300049522 Unclassified 529
345 Ga0501037_0070519 3300049573 Unclassified 2543
346 Ga0501038_0797705 3300049574 Bacteria 702
347 Ga0501043_0100396 3300049579 Bacteria 2275
348 Ga0501043_0353992 3300049579 Bacteria 1115
349 Ga0501047_0908449 3300049581 Bacteria 694
350 Ga0501070_0495523 3300049586 Bacteria 982
351 Ga0501075_0776540 3300049591 Bacteria 729
352 Ga0501207_033648 3300049654 Bacteria 871
353 Ga0501217_166338 3300049661 Bacteria 668
354 Ga0501224_067958 3300049664 Bacteria 561
355 Ga0501227_047177 3300049665 Bacteria 1079
356 Ga0501235_028079 3300049669 Bacteria 1264
357 Ga0501221_120733 3300049704 Bacteria 670
358 Ga0501225_0108219 3300049705 Unclassified 817
359 Ga0501081_0473480 3300049743 Bacteria 932
360 Ga0501279_015870 3300049775 Bacteria 1046
361 Ga0501283_100066 3300049779 Unclassified 564
362 Ga0501044_0624052 3300049823 Bacteria 969
363 nmdc:mga03683_247752_c1 3300050489 Bacteria 827
364 nmdc:mga0k408_1783_c1 3300050493 Bacteria 11536
365 nmdc:mga0k408_341277_c1 3300050493 Bacteria 893
366 nmdc:mga05p37_192611_c1 3300050507 Unclassified 2474
367 nmdc:mga05p37_264394_c1 3300050507 Bacteria 2057
368 nmdc:mga05p37_272267_c1 3300050507 Bacteria 2022
369 nmdc:mga09592_132606_c1 3300050508 Unclassified 2145
370 nmdc:mga0qj67_34856_c1 3300050509 Bacteria 3933
371 nmdc:mga06r32_288822_c1 3300050510 Unclassified 1627
372 nmdc:mga06r32_511354_c1 3300050510 Bacteria 1177
373 nmdc:mga08y16_1501744_c1 3300050511 Bacteria 634
374 nmdc:mga08y16_478299_c1 3300050511 Bacteria 1268
375 nmdc:mga08y16_552225_c1 3300050511 Bacteria 1165
376 nmdc:mga0n895_297780_c1 3300050512 Bacteria 1635
377 nmdc:mga08x19_64468_c1 3300050514 Bacteria 2378
378 nmdc:mga0a205_1109929_c1 3300050515 Bacteria 638
379 Ga0495601_0111240 3300053077 Bacteria 1774
380 Ga0495619_0056941 3300053085 Bacteria 2593
381 Ga0495619_0436345 3300053085 Bacteria 903
382 Ga0500578_0036846 3300053086 Bacteria 3141
383 Ga0500583_0009419 3300053092 Bacteria 3569
384 Ga0500566_0329903 3300053094 Bacteria 707
385 Ga0500650_0384951 3300053098 Bacteria 609
386 Ga0500554_038529 3300053102 Bacteria 1455
387 Ga0500562_000013 3300053108 Bacteria 150003
388 Ga0500572_251077 3300053111 Bacteria 575
389 Ga0500594_0003368 3300053118 Bacteria 3504
390 Ga0500559_0018537 3300053136 Unclassified 2941
391 Ga0500604_0007672 3300053151 Bacteria 2859
392 Ga0500616_0055309 3300053153 Bacteria 2076
393 Ga0500639_339870 3300053163 Bacteria 538
394 Ga0500636_0096550 3300053177 Bacteria 1686
395 Ga0500645_077324 3300053730 Bacteria 951
396 Ga0500645_154382 3300053730 Bacteria 631
397 Ga0500661_031910 3300055283 Bacteria 929
398 Ga0530510_0093540 3300061734 Bacteria 2195
399 Ga0530510_0684286 3300061734 Bacteria 781
400 Ga0530510_0716696 3300061734 Bacteria 762
401 2883071398 2883068021 Bacteria 6192739
402 Ga0395905_0499090
403 rootH1_10003938
404 rootH1_10154358
405 rootL2_10180038
406 JGI25405J52794_10044811
407 Ga0065714_10087926
408 Ga0065714_10234706
409 Ga0065712_10084013
410 Ga0065712_10455107
411 Ga0065715_10293641
412 Ga0065715_10383791
413 Ga0070683_100061333
414 Ga0070683_100641030
415 Ga0070683_101851013
416 Ga0070690_100003978
417 Ga0070670_100034177
418 Ga0070670_100049563
419 Ga0070670_100049882
420 Ga0070670_100060961
421 Ga0070670_100145634
422 Ga0070677_10113294
423 Ga0070677_10289779
424 Ga0068869_100039716
425 Ga0070666_10010770
426 Ga0070682_100560733
427 Ga0070682_100934524
428 Ga0068868_100019003
429 Ga0068868_100096153
430 Ga0068868_100106200
431 Ga0070660_100254501
432 Ga0070689_100096100
433 Ga0070689_100168193
434 Ga0070687_100408401
435 Ga0070661_100323257
436 Ga0070661_100429619
437 Ga0070661_100448948
438 Ga0070661_101480227
439 Ga0070669_100056553
440 Ga0070669_100400122
441 Ga0070675_100008405
442 Ga0070675_100192294
443 Ga0070671_100013595
444 Ga0070671_100176189
445 Ga0070671_100241520
446 Ga0070673_100005773
447 Ga0070673_100022702
448 Ga0070673_100168198
449 Ga0070688_100044744
450 Ga0070659_100007387
451 Ga0070667_100017871
452 Ga0070667_102340240
453 Ga0070713_100055688
454 Ga0070701_10163327
455 Ga0070711_100068510
456 Ga0070700_101536557
457 Ga0070678_100011580
458 Ga0070662_100971877
459 Ga0070681_10203659
460 Ga0068867_100560620
461 Ga0070685_10047750
462 Ga0070685_10067614
463 Ga0070685_10347723
464 Ga0070706_100888842
465 Ga0070707_100156482
466 Ga0070698_100004771
467 Ga0070699_100175645
468 Ga0070684_100025672
469 Ga0068853_100362238
470 Ga0068853_100965761
471 Ga0070672_100070554
472 Ga0070672_100812308
473 Ga0070665_102328508
474 Ga0070704_100102316
475 Ga0070664_100004753
476 Ga0070664_100159319
477 Ga0068857_100046329
478 Ga0068857_101995098
479 Ga0068854_100004832
480 Ga0068856_100131776
481 Ga0068852_100011448
482 Ga0068852_100104879
483 Ga0068852_100669003
484 Ga0068852_101613670
485 Ga0068859_100015329
486 Ga0068859_100309258
487 Ga0068859_101117848
488 Ga0068859_101442191
489 Ga0068864_100184807
490 Ga0068866_10004497
491 Ga0068861_100171717
492 Ga0068861_100180780
493 Ga0068861_101410101
494 Ga0068861_101505003
495 Ga0068851_10669220
496 Ga0068870_10025643
497 Ga0068870_10084595
498 Ga0068870_10131150
499 Ga0068870_10962612
500 Ga0068863_101088623
501 Ga0068858_100073111
502 Ga0068860_100174962
503 Ga0068860_100474829
504 Ga0068860_100539573
505 Ga0068862_100941087
506 Ga0068862_101132009
507 Ga0068862_101806263
508 Ga0081455_10006272
509 Ga0081455_10235165
510 Ga0081538_10020992
511 Ga0081538_10122769
512 Ga0081540_1058078
513 Ga0081539_10001948
514 Ga0070717_10045575
515 Ga0070715_10005672
516 Ga0070715_10098373
517 Ga0070716_100008442
518 Ga0070712_100082237
519 Ga0070712_100325243
520 Ga0075366_10001437
521 Ga0075366_10008435
522 Ga0097621_101169832
523 Ga0075370_10352545
524 Ga0068871_100085561
525 Ga0075428_100006050
526 Ga0075428_100330805
527 Ga0075428_100836608
528 Ga0075430_100001157
529 Ga0075430_100365908
530 Ga0075431_100010980
531 Ga0075431_100135827
532 Ga0075429_100035235
533 Ga0068865_100189932
534 Ga0097620_100015329
535 Ga0097620_100309237
536 Ga0097620_101117775
537 Ga0111539_11076839
538 Ga0114129_10046449
539 Ga0114129_10654161
540 Ga0105242_10015262
541 Ga0105242_10057858
542 Ga0105242_10387300
543 Ga0105248_11677112
544 Ga0105237_10020903
545 Ga0105238_12462167
546 Ga0105249_10002727
547 Ga0105249_10513552
548 Ga0105249_10728561
549 Ga0105239_10126690
550 Ga0105239_12346787
551 Ga0157373_10226583
552 Ga0157371_10104239
553 Ga0157371_10844669
554 Ga0157369_10041671
555 Ga0157369_11957399
556 Ga0157374_10001221
557 Ga0157374_10141547
558 Ga0157374_10231029
559 Ga0157374_10308602
560 Ga0157378_10307433
561 Ga0157378_12638193
562 Ga0163162_10107364
563 Ga0163162_10209570
564 Ga0163162_10512875
565 Ga0163162_11027950
566 Ga0157372_10003396
567 Ga0157372_10115033
568 Ga0157372_10218144
569 Ga0157372_10513209
570 Ga0157375_10001388
571 Ga0157375_10221622
572 Ga0163163_10136346
573 Ga0163163_10284603
574 Ga0163163_10309195
575 Ga0163163_10518545
576 Ga0163163_10992778
577 Ga0163163_12075113
578 Ga0157380_10026885
579 Ga0157380_10072778
580 Ga0157380_10208185
581 Ga0157377_10009315
582 Ga0157377_10036820
583 Ga0157377_10243157
584 Ga0157379_10080416
585 Ga0157379_10329736
586 Ga0157376_10001409
587 Ga0157376_10269636
588 Ga0157376_10320188
589 Ga0157376_10915999
590 Ga0163161_10266484
591 Ga0209646_1001012
592 Ga0207692_10267827
593 Ga0207688_10027969
594 Ga0207680_10011416
595 Ga0207685_10045819
596 Ga0207643_10018101
597 Ga0207643_10088315
598 Ga0207684_11191846
599 Ga0207693_10002958
600 Ga0207663_10102643
601 Ga0207663_10648542
602 Ga0207662_10004129
603 Ga0207662_10429661
604 Ga0207657_10131145
605 Ga0207649_10070227
606 Ga0207649_10215798
607 Ga0207649_10399799
608 Ga0207649_10614752
609 Ga0207681_10356829
610 Ga0207650_10014306
611 Ga0207650_10059698
612 Ga0207650_10086682
613 Ga0207650_10113938
614 Ga0207650_10150039
615 Ga0207650_10152813
616 Ga0207659_10005109
617 Ga0207659_10029935
618 Ga0207659_10112663
619 Ga0207659_10291584
620 Ga0207700_10084920
621 Ga0207690_10064440
622 Ga0207690_11671969
623 Ga0207686_10139126
624 Ga0207686_10256035
625 Ga0207670_10096835
626 Ga0207691_10036901
627 Ga0207691_10098657
628 Ga0207691_11169801
629 Ga0207689_10006451
630 Ga0207689_10013331
631 Ga0207689_10335690
632 Ga0207661_10095786
633 Ga0207679_10020334
634 Ga0207679_10028022
635 Ga0207667_10129227
636 Ga0207667_11180872
637 Ga0207651_10450494
638 Ga0207651_10661921
639 Ga0207712_10004856
640 Ga0207712_10604563
641 Ga0207640_10002135
642 Ga0207658_10008454
643 Ga0207658_11365023
644 Ga0207658_11735981
645 Ga0207677_10016612
646 Ga0207677_10056150
647 Ga0207703_10068179
648 Ga0207702_10128249
649 Ga0207641_10902350
650 Ga0207648_10117816
651 Ga0207648_10182528
652 Ga0207676_10131707
653 Ga0207674_10656629
654 Ga0207675_100116667
655 Ga0207675_100209826
656 Ga0207675_100228085
657 Ga0207675_101455148
658 Ga0207675_101487486
659 Ga0207683_10020499
660 Ga0207683_10030804
661 Ga0207683_10274021
662 Ga0207698_10004400
663 Ga0207698_10020442
664 Ga0207698_10109177
665 Ga0207698_10247819
666 Ga0207698_10507899
667 Ga0207698_11691024
668 Ga0209984_1015211
669 Ga0209974_10047073
670 Ga0207428_10895045
671 Ga0268266_11793424
672 Ga0268265_10226972
673 Ga0268265_10289873
674 Ga0268265_10947485
675 Ga0268264_10310541
676 Ga0268264_10626199
677 Ga0307517_10268737
678 Ga0265327_10013842
679 Ga0307513_10093118
680 Ga0307513_10264772
681 Ga0307405_11046587
682 Ga0307413_10236005
683 Ga0307413_10289115
684 Ga0307410_10163386
685 Ga0307410_10244348
686 Ga0307407_10058500
687 Ga0307407_11173872
688 Ga0307414_10915963
689 Ga0307411_10240864
690 Ga0307411_10499775
691 Ga0307415_100477594
692 Ga0307415_100730621
693 Ga0307415_100778696
694 Ga0373936_0207986
695 Ga0373945_0507899
696 Ga0373953_0172219
697 Ga0373943_0756664
698 Ga0373935_0542558
699 Ga0373935_0957936
700 Ga0373937_0772959
701 Ga0395898_1314811
702 Ga0395905_0002365
703 Ga0395901_0597918
704 Ga0436363_0264372
705 Ga0451789_0639076
706 Ga0451802_0620780
707 Ga0451807_2725283
708 Ga0451839_0192391
709 Ga0451851_1029880
710 Ga0453683_0032235
711 Ga0453683_0157690
712 Ga0453683_0508810
713 Ga0453684_0027037
714 Ga0453684_0062864
715 Ga0466968_0120761
716 Ga0466959_0276650
717 Ga0466959_0374130
718 Ga0451576_0405347
719 Ga0495629_0110499
720 Ga0495662_0039562
721 Ga0495664_0366602
722 Ga0495630_0036815
723 Ga0495632_0058425
724 Ga0495663_0175707
725 Ga0495666_0375420
726 Ga0495642_0125112
727 Ga0495652_0129380
728 Ga0495586_0044181
729 Ga0495621_0025798
730 Ga0495667_0177929
731 Ga0495657_0146968
732 Ga0495658_0003256
733 Ga0495600_0851601
734 Ga0495581_0246039
735 Ga0495672_0071954
736 Ga0495672_0246644
737 Ga0495676_0121563
738 Ga0495677_0433804
739 Ga0496100_0208931
740 Ga0496101_0130400
741 Ga0496106_0096197
742 Ga0496106_0125051
743 Ga0496115_0620487
744 Ga0496124_0021144
745 Ga0501299_201778
746 Ga0501037_0070519
747 Ga0501038_0797705
748 Ga0501043_0100396
749 Ga0501043_0353992
750 Ga0501047_0908449
751 Ga0501070_0495523
752 Ga0501075_0776540
753 Ga0501207_033648
754 Ga0501217_166338
755 Ga0501224_067958
756 Ga0501227_047177
757 Ga0501235_028079
758 Ga0501221_120733
759 Ga0501225_0108219
760 Ga0501081_0473480
761 Ga0501279_015870
762 Ga0501283_100066
763 Ga0501044_0624052
764 nmdc:mga03683_247752_c1
765 nmdc:mga0k408_1783_c1
766 nmdc:mga0k408_341277_c1
767 nmdc:mga05p37_192611_c1
768 nmdc:mga05p37_264394_c1
769 nmdc:mga05p37_272267_c1
770 nmdc:mga09592_132606_c1
771 nmdc:mga0qj67_34856_c1
772 nmdc:mga06r32_288822_c1
773 nmdc:mga06r32_511354_c1
774 nmdc:mga08y16_1501744_c1
775 nmdc:mga08y16_478299_c1
776 nmdc:mga08y16_552225_c1
777 nmdc:mga0n895_297780_c1
778 nmdc:mga08x19_64468_c1
779 nmdc:mga0a205_1109929_c1
780 Ga0495601_0111240
781 Ga0495619_0056941
782 Ga0495619_0436345
783 Ga0500578_0036846
784 Ga0500583_0009419
785 Ga0500566_0329903
786 Ga0500650_0384951
787 Ga0500554_038529
788 Ga0500562_000013
789 Ga0500572_251077
790 Ga0500594_0003368
791 Ga0500559_0018537
792 Ga0500604_0007672
793 Ga0500616_0055309
794 Ga0500639_339870
795 Ga0500636_0096550
796 Ga0500645_077324
797 Ga0500645_154382
798 Ga0500661_031910
799 Ga0530510_0093540
800 Ga0530510_0684286
801 Ga0530510_0716696
802 2883071398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

22

166

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tl4-assembly1.cif.gz_X crystal structure of the trna binding domain of glutaminyl-trna synthetase from saccharomyces cerevisiae 0.7702 78 128
6y0g-assembly1.cif.gz_SR structure of human ribosome in classical-pre state 0.5155 79 129
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.4956 1 128
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.4848 1 128
3ddh-assembly1.cif.gz_A the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.3535 55 129
ID Description Score Start End Superfamily
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9487 78 128 1.10.10.410
af_I6X831_94_154_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9042 78 128 1.10.10.410
af_Q60325_569_627_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.8913 78 128 1.10.10.410
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8867 1 77 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8489 2 79 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A7V9M0Y3-F1-model_v4 GatB/YqeY domain-containing protein 1.006 79 130 GO:0016884
AF-A0A655N0J4-F1-model_v4 deleted 0.9998 78 130
AF-A0A521KFC2-F1-model_v4 GatB/YqeY domain-containing protein 0.9937 78 128 GO:0016884
AF-A0A644ZSP8-F1-model_v4 GatB/YqeY domain-containing protein 0.9936 79 130 GO:0016884
AF-A0A7X6XU64-F1-model_v4 GatB/YqeY domain-containing protein 0.9901 78 128 GO:0016884

Map