F434837

General Info

Members Datasets Scaffolds Average Seq Length
401 227 802 414

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10051979|Ga0105237_100519792
Length 457
Sequence LRAAAPVARGDGGIITGNAELCLRRSTSHQAAAMTQAPIPAVPEDAFPPTIHHGTPAFRRTNLALFAAGFATFGLLYCVQPLMPEFGHDYGVSAAVSALSLSLTTGVLAFAMLFAGALSDACGRKSVMVWSLLSSAVLVLVSAAMPNWPALLAVRTLLGLTLSGLPAVAMTYLGEEMHVESIGLGMGLYISGSAVGGMGGRLITGVLTDFFGWRVGVLVVGAIGVLAGLIFWRALPPSRHFVAQPLRWRVVLGRFTGMFHDRGLPWLFVEGFLLLGAFVTVYNYLGYRLLAPPYKLSQAVVGLIFGIYLVGTFSSAWMGHLAGQLGRRKVLWTAFALMLAGVALTMTTPLLLVMLGIVAVTFGFFGGHSIVSSWVGRRAGASKAQASSVYLFCYYMGSSIAGASGGLFYAAHGWNGVALFVGALVLAGLLIALWLFRLPPLVNVATPPTPMSRGAMP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
55 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
67 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
211 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
212 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
213 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
214 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
215 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
216 2734482264 Dyella sp. AD052 Isolate Unclassified
217 2738543009 Luteibacter sp. OK325 Isolate Unclassified
218 2739367700 Dyella sp. YR388 Isolate Unclassified
219 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
220 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
221 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
222 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
223 2919085039 Luteibacter sp. 1214 Isolate Unclassified
224 2919404418 Luteibacter sp. 3190 Isolate Unclassified
225 2928963466 Dyella japonica 1073 Isolate Unclassified
226 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
227 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.01
Metatranscriptomes 0.5
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.95
Nodule 0
Rhizoplane 2.49
Rhizosphere 60.1
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10051979 3300009545 Bacteria 4115
2 JGI24739J22299_10005236 3300001989 Bacteria 4941
3 JGI25156J39149_1002284 3300002705 Bacteria 7036
4 JGI25162J39368_1000337 3300002737 Bacteria 41018
5 JGI25162J39368_1000359 3300002737 Bacteria 38881
6 JGI25162J39368_1000791 3300002737 Bacteria 21149
7 JGI25162J39368_1001178 3300002737 Bacteria 15473
8 JGI25162J39368_1005219 3300002737 Bacteria 2642
9 JGI25157J39369_1000298 3300002741 Bacteria 36141
10 JGI25157J39369_1000422 3300002741 Bacteria 27894
11 JGI25157J39369_1000436 3300002741 Bacteria 27040
12 JGI25157J39369_1003520 3300002741 Bacteria 3163
13 JGI25163J39215_1000222 3300002771 Bacteria 21223
14 JGI25164J39214_1000028 3300002772 Bacteria 150310
15 JGI25164J39214_1000553 3300002772 Bacteria 17152
16 JGI25164J39214_1000898 3300002772 Bacteria 9994
17 JGI25164J39214_1002618 3300002772 Bacteria 2642
18 JGI25165J46597_1000108 3300003214 Bacteria 150310
19 JGI25165J46597_1000643 3300003214 Bacteria 28939
20 JGI25165J46597_1005037 3300003214 Bacteria 2642
21 JGI25153J46596_10010462 3300003215 Bacteria 4192
22 rootH1_10025658 3300003316 Bacteria 5842
23 rootH2_10087311 3300003320 Bacteria 7002
24 rootH2_10327370 3300003320 Bacteria 1529
25 rootL2_10128903 3300003322 Bacteria 10515
26 rootH1_10302837 3300003323 Bacteria 4381
27 Ga0006562J51391_1078518 3300003578 Bacteria 8780
28 Ga0055539_1000474 3300003752 Bacteria 13173
29 Ga0055533_1001956 3300003756 Bacteria 5044
30 Ga0055525_1000233 3300003759 Bacteria 58310
31 Ga0055527_1000248 3300003760 Bacteria 33362
32 Ga0055527_1000399 3300003760 Bacteria 18402
33 Ga0055535_1000244 3300003761 Bacteria 57567
34 Ga0055535_1000398 3300003761 Bacteria 40844
35 Ga0055535_1000680 3300003761 Bacteria 26481
36 Ga0055535_1000805 3300003761 Bacteria 22731
37 Ga0055535_1002540 3300003761 Bacteria 6187
38 Ga0055542_1000167 3300003762 Bacteria 83068
39 Ga0055542_1000264 3300003762 Bacteria 58581
40 Ga0055542_1000366 3300003762 Bacteria 46858
41 Ga0055542_1000421 3300003762 Bacteria 41018
42 Ga0055542_1000768 3300003762 Bacteria 24278
43 Ga0055542_1000803 3300003762 Bacteria 23207
44 Ga0055529_1000078 3300003763 Bacteria 150310
45 Ga0055529_1000416 3300003763 Bacteria 43929
46 Ga0055529_1000448 3300003763 Bacteria 40848
47 Ga0055529_1000709 3300003763 Bacteria 22272
48 Ga0065165_1001770 3300005262 Bacteria 21418
49 Ga0070658_10238089 3300005327 Bacteria 1542
50 Ga0070680_100035410 3300005336 Bacteria 4030
51 Ga0070682_100067334 3300005337 Bacteria 2280
52 Ga0070660_100057529 3300005339 Bacteria 3012
53 Ga0070689_100022422 3300005340 Bacteria 4714
54 Ga0070687_100011574 3300005343 Unclassified 3864
55 Ga0070661_100038542 3300005344 Bacteria 3480
56 Ga0070661_100042712 3300005344 Bacteria 3309
57 Ga0070674_100173597 3300005356 Bacteria 1645
58 Ga0070659_100008216 3300005366 Bacteria 7621
59 Ga0070667_100193758 3300005367 Bacteria 1801
60 Ga0070709_10007745 3300005434 Bacteria 5898
61 Ga0070714_100000034 3300005435 Bacteria 130742
62 Ga0070714_100001388 3300005435 Bacteria 17551
63 Ga0070714_100004884 3300005435 Bacteria 10180
64 Ga0070714_100007730 3300005435 Bacteria 8374
65 Ga0070713_100001206 3300005436 Bacteria 16495
66 Ga0070713_100002432 3300005436 Bacteria 12142
67 Ga0070663_100042797 3300005455 Bacteria 3184
68 Ga0070681_10000970 3300005458 Bacteria 24216
69 Ga0070685_10017236 3300005466 Bacteria 3863
70 Ga0070679_100036497 3300005530 Bacteria 4877
71 Ga0070679_100042094 3300005530 Bacteria 4548
72 Ga0070684_100006404 3300005535 Bacteria 9108
73 Ga0068855_100001334 3300005563 Bacteria 30565
74 Ga0068855_100021905 3300005563 Bacteria 7660
75 Ga0068857_100000812 3300005577 Bacteria 23356
76 Ga0068854_100000279 3300005578 Bacteria 34224
77 Ga0068854_100006670 3300005578 Bacteria 7358
78 Ga0068856_100001540 3300005614 Bacteria 24168
79 Ga0068856_100002094 3300005614 Bacteria 20684
80 Ga0068852_100042935 3300005616 Bacteria 3831
81 Ga0068851_10010469 3300005834 Bacteria 4332
82 Ga0068860_100119066 3300005843 Unclassified 2528
83 Ga0070717_10092323 3300006028 Bacteria 2558
84 Ga0075369_10034741 3300006186 Bacteria 2141
85 Ga0105240_10001192 3300009093 Bacteria 45307
86 Ga0105240_10004332 3300009093 Bacteria 21665
87 Ga0105240_10020881 3300009093 Bacteria 8723
88 Ga0105240_10162883 3300009093 Bacteria 2648
89 Ga0105245_10109277 3300009098 Bacteria 2569
90 Ga0105237_10000026 3300009545 Bacteria 212619
91 Ga0105237_10000163 3300009545 Bacteria 94679
92 Ga0105238_10006659 3300009551 Bacteria 11522
93 Ga0105238_10109182 3300009551 Bacteria 2748
94 Ga0105238_10137228 3300009551 Bacteria 2424
95 Ga0105239_10000022 3300010375 Bacteria 257744
96 Ga0105239_10062237 3300010375 Bacteria 4096
97 Ga0157314_1000802 3300012500 Bacteria 2694
98 Ga0157339_1000155 3300012505 Bacteria 3224
99 Ga0157371_10004829 3300013102 Bacteria 11593
100 Ga0157370_10027505 3300013104 Bacteria 5607
101 Ga0157369_10046373 3300013105 Bacteria 4723
102 Ga0157378_10339978 3300013297 Bacteria 1463
103 Ga0157375_10013647 3300013308 Bacteria 7240
104 Ga0182008_10015620 3300014497 Bacteria 3958
105 Ga0182008_10020009 3300014497 Bacteria 3449
106 Ga0182008_10090589 3300014497 Bacteria 1507
107 Ga0157376_10070284 3300014969 Bacteria 2971
108 Ga0182006_1000027 3300015261 Bacteria 252946
109 Ga0182006_1004025 3300015261 Bacteria 7335
110 Ga0182007_10004554 3300015262 Bacteria 6266
111 Ga0182007_10015421 3300015262 Bacteria 2851
112 Ga0182007_10025899 3300015262 Bacteria 2039
113 Ga0182007_10035188 3300015262 Bacteria 1688
114 Ga0182005_1000055 3300015265 Bacteria 111824
115 Ga0182005_1003635 3300015265 Bacteria 5177
116 Ga0182005_1028672 3300015265 Bacteria 1518
117 Ga0183369_1009 3300015685 Bacteria 346348
118 Ga0183368_1004 3300015687 Bacteria 1211761
119 Ga0163161_10005048 3300017792 Bacteria 9181
120 Ga0163161_10213743 3300017792 Bacteria 1491
121 Ga0206353_10009317 3300020082 Bacteria 5337
122 Ga0213872_10000059 3300021361 Bacteria 100362
123 Ga0213872_10000296 3300021361 Bacteria 42414
124 Ga0213872_10010058 3300021361 Bacteria 4512
125 Ga0209760_100263 3300025207 Bacteria 19816
126 Ga0209784_100047 3300025224 Bacteria 199596
127 Ga0209674_100016 3300025226 Bacteria 696756
128 Ga0209674_100780 3300025226 Bacteria 10762
129 Ga0209672_100007 3300025228 Bacteria 959482
130 Ga0209672_100018 3300025228 Bacteria 432924
131 Ga0209672_100552 3300025228 Bacteria 20231
132 Ga0209672_101378 3300025228 Bacteria 9026
133 Ga0209563_100071 3300025230 Bacteria 232653
134 Ga0207427_100013 3300025231 Bacteria 581419
135 Ga0207427_100050 3300025231 Bacteria 227233
136 Ga0207427_100123 3300025231 Bacteria 98859
137 Ga0207427_102307 3300025231 Bacteria 5280
138 Ga0207427_103993 3300025231 Bacteria 2700
139 Ga0209437_100015 3300025233 Bacteria 713457
140 Ga0209437_100106 3300025233 Bacteria 219071
141 Ga0209437_100120 3300025233 Bacteria 205054
142 Ga0209437_100227 3300025233 Bacteria 98939
143 Ga0209437_103785 3300025233 Bacteria 2700
144 Ga0209258_100017 3300025242 Bacteria 590785
145 Ga0209258_100024 3300025242 Bacteria 542096
146 Ga0209258_100035 3300025242 Bacteria 430864
147 Ga0209258_100043 3300025242 Bacteria 380685
148 Ga0209258_100379 3300025242 Bacteria 57256
149 Ga0209646_1001124 3300025246 Bacteria 7870
150 Ga0209646_1002617 3300025246 Bacteria 3875
151 Ga0209026_1000047 3300025250 Bacteria 261867
152 Ga0209026_1000056 3300025250 Bacteria 236450
153 Ga0209026_1000158 3300025250 Bacteria 106333
154 Ga0209026_1000479 3300025250 Bacteria 30135
155 Ga0209677_101418 3300025253 Bacteria 10376
156 Ga0209148_1000002 3300025254 Bacteria 2399500
157 Ga0209148_1000009 3300025254 Bacteria 1395625
158 Ga0209148_1000010 3300025254 Bacteria 1265567
159 Ga0209148_1000044 3300025254 Bacteria 458417
160 Ga0209148_1000045 3300025254 Bacteria 448076
161 Ga0209148_1000048 3300025254 Bacteria 430913
162 Ga0209759_1000166 3300025256 Bacteria 113080
163 Ga0209759_1000254 3300025256 Bacteria 78852
164 Ga0209759_1000606 3300025256 Bacteria 34660
165 Ga0209129_1000572 3300025258 Bacteria 25388
166 Ga0209233_1000009 3300025261 Bacteria 1265567
167 Ga0209233_1000174 3300025261 Bacteria 144639
168 Ga0209233_1000184 3300025261 Bacteria 134246
169 Ga0209233_1000419 3300025261 Bacteria 32032
170 Ga0209233_1010894 3300025261 Bacteria 2700
171 Ga0209455_1000010 3300025272 Bacteria 959482
172 Ga0209455_1000020 3300025272 Bacteria 702259
173 Ga0209455_1000029 3300025272 Bacteria 542096
174 Ga0209455_1000035 3300025272 Bacteria 479071
175 Ga0209455_1000218 3300025272 Bacteria 79966
176 Ga0209455_1006412 3300025272 Bacteria 3476
177 Ga0209758_1000266 3300025297 Bacteria 104007
178 Ga0209758_1013276 3300025297 Bacteria 4510
179 Ga0209758_1031007 3300025297 Bacteria 2202
180 Ga0209051_1004767 3300025303 Bacteria 8193
181 Ga0207656_10048241 3300025321 Bacteria 1833
182 Ga0207647_10011002 3300025904 Bacteria 6365
183 Ga0207647_10043433 3300025904 Bacteria 2813
184 Ga0207705_10092932 3300025909 Bacteria 2211
185 Ga0207654_10108294 3300025911 Bacteria 1724
186 Ga0207707_10000732 3300025912 Bacteria 32480
187 Ga0207707_10002714 3300025912 Bacteria 15807
188 Ga0207695_10001108 3300025913 Bacteria 46826
189 Ga0207695_10002149 3300025913 Bacteria 29878
190 Ga0207671_10000041 3300025914 Bacteria 216095
191 Ga0207671_10001413 3300025914 Bacteria 27891
192 Ga0207693_10079818 3300025915 Bacteria 2561
193 Ga0207660_10031095 3300025917 Bacteria 3673
194 Ga0207657_10042418 3300025919 Bacteria 4014
195 Ga0207649_10049840 3300025920 Bacteria 2588
196 Ga0207652_10061087 3300025921 Bacteria 3253
197 Ga0207700_10006328 3300025928 Bacteria 7140
198 Ga0207700_10015412 3300025928 Bacteria 5043
199 Ga0207664_10000021 3300025929 Bacteria 216875
200 Ga0207664_10005417 3300025929 Bacteria 8715
201 Ga0207664_10065468 3300025929 Bacteria 2910
202 Ga0207690_10000384 3300025932 Bacteria 29204
203 Ga0207690_10064547 3300025932 Bacteria 2500
204 Ga0207706_10033934 3300025933 Bacteria 4542
205 Ga0207706_10170777 3300025933 Bacteria 1911
206 Ga0207670_10000976 3300025936 Bacteria 15090
207 Ga0207691_10108576 3300025940 Bacteria 2469
208 Ga0207661_10072864 3300025944 Bacteria 2811
209 Ga0207667_10000157 3300025949 Bacteria 101449
210 Ga0207667_10000176 3300025949 Bacteria 93425
211 Ga0207667_10017817 3300025949 Bacteria 7985
212 Ga0207667_10066590 3300025949 Bacteria 3754
213 Ga0207668_10022311 3300025972 Bacteria 4051
214 Ga0207640_10000235 3300025981 Bacteria 37928
215 Ga0207640_10002073 3300025981 Bacteria 10805
216 Ga0207640_10012273 3300025981 Bacteria 4875
217 Ga0207702_10000290 3300026078 Bacteria 58330
218 Ga0207702_10000958 3300026078 Bacteria 29656
219 Ga0207648_10120113 3300026089 Bacteria 2310
220 Ga0207674_10001266 3300026116 Bacteria 33027
221 Ga0207674_10037238 3300026116 Bacteria 5062
222 Ga0207674_10116503 3300026116 Bacteria 2643
223 Ga0307408_100004839 3300031548 Bacteria 9067
224 Ga0307405_10151844 3300031731 Bacteria 1630
225 Ga0307412_10005587 3300031911 Bacteria 7058
226 Ga0373957_0011047 3300035120 Bacteria 3003
227 Ga0373955_0003905 3300035172 Bacteria 6576
228 Ga0373933_0003260 3300035724 Bacteria 9072
229 Ga0373937_0006120 3300036401 Bacteria 10360
230 Ga0395899_0017923 3300037312 Bacteria 5388
231 Ga0395899_0075390 3300037312 Bacteria 2463
232 Ga0395900_0000107 3300037418 Bacteria 149024
233 Ga0395898_0000078 3300037466 Bacteria 244514
234 Ga0395898_0000211 3300037466 Bacteria 149301
235 Ga0395898_0007669 3300037466 Bacteria 11460
236 Ga0395898_0033697 3300037466 Bacteria 5108
237 Ga0395901_0002837 3300038443 Bacteria 17501
238 Ga0395901_0016349 3300038443 Bacteria 7555
239 Ga0395901_0020948 3300038443 Bacteria 6698
240 Ga0395901_0023122 3300038443 Bacteria 6371
241 Ga0436365_1737045 3300039437 Bacteria 1766
242 Ga0436361_0680023 3300039447 Bacteria 10290
243 Ga0439436_0000069 3300041404 Bacteria 28567
244 Ga0451793_0355983 3300041452 Bacteria 4276
245 Ga0450908_000072 3300042184 Bacteria 20011
246 Ga0466969_0007760 3300044656 Bacteria 5705
247 Ga0466969_0072045 3300044656 Bacteria 1660
248 Ga0466982_0000009 3300044672 Bacteria 221166
249 Ga0466966_0009396 3300044684 Bacteria 6473
250 Ga0466961_0001488 3300044693 Bacteria 14542
251 Ga0466961_0010434 3300044693 Bacteria 5928
252 Ga0466961_0017177 3300044693 Bacteria 4648
253 Ga0466961_0141073 3300044693 Bacteria 1508
254 Ga0466971_0004577 3300044719 Bacteria 5974
255 Ga0466971_0006712 3300044719 Bacteria 5007
256 Ga0466968_0000690 3300044735 Bacteria 11652
257 Ga0466970_0001491 3300044765 Bacteria 11257
258 Ga0466970_0029728 3300044765 Bacteria 2878
259 Ga0466970_0035523 3300044765 Bacteria 2640
260 Ga0466957_0009096 3300044842 Bacteria 5662
261 Ga0466960_0002539 3300044901 Bacteria 6859
262 Ga0466959_0000172 3300045049 Bacteria 42574
263 Ga0466959_0010756 3300045049 Bacteria 6555
264 Ga0466958_0009348 3300045836 Bacteria 5463
265 Ga0466958_0019621 3300045836 Bacteria 3935
266 Ga0466958_0020025 3300045836 Bacteria 3899
267 Ga0495617_000792 3300046452 Bacteria 15271
268 Ga0495617_001010 3300046452 Bacteria 13004
269 Ga0495592_0041293 3300046454 Bacteria 3457
270 Ga0495638_0000007 3300046460 Bacteria 602783
271 Ga0495638_0000155 3300046460 Bacteria 108696
272 Ga0495638_0000509 3300046460 Bacteria 45817
273 Ga0495650_0000109 3300046471 Bacteria 199925
274 Ga0495650_0000610 3300046471 Bacteria 48766
275 Ga0495650_0002378 3300046471 Bacteria 15439
276 Ga0495584_0002324 3300046491 Bacteria 10837
277 Ga0495585_0000069 3300046492 Bacteria 106677
278 Ga0495585_0037643 3300046492 Bacteria 2724
279 Ga0495594_0033518 3300046499 Bacteria 2793
280 Ga0495607_0000019 3300046501 Bacteria 167319
281 Ga0495607_0000072 3300046501 Bacteria 100135
282 Ga0495583_0008827 3300046506 Bacteria 6104
283 Ga0495606_0000164 3300046507 Bacteria 116768
284 Ga0495606_0000385 3300046507 Bacteria 74818
285 Ga0495606_0000745 3300046507 Bacteria 50308
286 Ga0495606_0027265 3300046507 Bacteria 4055
287 Ga0495610_0007296 3300046512 Bacteria 7397
288 Ga0495616_0000089 3300046513 Bacteria 77466
289 Ga0495620_0000773 3300046515 Bacteria 19629
290 Ga0495620_0001267 3300046515 Bacteria 15406
291 Ga0495631_0000070 3300046518 Bacteria 64592
292 Ga0495631_0004745 3300046518 Bacteria 7181
293 Ga0495632_0009585 3300046519 Bacteria 5822
294 Ga0495637_0012051 3300046520 Bacteria 4144
295 Ga0495648_0000615 3300046524 Bacteria 38076
296 Ga0495609_0002690 3300046538 Bacteria 10735
297 Ga0495645_0000342 3300046543 Bacteria 33033
298 Ga0495667_0013565 3300046559 Bacteria 5513
299 Ga0495611_0000001 3300046648 Bacteria 2628469
300 Ga0495611_0001827 3300046648 Bacteria 10181
301 Ga0495625_0000001 3300046660 Bacteria 1641829
302 Ga0495661_0000103 3300046665 Bacteria 104642
303 Ga0495670_0010426 3300046691 Bacteria 4565
304 Ga0495649_0001964 3300046694 Bacteria 14915
305 Ga0495589_0000063 3300046794 Bacteria 103565
306 Ga0495660_0000275 3300046810 Bacteria 48406
307 Ga0495660_0001017 3300046810 Bacteria 20366
308 Ga0495683_0001265 3300047323 Bacteria 17137
309 Ga0495675_0002505 3300047444 Bacteria 10993
310 Ga0495679_000001 3300047446 Bacteria 1607568
311 Ga0495673_0000001 3300047469 Bacteria 1630730
312 Ga0495673_0000010 3300047469 Bacteria 709599
313 Ga0495673_0002050 3300047469 Bacteria 14749
314 Ga0495684_0019280 3300047471 Bacteria 5252
315 Ga0495686_0000085 3300047472 Bacteria 198128
316 Ga0495686_0002615 3300047472 Bacteria 16685
317 Ga0495686_0009560 3300047472 Bacteria 6969
318 Ga0495686_0034203 3300047472 Bacteria 3275
319 Ga0496101_0000524 3300048904 Bacteria 23879
320 Ga0496101_0004559 3300048904 Bacteria 8751
321 Ga0496102_0130929 3300048905 Bacteria 2348
322 Ga0496105_0010586 3300048908 Bacteria 7255
323 Ga0496106_0008767 3300048909 Bacteria 7473
324 Ga0496115_0000024 3300048918 Bacteria 154488
325 Ga0496115_0000103 3300048918 Bacteria 80518
326 Ga0496115_0002397 3300048918 Bacteria 13443
327 Ga0496115_0044987 3300048918 Bacteria 3523
328 Ga0496117_0006122 3300048920 Bacteria 12311
329 Ga0496118_0001001 3300048921 Bacteria 44080
330 Ga0496118_0003091 3300048921 Bacteria 21343
331 Ga0496118_0006548 3300048921 Bacteria 12738
332 Ga0496119_0001207 3300048922 Bacteria 32260
333 Ga0496119_0010398 3300048922 Bacteria 7838
334 Ga0496119_0102959 3300048922 Bacteria 1599
335 Ga0496120_0000167 3300048923 Bacteria 110734
336 Ga0496120_0000868 3300048923 Bacteria 42806
337 Ga0496121_0000532 3300048924 Bacteria 72417
338 Ga0496121_0001051 3300048924 Bacteria 48973
339 Ga0496121_0007075 3300048924 Bacteria 13623
340 Ga0496121_0007806 3300048924 Bacteria 12812
341 Ga0496121_0023340 3300048924 Bacteria 5962
342 Ga0496121_0025375 3300048924 Bacteria 5626
343 Ga0496121_0031228 3300048924 Bacteria 4870
344 Ga0496122_0021055 3300048925 Bacteria 5857
345 Ga0496123_0011718 3300048926 Bacteria 7562
346 Ga0496124_0017380 3300048927 Bacteria 6778
347 Ga0496125_0000198 3300048928 Bacteria 127026
348 Ga0496126_0000581 3300048929 Bacteria 69541
349 Ga0496126_0017932 3300048929 Bacteria 7040
350 Ga0496126_0100696 3300048929 Bacteria 2528
351 Ga0496126_0264715 3300048929 Bacteria 1428
352 Ga0495678_000180 3300049459 Bacteria 72870
353 Ga0495682_0000960 3300049460 Bacteria 17377
354 Ga0495682_0017726 3300049460 Bacteria 2684
355 Ga0501031_0019807 3300049568 Bacteria 4385
356 Ga0501032_0032749 3300049569 Bacteria 3561
357 Ga0501033_0023667 3300049570 Bacteria 4632
358 Ga0501033_0063344 3300049570 Bacteria 2721
359 Ga0501036_0038396 3300049572 Bacteria 4053
360 Ga0501038_0029138 3300049574 Bacteria 4895
361 Ga0501043_0021836 3300049579 Bacteria 5020
362 Ga0501043_0028659 3300049579 Bacteria 4371
363 Ga0501043_0125755 3300049579 Bacteria 2010
364 Ga0501046_0005762 3300049580 Bacteria 11059
365 Ga0501046_0164777 3300049580 Bacteria 1665
366 Ga0501047_0025898 3300049581 Bacteria 5639
367 Ga0501047_0179261 3300049581 Bacteria 1985
368 Ga0501048_0009469 3300049582 Bacteria 7312
369 Ga0501069_0000801 3300049585 Bacteria 14826
370 Ga0501070_0082959 3300049586 Bacteria 2653
371 Ga0501035_0040342 3300049822 Bacteria 4219
372 Ga0501035_0064740 3300049822 Bacteria 3248
373 Ga0501044_0004650 3300049823 Bacteria 15359
374 Ga0501044_0005494 3300049823 Bacteria 14083
375 Ga0501044_0037331 3300049823 Bacteria 5078
376 Ga0501044_0133419 3300049823 Bacteria 2476
377 Ga0500643_000080 3300053087 Bacteria 103235
378 Ga0500555_000031 3300053103 Bacteria 99406
379 Ga0500618_000078 3300053125 Bacteria 79833
380 Ga0500633_0020992 3300053160 Bacteria 1979
381 Ga0500645_010290 3300053730 Bacteria 3101
382 Ga0466962_0022534 3300061719 Bacteria 3026
383 Ga0466962_0037700 3300061719 Bacteria 2315
384 2538834016 2537561836 Bacteria 3910579
385 2595451738 2593339239 Bacteria 4124669
386 2643830679 2643221562 Bacteria 4048635
387 2643894118 2643221577 Bacteria 3710843
388 2644476321 2643221685 Bacteria 3673288
389 2687582484 2687453130 Bacteria 4227172
390 2735836331 2734482264 Unclassified 5014763
391 2739227589 2738543009 Bacteria 4944499
392 2739730710 2739367700 Bacteria 4747630
393 2842915423 2842914999 Bacteria 4419378
394 2842921754 2842918807 Bacteria 4289178
395 2884340004 2884338543 Bacteria 4610696
396 2895396670 2895395659 Bacteria 3983269
397 2919085932 2919085039 Bacteria 4532964
398 2919404818 2919404418 Bacteria 4232372
399 2928964220 2928963466 Bacteria 5165703
400 2939614540 2939611941 Bacteria 3892017
401 2953997770 2953994433 Bacteria 4303959
402 Ga0105237_10051979
403 JGI24739J22299_10005236
404 JGI25156J39149_1002284
405 JGI25162J39368_1000337
406 JGI25162J39368_1000359
407 JGI25162J39368_1000791
408 JGI25162J39368_1001178
409 JGI25162J39368_1005219
410 JGI25157J39369_1000298
411 JGI25157J39369_1000422
412 JGI25157J39369_1000436
413 JGI25157J39369_1003520
414 JGI25163J39215_1000222
415 JGI25164J39214_1000028
416 JGI25164J39214_1000553
417 JGI25164J39214_1000898
418 JGI25164J39214_1002618
419 JGI25165J46597_1000108
420 JGI25165J46597_1000643
421 JGI25165J46597_1005037
422 JGI25153J46596_10010462
423 rootH1_10025658
424 rootH2_10087311
425 rootH2_10327370
426 rootL2_10128903
427 rootH1_10302837
428 Ga0006562J51391_1078518
429 Ga0055539_1000474
430 Ga0055533_1001956
431 Ga0055525_1000233
432 Ga0055527_1000248
433 Ga0055527_1000399
434 Ga0055535_1000244
435 Ga0055535_1000398
436 Ga0055535_1000680
437 Ga0055535_1000805
438 Ga0055535_1002540
439 Ga0055542_1000167
440 Ga0055542_1000264
441 Ga0055542_1000366
442 Ga0055542_1000421
443 Ga0055542_1000768
444 Ga0055542_1000803
445 Ga0055529_1000078
446 Ga0055529_1000416
447 Ga0055529_1000448
448 Ga0055529_1000709
449 Ga0065165_1001770
450 Ga0070658_10238089
451 Ga0070680_100035410
452 Ga0070682_100067334
453 Ga0070660_100057529
454 Ga0070689_100022422
455 Ga0070687_100011574
456 Ga0070661_100038542
457 Ga0070661_100042712
458 Ga0070674_100173597
459 Ga0070659_100008216
460 Ga0070667_100193758
461 Ga0070709_10007745
462 Ga0070714_100000034
463 Ga0070714_100001388
464 Ga0070714_100004884
465 Ga0070714_100007730
466 Ga0070713_100001206
467 Ga0070713_100002432
468 Ga0070663_100042797
469 Ga0070681_10000970
470 Ga0070685_10017236
471 Ga0070679_100036497
472 Ga0070679_100042094
473 Ga0070684_100006404
474 Ga0068855_100001334
475 Ga0068855_100021905
476 Ga0068857_100000812
477 Ga0068854_100000279
478 Ga0068854_100006670
479 Ga0068856_100001540
480 Ga0068856_100002094
481 Ga0068852_100042935
482 Ga0068851_10010469
483 Ga0068860_100119066
484 Ga0070717_10092323
485 Ga0075369_10034741
486 Ga0105240_10001192
487 Ga0105240_10004332
488 Ga0105240_10020881
489 Ga0105240_10162883
490 Ga0105245_10109277
491 Ga0105237_10000026
492 Ga0105237_10000163
493 Ga0105238_10006659
494 Ga0105238_10109182
495 Ga0105238_10137228
496 Ga0105239_10000022
497 Ga0105239_10062237
498 Ga0157314_1000802
499 Ga0157339_1000155
500 Ga0157371_10004829
501 Ga0157370_10027505
502 Ga0157369_10046373
503 Ga0157378_10339978
504 Ga0157375_10013647
505 Ga0182008_10015620
506 Ga0182008_10020009
507 Ga0182008_10090589
508 Ga0157376_10070284
509 Ga0182006_1000027
510 Ga0182006_1004025
511 Ga0182007_10004554
512 Ga0182007_10015421
513 Ga0182007_10025899
514 Ga0182007_10035188
515 Ga0182005_1000055
516 Ga0182005_1003635
517 Ga0182005_1028672
518 Ga0183369_1009
519 Ga0183368_1004
520 Ga0163161_10005048
521 Ga0163161_10213743
522 Ga0206353_10009317
523 Ga0213872_10000059
524 Ga0213872_10000296
525 Ga0213872_10010058
526 Ga0209760_100263
527 Ga0209784_100047
528 Ga0209674_100016
529 Ga0209674_100780
530 Ga0209672_100007
531 Ga0209672_100018
532 Ga0209672_100552
533 Ga0209672_101378
534 Ga0209563_100071
535 Ga0207427_100013
536 Ga0207427_100050
537 Ga0207427_100123
538 Ga0207427_102307
539 Ga0207427_103993
540 Ga0209437_100015
541 Ga0209437_100106
542 Ga0209437_100120
543 Ga0209437_100227
544 Ga0209437_103785
545 Ga0209258_100017
546 Ga0209258_100024
547 Ga0209258_100035
548 Ga0209258_100043
549 Ga0209258_100379
550 Ga0209646_1001124
551 Ga0209646_1002617
552 Ga0209026_1000047
553 Ga0209026_1000056
554 Ga0209026_1000158
555 Ga0209026_1000479
556 Ga0209677_101418
557 Ga0209148_1000002
558 Ga0209148_1000009
559 Ga0209148_1000010
560 Ga0209148_1000044
561 Ga0209148_1000045
562 Ga0209148_1000048
563 Ga0209759_1000166
564 Ga0209759_1000254
565 Ga0209759_1000606
566 Ga0209129_1000572
567 Ga0209233_1000009
568 Ga0209233_1000174
569 Ga0209233_1000184
570 Ga0209233_1000419
571 Ga0209233_1010894
572 Ga0209455_1000010
573 Ga0209455_1000020
574 Ga0209455_1000029
575 Ga0209455_1000035
576 Ga0209455_1000218
577 Ga0209455_1006412
578 Ga0209758_1000266
579 Ga0209758_1013276
580 Ga0209758_1031007
581 Ga0209051_1004767
582 Ga0207656_10048241
583 Ga0207647_10011002
584 Ga0207647_10043433
585 Ga0207705_10092932
586 Ga0207654_10108294
587 Ga0207707_10000732
588 Ga0207707_10002714
589 Ga0207695_10001108
590 Ga0207695_10002149
591 Ga0207671_10000041
592 Ga0207671_10001413
593 Ga0207693_10079818
594 Ga0207660_10031095
595 Ga0207657_10042418
596 Ga0207649_10049840
597 Ga0207652_10061087
598 Ga0207700_10006328
599 Ga0207700_10015412
600 Ga0207664_10000021
601 Ga0207664_10005417
602 Ga0207664_10065468
603 Ga0207690_10000384
604 Ga0207690_10064547
605 Ga0207706_10033934
606 Ga0207706_10170777
607 Ga0207670_10000976
608 Ga0207691_10108576
609 Ga0207661_10072864
610 Ga0207667_10000157
611 Ga0207667_10000176
612 Ga0207667_10017817
613 Ga0207667_10066590
614 Ga0207668_10022311
615 Ga0207640_10000235
616 Ga0207640_10002073
617 Ga0207640_10012273
618 Ga0207702_10000290
619 Ga0207702_10000958
620 Ga0207648_10120113
621 Ga0207674_10001266
622 Ga0207674_10037238
623 Ga0207674_10116503
624 Ga0307408_100004839
625 Ga0307405_10151844
626 Ga0307412_10005587
627 Ga0373957_0011047
628 Ga0373955_0003905
629 Ga0373933_0003260
630 Ga0373937_0006120
631 Ga0395899_0017923
632 Ga0395899_0075390
633 Ga0395900_0000107
634 Ga0395898_0000078
635 Ga0395898_0000211
636 Ga0395898_0007669
637 Ga0395898_0033697
638 Ga0395901_0002837
639 Ga0395901_0016349
640 Ga0395901_0020948
641 Ga0395901_0023122
642 Ga0436365_1737045
643 Ga0436361_0680023
644 Ga0439436_0000069
645 Ga0451793_0355983
646 Ga0450908_000072
647 Ga0466969_0007760
648 Ga0466969_0072045
649 Ga0466982_0000009
650 Ga0466966_0009396
651 Ga0466961_0001488
652 Ga0466961_0010434
653 Ga0466961_0017177
654 Ga0466961_0141073
655 Ga0466971_0004577
656 Ga0466971_0006712
657 Ga0466968_0000690
658 Ga0466970_0001491
659 Ga0466970_0029728
660 Ga0466970_0035523
661 Ga0466957_0009096
662 Ga0466960_0002539
663 Ga0466959_0000172
664 Ga0466959_0010756
665 Ga0466958_0009348
666 Ga0466958_0019621
667 Ga0466958_0020025
668 Ga0495617_000792
669 Ga0495617_001010
670 Ga0495592_0041293
671 Ga0495638_0000007
672 Ga0495638_0000155
673 Ga0495638_0000509
674 Ga0495650_0000109
675 Ga0495650_0000610
676 Ga0495650_0002378
677 Ga0495584_0002324
678 Ga0495585_0000069
679 Ga0495585_0037643
680 Ga0495594_0033518
681 Ga0495607_0000019
682 Ga0495607_0000072
683 Ga0495583_0008827
684 Ga0495606_0000164
685 Ga0495606_0000385
686 Ga0495606_0000745
687 Ga0495606_0027265
688 Ga0495610_0007296
689 Ga0495616_0000089
690 Ga0495620_0000773
691 Ga0495620_0001267
692 Ga0495631_0000070
693 Ga0495631_0004745
694 Ga0495632_0009585
695 Ga0495637_0012051
696 Ga0495648_0000615
697 Ga0495609_0002690
698 Ga0495645_0000342
699 Ga0495667_0013565
700 Ga0495611_0000001
701 Ga0495611_0001827
702 Ga0495625_0000001
703 Ga0495661_0000103
704 Ga0495670_0010426
705 Ga0495649_0001964
706 Ga0495589_0000063
707 Ga0495660_0000275
708 Ga0495660_0001017
709 Ga0495683_0001265
710 Ga0495675_0002505
711 Ga0495679_000001
712 Ga0495673_0000001
713 Ga0495673_0000010
714 Ga0495673_0002050
715 Ga0495684_0019280
716 Ga0495686_0000085
717 Ga0495686_0002615
718 Ga0495686_0009560
719 Ga0495686_0034203
720 Ga0496101_0000524
721 Ga0496101_0004559
722 Ga0496102_0130929
723 Ga0496105_0010586
724 Ga0496106_0008767
725 Ga0496115_0000024
726 Ga0496115_0000103
727 Ga0496115_0002397
728 Ga0496115_0044987
729 Ga0496117_0006122
730 Ga0496118_0001001
731 Ga0496118_0003091
732 Ga0496118_0006548
733 Ga0496119_0001207
734 Ga0496119_0010398
735 Ga0496119_0102959
736 Ga0496120_0000167
737 Ga0496120_0000868
738 Ga0496121_0000532
739 Ga0496121_0001051
740 Ga0496121_0007075
741 Ga0496121_0007806
742 Ga0496121_0023340
743 Ga0496121_0025375
744 Ga0496121_0031228
745 Ga0496122_0021055
746 Ga0496123_0011718
747 Ga0496124_0017380
748 Ga0496125_0000198
749 Ga0496126_0000581
750 Ga0496126_0017932
751 Ga0496126_0100696
752 Ga0496126_0264715
753 Ga0495678_000180
754 Ga0495682_0000960
755 Ga0495682_0017726
756 Ga0501031_0019807
757 Ga0501032_0032749
758 Ga0501033_0023667
759 Ga0501033_0063344
760 Ga0501036_0038396
761 Ga0501038_0029138
762 Ga0501043_0021836
763 Ga0501043_0028659
764 Ga0501043_0125755
765 Ga0501046_0005762
766 Ga0501046_0164777
767 Ga0501047_0025898
768 Ga0501047_0179261
769 Ga0501048_0009469
770 Ga0501069_0000801
771 Ga0501070_0082959
772 Ga0501035_0040342
773 Ga0501035_0064740
774 Ga0501044_0004650
775 Ga0501044_0005494
776 Ga0501044_0037331
777 Ga0501044_0133419
778 Ga0500643_000080
779 Ga0500555_000031
780 Ga0500618_000078
781 Ga0500633_0020992
782 Ga0500645_010290
783 Ga0466962_0022534
784 Ga0466962_0037700
785 2538834016
786 2595451738
787 2643830679
788 2643894118
789 2644476321
790 2687582484
791 2735836331
792 2739227589
793 2739730710
794 2842915423
795 2842921754
796 2884340004
797 2895396670
798 2919085932
799 2919404818
800 2928964220
801 2939614540
802 2953997770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

65

298

0.86

PF07690

MFS_1

Major Facilitator Superfamily

273

455

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8615 21 394
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8564 20 391
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8484 21 394
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8431 20 391
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.8346 22 395
ID Description Score Start End Superfamily
af_P43531_29_411_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9587 16 391 1.20.1250.20
af_P43531_29_411_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9392 16 391 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9253 18 190 1.20.1250.20
af_P0AA80_9_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.923 16 190 1.20.1250.20
af_Q2FVB9_1_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.92 18 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A857J6V0-F1-model_v4 MFS transporter 0.9728 22 392 GO:0005886
GO:0022857
AF-A0A1C6R6A8-F1-model_v4 MFS transporter, YNFM family, putative membrane transport protein 0.971 8 390 GO:0005886
GO:0022857
AF-A0A7K3BWN4-F1-model_v4 deleted 0.9697 25 390
AF-A0A520HSG7-F1-model_v4 MFS transporter 0.9688 29 360 GO:0005886
GO:0022857
AF-A0A6J5EHN5-F1-model_v4 Inner membrane transport protein YnfM 0.9673 29 392 GO:0005886
GO:0022857

Map