F434694

General Info

Members Datasets Scaffolds Average Seq Length
400 206 800 240

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0101614|Ga0501071_0101614_1234_1953
Length 232
Sequence MTGAEAEDFSQPILEGGAPSDYERYLNTEGLLALQKDEGEWVHRDELLFQVTHQSSELWLKLCWNDAAEAVRLIEGGDVERASLCLRFVTAQLDMLERMSPWEYQEIRKVLGHGSGFDSPGWRELRHVFPRLGQAFHAARRDAGLSLADVYVRGREHEHLYRLAEALIELDESAQHWRMRHYQVVARVIGDKVVGTQGTPVELLGRLIATTSFPELWEVRNELTALSKAGGE

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
123 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 6
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0101614 3300049587 Bacteria 2120
2 JGI24742J22300_10022548 3300002244 Bacteria 1080
3 Ga0070690_100104712 3300005330 Bacteria 1880
4 Ga0068869_100101388 3300005334 Bacteria 2178
5 Ga0070682_100010991 3300005337 Bacteria 5160
6 Ga0068868_100182952 3300005338 Bacteria 1740
7 Ga0070660_100282013 3300005339 Bacteria 1359
8 Ga0070689_100004985 3300005340 Bacteria 9017
9 Ga0070687_100038210 3300005343 Bacteria 2405
10 Ga0070692_10008356 3300005345 Bacteria 4615
11 Ga0070668_100028333 3300005347 Bacteria 4253
12 Ga0070671_100020685 3300005355 Bacteria 5369
13 Ga0070674_100002922 3300005356 Bacteria 9469
14 Ga0070688_100294078 3300005365 Bacteria 1171
15 Ga0070703_10009630 3300005406 Bacteria 2726
16 Ga0070709_10075562 3300005434 Bacteria 2186
17 Ga0070714_100004981 3300005435 Bacteria 10094
18 Ga0070710_10006595 3300005437 Bacteria 5581
19 Ga0070711_100013852 3300005439 Bacteria 5072
20 Ga0070711_100059434 3300005439 Unclassified 2654
21 Ga0070705_100063739 3300005440 Bacteria 2199
22 Ga0070694_100243779 3300005444 Bacteria 1356
23 Ga0070708_100141872 3300005445 Bacteria 2228
24 Ga0070663_100010832 3300005455 Bacteria 5696
25 Ga0070678_100009860 3300005456 Bacteria 5806
26 Ga0070662_100129183 3300005457 Bacteria 1946
27 Ga0070681_10066667 3300005458 Bacteria 3569
28 Ga0070681_10365182 3300005458 Bacteria 1354
29 Ga0068867_100041026 3300005459 Bacteria 3381
30 Ga0070706_100016309 3300005467 Bacteria 6863
31 Ga0070707_100025348 3300005468 Bacteria 5625
32 Ga0070698_100028053 3300005471 Bacteria 5851
33 Ga0070699_100016142 3300005518 Bacteria 6410
34 Ga0070699_100727645 3300005518 Bacteria 907
35 Ga0070684_100353545 3300005535 Bacteria 1352
36 Ga0070697_100571307 3300005536 Bacteria 992
37 Ga0068853_100046705 3300005539 Bacteria 3714
38 Ga0070672_100013176 3300005543 Bacteria 5831
39 Ga0070686_100002266 3300005544 Bacteria 10613
40 Ga0070696_100004361 3300005546 Bacteria 9426
41 Ga0070665_100431442 3300005548 Bacteria 1327
42 Ga0070704_100011759 3300005549 Bacteria 5380
43 Ga0070664_100489466 3300005564 Bacteria 1133
44 Ga0068856_100007363 3300005614 Bacteria 10740
45 Ga0068856_100340962 3300005614 Bacteria 1517
46 Ga0068852_100012004 3300005616 Bacteria 6554
47 Ga0068859_100015862 3300005617 Bacteria 7571
48 Ga0068866_10001111 3300005718 Bacteria 11823
49 Ga0081455_10018448 3300005937 Bacteria 6647
50 Ga0081455_10031568 3300005937 Bacteria 4790
51 Ga0081455_10068429 3300005937 Bacteria 2955
52 Ga0081455_10416508 3300005937 Bacteria 928
53 Ga0081538_10025631 3300005981 Bacteria 4149
54 Ga0075365_10047113 3300006038 Bacteria 2833
55 Ga0075364_10348787 3300006051 Bacteria 1009
56 Ga0075432_10008153 3300006058 Bacteria 3572
57 Ga0070712_100083477 3300006175 Bacteria 2320
58 Ga0075362_10151438 3300006177 Bacteria 1113
59 Ga0097621_100006395 3300006237 Bacteria 8361
60 Ga0068871_100018197 3300006358 Bacteria 5335
61 Ga0075428_100025915 3300006844 Bacteria 6494
62 Ga0075428_100297247 3300006844 Bacteria 1736
63 Ga0075430_100001591 3300006846 Bacteria 18560
64 Ga0075430_100189130 3300006846 Bacteria 1711
65 Ga0075431_100021677 3300006847 Bacteria 6570
66 Ga0075431_100062357 3300006847 Unclassified 3847
67 Ga0075431_100131686 3300006847 Bacteria 2579
68 Ga0075431_100282394 3300006847 Bacteria 1681
69 Ga0075433_10002951 3300006852 Bacteria 13059
70 Ga0075433_10365439 3300006852 Bacteria 1274
71 Ga0075434_100011556 3300006871 Bacteria 8333
72 Ga0075434_100143838 3300006871 Bacteria 2405
73 Ga0075429_100060090 3300006880 Bacteria 3311
74 Ga0075429_100207526 3300006880 Bacteria 1716
75 Ga0068865_100005601 3300006881 Bacteria 7621
76 Ga0075436_100000915 3300006914 Bacteria 19663
77 Ga0075436_100150814 3300006914 Bacteria 1636
78 Ga0097620_100015862 3300006931 Bacteria 7571
79 Ga0075435_100005131 3300007076 Bacteria 9104
80 Ga0075435_100105292 3300007076 Bacteria 2341
81 Ga0111539_10019581 3300009094 Bacteria 8350
82 Ga0111539_10030962 3300009094 Bacteria 6500
83 Ga0105245_10005009 3300009098 Bacteria 11643
84 Ga0105245_10048464 3300009098 Bacteria 3800
85 Ga0114129_10000141 3300009147 Bacteria 75420
86 Ga0114129_10015064 3300009147 Bacteria 11007
87 Ga0114129_10061083 3300009147 Bacteria 5267
88 Ga0114129_10063715 3300009147 Bacteria 5146
89 Ga0114129_10337474 3300009147 Bacteria 2000
90 Ga0114129_10882766 3300009147 Bacteria 1134
91 Ga0105243_10014145 3300009148 Bacteria 6036
92 Ga0105243_10467922 3300009148 Bacteria 1187
93 Ga0105241_10108816 3300009174 Bacteria 2216
94 Ga0105248_10036786 3300009177 Bacteria 5475
95 Ga0105237_10429079 3300009545 Bacteria 1327
96 Ga0105239_10011750 3300010375 Bacteria 9774
97 Ga0157374_10005632 3300013296 Bacteria 10556
98 Ga0157378_10056064 3300013297 Bacteria 3511
99 Ga0163162_10015512 3300013306 Bacteria 7446
100 Ga0157375_10180663 3300013308 Bacteria 2261
101 Ga0157380_10036544 3300014326 Bacteria 3801
102 Ga0157380_10380007 3300014326 Bacteria 1333
103 Ga0207653_10009407 3300025885 Bacteria 3043
104 Ga0207642_10026967 3300025899 Bacteria 2346
105 Ga0207684_10070887 3300025910 Bacteria 2962
106 Ga0207693_10000468 3300025915 Bacteria 36863
107 Ga0207652_10118667 3300025921 Bacteria 2352
108 Ga0207652_10198760 3300025921 Bacteria 1804
109 Ga0207646_10009003 3300025922 Bacteria 9924
110 Ga0207681_10351624 3300025923 Bacteria 1180
111 Ga0207664_10004970 3300025929 Bacteria 9047
112 Ga0207644_10031772 3300025931 Bacteria 3681
113 Ga0207706_10169632 3300025933 Bacteria 1918
114 Ga0207686_10002592 3300025934 Bacteria 9812
115 Ga0207709_10024298 3300025935 Bacteria 3459
116 Ga0207669_10026304 3300025937 Bacteria 3162
117 Ga0207691_10004591 3300025940 Bacteria 13375
118 Ga0207667_10191816 3300025949 Bacteria 2097
119 Ga0207668_10005999 3300025972 Bacteria 7161
120 Ga0207677_10025652 3300026023 Unclassified 3681
121 Ga0207703_10212746 3300026035 Bacteria 1725
122 Ga0207708_10015929 3300026075 Bacteria 5646
123 Ga0207702_10056110 3300026078 Bacteria 3343
124 Ga0207702_10910485 3300026078 Bacteria 871
125 Ga0207648_10003561 3300026089 Bacteria 16283
126 Ga0207675_100087117 3300026118 Bacteria 2932
127 Ga0207428_10013525 3300027907 Bacteria 7126
128 Ga0268266_10094587 3300028379 Bacteria 2623
129 Ga0265319_1017271 3300028563 Bacteria 2746
130 Ga0265319_1066193 3300028563 Bacteria 1164
131 Ga0265319_1118437 3300028563 Archaea 826
132 Ga0265336_10006003 3300028666 Bacteria 4426
133 Ga0265338_10201860 3300028800 Unclassified 1499
134 Ga0265338_10261347 3300028800 Bacteria 1272
135 Ga0265338_10319937 3300028800 Bacteria 1123
136 Ga0265320_10178013 3300031240 Bacteria 954
137 Ga0265316_10043562 3300031344 Bacteria 3576
138 Ga0307405_10079442 3300031731 Bacteria 2138
139 Ga0307405_10628594 3300031731 Bacteria 880
140 Ga0307410_10424142 3300031852 Bacteria 1080
141 Ga0307407_10054920 3300031903 Bacteria 2299
142 Ga0307412_10130432 3300031911 Unclassified 1825
143 Ga0307409_100194765 3300031995 Unclassified 1808
144 Ga0307409_100220774 3300031995 Bacteria 1711
145 Ga0307409_100310907 3300031995 Bacteria 1470
146 Ga0307416_100346334 3300032002 Bacteria 1501
147 Ga0307416_100550968 3300032002 Bacteria 1226
148 Ga0307416_100756092 3300032002 Bacteria 1065
149 Ga0307416_101269125 3300032002 Unclassified 842
150 Ga0307414_10079614 3300032004 Bacteria 2393
151 Ga0307411_10309533 3300032005 Bacteria 1270
152 Ga0307415_100047235 3300032126 Bacteria 2897
153 Ga0307415_100122421 3300032126 Bacteria 1953
154 Ga0307415_100192441 3300032126 Unclassified 1611
155 Ga0316583_10054602 3300032133 Unclassified 1405
156 Ga0395899_0021695 3300037312 Bacteria 4870
157 Ga0395899_0076734 3300037312 Bacteria 2439
158 Ga0395899_0099519 3300037312 Bacteria 2100
159 Ga0395899_0175872 3300037312 Bacteria 1505
160 Ga0395900_0036818 3300037418 Bacteria 5044
161 Ga0395900_0216899 3300037418 Bacteria 1930
162 Ga0395900_0666330 3300037418 Bacteria 976
163 Ga0395898_0008888 3300037466 Bacteria 10583
164 Ga0395898_0035254 3300037466 Bacteria 4978
165 Ga0395898_0365489 3300037466 Bacteria 1376
166 Ga0395905_0003053 3300037471 Bacteria 18137
167 Ga0395905_0037949 3300037471 Bacteria 4521
168 Ga0395905_0095429 3300037471 Bacteria 2791
169 Ga0395905_0285649 3300037471 Bacteria 1537
170 Ga0395905_0666165 3300037471 Bacteria 943
171 Ga0395901_0005294 3300038443 Bacteria 13040
172 Ga0395901_0016341 3300038443 Bacteria 7558
173 Ga0395901_0166603 3300038443 Unclassified 2313
174 Ga0436363_0513363 3300039450 Bacteria 1391
175 Ga0439461_0016718 3300041410 Bacteria 1420
176 Ga0450910_006121 3300042147 Bacteria 1654
177 Ga0439446_0000145 3300042156 Bacteria 12387
178 Ga0439446_0001288 3300042156 Bacteria 5635
179 Ga0439434_0002589 3300042435 Bacteria 5265
180 Ga0439435_0047570 3300042436 Bacteria 1219
181 Ga0450918_016579 3300042531 Bacteria 1281
182 Ga0466965_0056920 3300044683 Bacteria 1948
183 Ga0466966_0010213 3300044684 Bacteria 6227
184 Ga0466961_0426085 3300044693 Bacteria 804
185 Ga0466964_0022398 3300044706 Bacteria 2451
186 Ga0466964_0035878 3300044706 Unclassified 1985
187 Ga0466960_0014230 3300044901 Unclassified 3400
188 Ga0466959_0046258 3300045049 Unclassified 3203
189 Ga0466967_0016261 3300045976 Bacteria 5860
190 Ga0466967_0025521 3300045976 Bacteria 4875
191 Ga0466967_0062670 3300045976 Bacteria 3301
192 Ga0495603_0028918 3300046455 Bacteria 3343
193 Ga0495641_0031277 3300046461 Bacteria 2544
194 Ga0495580_0080251 3300046472 Bacteria 2275
195 Ga0495585_0064187 3300046492 Bacteria 2014
196 Ga0495656_0260873 3300046615 Bacteria 878
197 Ga0495658_0141790 3300046683 Bacteria 1470
198 Ga0495670_0084512 3300046691 Bacteria 1620
199 Ga0495670_0095396 3300046691 Bacteria 1526
200 Ga0495589_0073781 3300046794 Unclassified 1665
201 Ga0495680_0411484 3300047322 Bacteria 932
202 Ga0496100_0333005 3300048903 Bacteria 1143
203 Ga0496101_0097370 3300048904 Bacteria 2197
204 Ga0496102_0001949 3300048905 Bacteria 17792
205 Ga0496102_0168662 3300048905 Bacteria 2061
206 Ga0496102_0283816 3300048905 Bacteria 1560
207 Ga0496102_0461431 3300048905 Bacteria 1191
208 Ga0496103_0017949 3300048906 Bacteria 4240
209 Ga0496103_0027101 3300048906 Bacteria 3471
210 Ga0496104_0035761 3300048907 Bacteria 4639
211 Ga0496105_0117948 3300048908 Bacteria 2189
212 Ga0496106_0017688 3300048909 Bacteria 5271
213 Ga0496106_0073716 3300048909 Bacteria 2612
214 Ga0496106_0189681 3300048909 Bacteria 1634
215 Ga0496107_0235865 3300048910 Bacteria 1361
216 Ga0496108_0031584 3300048911 Bacteria 4395
217 Ga0496108_0081150 3300048911 Bacteria 2748
218 Ga0496109_0026077 3300048912 Bacteria 5209
219 Ga0496109_0981491 3300048912 Bacteria 782
220 Ga0496110_0088048 3300048913 Bacteria 2773
221 Ga0496111_0027484 3300048914 Bacteria 4025
222 Ga0496112_0015263 3300048915 Bacteria 7162
223 Ga0496112_0167155 3300048915 Bacteria 2165
224 Ga0496114_0008013 3300048917 Bacteria 8359
225 Ga0496115_0230971 3300048918 Bacteria 1525
226 Ga0501031_0023107 3300049568 Bacteria 4055
227 Ga0501031_0029579 3300049568 Bacteria 3573
228 Ga0501031_0037741 3300049568 Bacteria 3153
229 Ga0501031_0061631 3300049568 Bacteria 2444
230 Ga0501032_0004991 3300049569 Bacteria 9922
231 Ga0501032_0023525 3300049569 Bacteria 4254
232 Ga0501032_0028787 3300049569 Bacteria 3815
233 Ga0501033_0021340 3300049570 Bacteria 4885
234 Ga0501033_0028343 3300049570 Bacteria 4207
235 Ga0501033_0033805 3300049570 Bacteria 3839
236 Ga0501034_0119813 3300049571 Bacteria 2618
237 Ga0501036_0000796 3300049572 Bacteria 23409
238 Ga0501036_0032263 3300049572 Bacteria 4425
239 Ga0501036_0085233 3300049572 Bacteria 2670
240 Ga0501036_0174599 3300049572 Bacteria 1809
241 Ga0501036_0269804 3300049572 Bacteria 1425
242 Ga0501036_0511082 3300049572 Bacteria 999
243 Ga0501037_0022450 3300049573 Bacteria 4668
244 Ga0501037_0030586 3300049573 Bacteria 3978
245 Ga0501037_0076688 3300049573 Bacteria 2426
246 Ga0501037_0140040 3300049573 Bacteria 1732
247 Ga0501037_0214744 3300049573 Bacteria 1355
248 Ga0501038_0022830 3300049574 Bacteria 5600
249 Ga0501038_0052136 3300049574 Bacteria 3528
250 Ga0501038_0079947 3300049574 Bacteria 2756
251 Ga0501038_0108013 3300049574 Bacteria 2308
252 Ga0501039_0001835 3300049575 Bacteria 15694
253 Ga0501039_0010498 3300049575 Bacteria 7057
254 Ga0501039_0027478 3300049575 Bacteria 4375
255 Ga0501039_0075152 3300049575 Bacteria 2626
256 Ga0501039_0102093 3300049575 Bacteria 2238
257 Ga0501040_0005264 3300049576 Bacteria 8364
258 Ga0501040_0005939 3300049576 Bacteria 7905
259 Ga0501040_0007837 3300049576 Bacteria 6920
260 Ga0501040_0015188 3300049576 Bacteria 5088
261 Ga0501040_0310988 3300049576 Bacteria 1126
262 Ga0501041_0000834 3300049577 Bacteria 16540
263 Ga0501041_0001226 3300049577 Bacteria 14049
264 Ga0501041_0005599 3300049577 Bacteria 7342
265 Ga0501041_0018389 3300049577 Bacteria 4165
266 Ga0501041_0019667 3300049577 Bacteria 4033
267 Ga0501042_0000802 3300049578 Bacteria 17288
268 Ga0501042_0006821 3300049578 Bacteria 7447
269 Ga0501042_0012215 3300049578 Bacteria 5811
270 Ga0501042_0060948 3300049578 Bacteria 2695
271 Ga0501042_0083182 3300049578 Bacteria 2295
272 Ga0501042_0287325 3300049578 Unclassified 1188
273 Ga0501043_0017364 3300049579 Bacteria 5643
274 Ga0501043_0026900 3300049579 Bacteria 4514
275 Ga0501043_0037726 3300049579 Bacteria 3800
276 Ga0501046_0024981 3300049580 Bacteria 4894
277 Ga0501046_0033109 3300049580 Bacteria 4179
278 Ga0501046_0054237 3300049580 Bacteria 3154
279 Ga0501046_0118675 3300049580 Bacteria 2014
280 Ga0501047_0245235 3300049581 Bacteria 1641
281 Ga0501048_0000416 3300049582 Bacteria 29823
282 Ga0501048_0014406 3300049582 Bacteria 5854
283 Ga0501048_0016101 3300049582 Bacteria 5514
284 Ga0501048_0138149 3300049582 Bacteria 1722
285 Ga0501067_0091272 3300049583 Bacteria 1691
286 Ga0501068_0004238 3300049584 Bacteria 7781
287 Ga0501068_0021191 3300049584 Bacteria 3794
288 Ga0501068_0050626 3300049584 Bacteria 2511
289 Ga0501069_0001074 3300049585 Bacteria 13145
290 Ga0501069_0106545 3300049585 Bacteria 1593
291 Ga0501069_0185434 3300049585 Bacteria 1203
292 Ga0501070_0010335 3300049586 Bacteria 7889
293 Ga0501070_0016127 3300049586 Bacteria 6280
294 Ga0501071_0016880 3300049587 Bacteria 5022
295 Ga0501071_0020362 3300049587 Bacteria 4608
296 Ga0501071_0020702 3300049587 Bacteria 4573
297 Ga0501072_0000832 3300049588 Bacteria 22731
298 Ga0501072_0010075 3300049588 Bacteria 7192
299 Ga0501072_0019598 3300049588 Bacteria 5231
300 Ga0501072_0020975 3300049588 Bacteria 5065
301 Ga0501072_0155757 3300049588 Bacteria 1822
302 Ga0501072_0631087 3300049588 Bacteria 844
303 Ga0501073_0009749 3300049589 Bacteria 7071
304 Ga0501073_0026490 3300049589 Bacteria 4154
305 Ga0501073_0202091 3300049589 Bacteria 1374
306 Ga0501074_0009183 3300049590 Bacteria 7182
307 Ga0501074_0018283 3300049590 Bacteria 5092
308 Ga0501074_0021624 3300049590 Bacteria 4670
309 Ga0501074_0192189 3300049590 Bacteria 1455
310 Ga0501075_0004138 3300049591 Bacteria 9789
311 Ga0501075_0021089 3300049591 Bacteria 4747
312 Ga0501075_0026935 3300049591 Bacteria 4234
313 Ga0501075_0106099 3300049591 Bacteria 2135
314 Ga0501075_0109692 3300049591 Bacteria 2098
315 Ga0501076_0000227 3300049592 Bacteria 34085
316 Ga0501076_0001380 3300049592 Bacteria 16264
317 Ga0501076_0038055 3300049592 Bacteria 3775
318 Ga0501076_0106494 3300049592 Bacteria 2263
319 Ga0501076_0160796 3300049592 Bacteria 1829
320 Ga0501077_0001842 3300049593 Bacteria 12829
321 Ga0501077_0004340 3300049593 Bacteria 8596
322 Ga0501077_0012654 3300049593 Bacteria 5283
323 Ga0501077_0027051 3300049593 Bacteria 3642
324 Ga0501077_0037673 3300049593 Bacteria 3079
325 Ga0501077_0045800 3300049593 Bacteria 2779
326 Ga0501077_0105650 3300049593 Bacteria 1784
327 Ga0501079_0000406 3300049741 Bacteria 27883
328 Ga0501079_0012952 3300049741 Bacteria 6360
329 Ga0501079_0194938 3300049741 Bacteria 1581
330 Ga0501079_0225979 3300049741 Bacteria 1462
331 Ga0501080_0035292 3300049742 Bacteria 4667
332 Ga0501080_0036741 3300049742 Bacteria 4572
333 Ga0501080_0052566 3300049742 Bacteria 3791
334 Ga0501081_0007392 3300049743 Bacteria 7129
335 Ga0501081_0019000 3300049743 Bacteria 4570
336 Ga0501081_0019164 3300049743 Bacteria 4551
337 Ga0501081_0059470 3300049743 Bacteria 2646
338 Ga0501081_0123817 3300049743 Bacteria 1843
339 Ga0501081_0406775 3300049743 Unclassified 1008
340 Ga0501083_0002237 3300049744 Bacteria 13226
341 Ga0501083_0022074 3300049744 Bacteria 4418
342 Ga0501083_0083421 3300049744 Bacteria 2117
343 Ga0501035_0024545 3300049822 Bacteria 5528
344 Ga0501035_0037852 3300049822 Bacteria 4366
345 Ga0501035_0082113 3300049822 Bacteria 2844
346 Ga0501035_0179910 3300049822 Bacteria 1822
347 Ga0501044_0236446 3300049823 Bacteria 1772
348 Ga0501044_0327251 3300049823 Bacteria 1456
349 Ga0501044_0382806 3300049823 Bacteria 1322
350 Ga0501045_0004523 3300049824 Bacteria 9611
351 Ga0501045_0020967 3300049824 Bacteria 4672
352 Ga0501045_0029821 3300049824 Bacteria 3944
353 Ga0501045_0610164 3300049824 Bacteria 808
354 Ga0501045_0670405 3300049824 Bacteria 766
355 nmdc:mga0yw44_230470_c1 3300050492 Bacteria 1229
356 nmdc:mga05p37_15939_c1 3300050507 Bacteria 9040
357 nmdc:mga05p37_31352_c1 3300050507 Bacteria 6493
358 nmdc:mga05p37_345670_c1 3300050507 Bacteria 1753
359 nmdc:mga05p37_51634_c1 3300050507 Bacteria 5055
360 nmdc:mga05p37_67615_c1 3300050507 Bacteria 4396
361 nmdc:mga05p37_701251_c1 3300050507 Bacteria 1124
362 nmdc:mga09592_123964_c1 3300050508 Bacteria 2221
363 nmdc:mga09592_253119_c1 3300050508 Bacteria 1527
364 nmdc:mga09592_8522_c1 3300050508 Bacteria 8341
365 nmdc:mga0qj67_21389_c1 3300050509 Bacteria 4963
366 nmdc:mga0qj67_552249_c1 3300050509 Unclassified 924
367 nmdc:mga0qj67_99529_c1 3300050509 Bacteria 2343
368 nmdc:mga06r32_149853_c1 3300050510 Bacteria 2311
369 nmdc:mga06r32_160387_c1 3300050510 Bacteria 2231
370 nmdc:mga06r32_26472_c1 3300050510 Bacteria 5407
371 nmdc:mga06r32_284289_c1 3300050510 Bacteria 1641
372 nmdc:mga08y16_14829_c1 3300050511 Bacteria 8195
373 nmdc:mga08y16_310729_c1 3300050511 Bacteria 1623
374 nmdc:mga08y16_78038_c1 3300050511 Bacteria 3453
375 nmdc:mga0n895_119560_c1 3300050512 Bacteria 2656
376 nmdc:mga0n895_287098_c1 3300050512 Bacteria 1668
377 nmdc:mga0n895_706968_c1 3300050512 Bacteria 1003
378 nmdc:mga0rr50_15491_c1 3300050513 Bacteria 5035
379 nmdc:mga0rr50_160073_c1 3300050513 Bacteria 1826
380 nmdc:mga0rr50_372_c1 3300050513 Bacteria 24510
381 nmdc:mga08x19_28594_c1 3300050514 Bacteria 3492
382 nmdc:mga0a205_2975_c1 3300050515 Bacteria 15039
383 Ga0501084_0002775 3300054114 Bacteria 14152
384 Ga0501084_0011922 3300054114 Bacteria 7197
385 Ga0501084_0026971 3300054114 Bacteria 4799
386 Ga0501084_0031671 3300054114 Bacteria 4421
387 Ga0501084_0162119 3300054114 Bacteria 1886
388 Ga0501084_0393261 3300054114 Bacteria 1171
389 Ga0590071_003831 3300059421 Bacteria 3689
390 Ga0590074_009630 3300059423 Bacteria 1610
391 Ga0590077_023486 3300059426 Bacteria 1320
392 Ga0501082_0016677 3300060353 Bacteria 6325
393 Ga0501082_0024083 3300060353 Bacteria 5250
394 Ga0501082_0026385 3300060353 Bacteria 5005
395 Ga0501082_0178031 3300060353 Bacteria 1849
396 Ga0530510_0002206 3300061734 Bacteria 13362
397 Ga0530510_0005990 3300061734 Bacteria 8435
398 Ga0530510_0018409 3300061734 Bacteria 4951
399 Ga0530510_0019301 3300061734 Bacteria 4838
400 Ga0530510_0403333 3300061734 Bacteria 1031
401 Ga0501071_0101614
402 JGI24742J22300_10022548
403 Ga0070690_100104712
404 Ga0068869_100101388
405 Ga0070682_100010991
406 Ga0068868_100182952
407 Ga0070660_100282013
408 Ga0070689_100004985
409 Ga0070687_100038210
410 Ga0070692_10008356
411 Ga0070668_100028333
412 Ga0070671_100020685
413 Ga0070674_100002922
414 Ga0070688_100294078
415 Ga0070703_10009630
416 Ga0070709_10075562
417 Ga0070714_100004981
418 Ga0070710_10006595
419 Ga0070711_100013852
420 Ga0070711_100059434
421 Ga0070705_100063739
422 Ga0070694_100243779
423 Ga0070708_100141872
424 Ga0070663_100010832
425 Ga0070678_100009860
426 Ga0070662_100129183
427 Ga0070681_10066667
428 Ga0070681_10365182
429 Ga0068867_100041026
430 Ga0070706_100016309
431 Ga0070707_100025348
432 Ga0070698_100028053
433 Ga0070699_100016142
434 Ga0070699_100727645
435 Ga0070684_100353545
436 Ga0070697_100571307
437 Ga0068853_100046705
438 Ga0070672_100013176
439 Ga0070686_100002266
440 Ga0070696_100004361
441 Ga0070665_100431442
442 Ga0070704_100011759
443 Ga0070664_100489466
444 Ga0068856_100007363
445 Ga0068856_100340962
446 Ga0068852_100012004
447 Ga0068859_100015862
448 Ga0068866_10001111
449 Ga0081455_10018448
450 Ga0081455_10031568
451 Ga0081455_10068429
452 Ga0081455_10416508
453 Ga0081538_10025631
454 Ga0075365_10047113
455 Ga0075364_10348787
456 Ga0075432_10008153
457 Ga0070712_100083477
458 Ga0075362_10151438
459 Ga0097621_100006395
460 Ga0068871_100018197
461 Ga0075428_100025915
462 Ga0075428_100297247
463 Ga0075430_100001591
464 Ga0075430_100189130
465 Ga0075431_100021677
466 Ga0075431_100062357
467 Ga0075431_100131686
468 Ga0075431_100282394
469 Ga0075433_10002951
470 Ga0075433_10365439
471 Ga0075434_100011556
472 Ga0075434_100143838
473 Ga0075429_100060090
474 Ga0075429_100207526
475 Ga0068865_100005601
476 Ga0075436_100000915
477 Ga0075436_100150814
478 Ga0097620_100015862
479 Ga0075435_100005131
480 Ga0075435_100105292
481 Ga0111539_10019581
482 Ga0111539_10030962
483 Ga0105245_10005009
484 Ga0105245_10048464
485 Ga0114129_10000141
486 Ga0114129_10015064
487 Ga0114129_10061083
488 Ga0114129_10063715
489 Ga0114129_10337474
490 Ga0114129_10882766
491 Ga0105243_10014145
492 Ga0105243_10467922
493 Ga0105241_10108816
494 Ga0105248_10036786
495 Ga0105237_10429079
496 Ga0105239_10011750
497 Ga0157374_10005632
498 Ga0157378_10056064
499 Ga0163162_10015512
500 Ga0157375_10180663
501 Ga0157380_10036544
502 Ga0157380_10380007
503 Ga0207653_10009407
504 Ga0207642_10026967
505 Ga0207684_10070887
506 Ga0207693_10000468
507 Ga0207652_10118667
508 Ga0207652_10198760
509 Ga0207646_10009003
510 Ga0207681_10351624
511 Ga0207664_10004970
512 Ga0207644_10031772
513 Ga0207706_10169632
514 Ga0207686_10002592
515 Ga0207709_10024298
516 Ga0207669_10026304
517 Ga0207691_10004591
518 Ga0207667_10191816
519 Ga0207668_10005999
520 Ga0207677_10025652
521 Ga0207703_10212746
522 Ga0207708_10015929
523 Ga0207702_10056110
524 Ga0207702_10910485
525 Ga0207648_10003561
526 Ga0207675_100087117
527 Ga0207428_10013525
528 Ga0268266_10094587
529 Ga0265319_1017271
530 Ga0265319_1066193
531 Ga0265319_1118437
532 Ga0265336_10006003
533 Ga0265338_10201860
534 Ga0265338_10261347
535 Ga0265338_10319937
536 Ga0265320_10178013
537 Ga0265316_10043562
538 Ga0307405_10079442
539 Ga0307405_10628594
540 Ga0307410_10424142
541 Ga0307407_10054920
542 Ga0307412_10130432
543 Ga0307409_100194765
544 Ga0307409_100220774
545 Ga0307409_100310907
546 Ga0307416_100346334
547 Ga0307416_100550968
548 Ga0307416_100756092
549 Ga0307416_101269125
550 Ga0307414_10079614
551 Ga0307411_10309533
552 Ga0307415_100047235
553 Ga0307415_100122421
554 Ga0307415_100192441
555 Ga0316583_10054602
556 Ga0395899_0021695
557 Ga0395899_0076734
558 Ga0395899_0099519
559 Ga0395899_0175872
560 Ga0395900_0036818
561 Ga0395900_0216899
562 Ga0395900_0666330
563 Ga0395898_0008888
564 Ga0395898_0035254
565 Ga0395898_0365489
566 Ga0395905_0003053
567 Ga0395905_0037949
568 Ga0395905_0095429
569 Ga0395905_0285649
570 Ga0395905_0666165
571 Ga0395901_0005294
572 Ga0395901_0016341
573 Ga0395901_0166603
574 Ga0436363_0513363
575 Ga0439461_0016718
576 Ga0450910_006121
577 Ga0439446_0000145
578 Ga0439446_0001288
579 Ga0439434_0002589
580 Ga0439435_0047570
581 Ga0450918_016579
582 Ga0466965_0056920
583 Ga0466966_0010213
584 Ga0466961_0426085
585 Ga0466964_0022398
586 Ga0466964_0035878
587 Ga0466960_0014230
588 Ga0466959_0046258
589 Ga0466967_0016261
590 Ga0466967_0025521
591 Ga0466967_0062670
592 Ga0495603_0028918
593 Ga0495641_0031277
594 Ga0495580_0080251
595 Ga0495585_0064187
596 Ga0495656_0260873
597 Ga0495658_0141790
598 Ga0495670_0084512
599 Ga0495670_0095396
600 Ga0495589_0073781
601 Ga0495680_0411484
602 Ga0496100_0333005
603 Ga0496101_0097370
604 Ga0496102_0001949
605 Ga0496102_0168662
606 Ga0496102_0283816
607 Ga0496102_0461431
608 Ga0496103_0017949
609 Ga0496103_0027101
610 Ga0496104_0035761
611 Ga0496105_0117948
612 Ga0496106_0017688
613 Ga0496106_0073716
614 Ga0496106_0189681
615 Ga0496107_0235865
616 Ga0496108_0031584
617 Ga0496108_0081150
618 Ga0496109_0026077
619 Ga0496109_0981491
620 Ga0496110_0088048
621 Ga0496111_0027484
622 Ga0496112_0015263
623 Ga0496112_0167155
624 Ga0496114_0008013
625 Ga0496115_0230971
626 Ga0501031_0023107
627 Ga0501031_0029579
628 Ga0501031_0037741
629 Ga0501031_0061631
630 Ga0501032_0004991
631 Ga0501032_0023525
632 Ga0501032_0028787
633 Ga0501033_0021340
634 Ga0501033_0028343
635 Ga0501033_0033805
636 Ga0501034_0119813
637 Ga0501036_0000796
638 Ga0501036_0032263
639 Ga0501036_0085233
640 Ga0501036_0174599
641 Ga0501036_0269804
642 Ga0501036_0511082
643 Ga0501037_0022450
644 Ga0501037_0030586
645 Ga0501037_0076688
646 Ga0501037_0140040
647 Ga0501037_0214744
648 Ga0501038_0022830
649 Ga0501038_0052136
650 Ga0501038_0079947
651 Ga0501038_0108013
652 Ga0501039_0001835
653 Ga0501039_0010498
654 Ga0501039_0027478
655 Ga0501039_0075152
656 Ga0501039_0102093
657 Ga0501040_0005264
658 Ga0501040_0005939
659 Ga0501040_0007837
660 Ga0501040_0015188
661 Ga0501040_0310988
662 Ga0501041_0000834
663 Ga0501041_0001226
664 Ga0501041_0005599
665 Ga0501041_0018389
666 Ga0501041_0019667
667 Ga0501042_0000802
668 Ga0501042_0006821
669 Ga0501042_0012215
670 Ga0501042_0060948
671 Ga0501042_0083182
672 Ga0501042_0287325
673 Ga0501043_0017364
674 Ga0501043_0026900
675 Ga0501043_0037726
676 Ga0501046_0024981
677 Ga0501046_0033109
678 Ga0501046_0054237
679 Ga0501046_0118675
680 Ga0501047_0245235
681 Ga0501048_0000416
682 Ga0501048_0014406
683 Ga0501048_0016101
684 Ga0501048_0138149
685 Ga0501067_0091272
686 Ga0501068_0004238
687 Ga0501068_0021191
688 Ga0501068_0050626
689 Ga0501069_0001074
690 Ga0501069_0106545
691 Ga0501069_0185434
692 Ga0501070_0010335
693 Ga0501070_0016127
694 Ga0501071_0016880
695 Ga0501071_0020362
696 Ga0501071_0020702
697 Ga0501072_0000832
698 Ga0501072_0010075
699 Ga0501072_0019598
700 Ga0501072_0020975
701 Ga0501072_0155757
702 Ga0501072_0631087
703 Ga0501073_0009749
704 Ga0501073_0026490
705 Ga0501073_0202091
706 Ga0501074_0009183
707 Ga0501074_0018283
708 Ga0501074_0021624
709 Ga0501074_0192189
710 Ga0501075_0004138
711 Ga0501075_0021089
712 Ga0501075_0026935
713 Ga0501075_0106099
714 Ga0501075_0109692
715 Ga0501076_0000227
716 Ga0501076_0001380
717 Ga0501076_0038055
718 Ga0501076_0106494
719 Ga0501076_0160796
720 Ga0501077_0001842
721 Ga0501077_0004340
722 Ga0501077_0012654
723 Ga0501077_0027051
724 Ga0501077_0037673
725 Ga0501077_0045800
726 Ga0501077_0105650
727 Ga0501079_0000406
728 Ga0501079_0012952
729 Ga0501079_0194938
730 Ga0501079_0225979
731 Ga0501080_0035292
732 Ga0501080_0036741
733 Ga0501080_0052566
734 Ga0501081_0007392
735 Ga0501081_0019000
736 Ga0501081_0019164
737 Ga0501081_0059470
738 Ga0501081_0123817
739 Ga0501081_0406775
740 Ga0501083_0002237
741 Ga0501083_0022074
742 Ga0501083_0083421
743 Ga0501035_0024545
744 Ga0501035_0037852
745 Ga0501035_0082113
746 Ga0501035_0179910
747 Ga0501044_0236446
748 Ga0501044_0327251
749 Ga0501044_0382806
750 Ga0501045_0004523
751 Ga0501045_0020967
752 Ga0501045_0029821
753 Ga0501045_0610164
754 Ga0501045_0670405
755 nmdc:mga0yw44_230470_c1
756 nmdc:mga05p37_15939_c1
757 nmdc:mga05p37_31352_c1
758 nmdc:mga05p37_345670_c1
759 nmdc:mga05p37_51634_c1
760 nmdc:mga05p37_67615_c1
761 nmdc:mga05p37_701251_c1
762 nmdc:mga09592_123964_c1
763 nmdc:mga09592_253119_c1
764 nmdc:mga09592_8522_c1
765 nmdc:mga0qj67_21389_c1
766 nmdc:mga0qj67_552249_c1
767 nmdc:mga0qj67_99529_c1
768 nmdc:mga06r32_149853_c1
769 nmdc:mga06r32_160387_c1
770 nmdc:mga06r32_26472_c1
771 nmdc:mga06r32_284289_c1
772 nmdc:mga08y16_14829_c1
773 nmdc:mga08y16_310729_c1
774 nmdc:mga08y16_78038_c1
775 nmdc:mga0n895_119560_c1
776 nmdc:mga0n895_287098_c1
777 nmdc:mga0n895_706968_c1
778 nmdc:mga0rr50_15491_c1
779 nmdc:mga0rr50_160073_c1
780 nmdc:mga0rr50_372_c1
781 nmdc:mga08x19_28594_c1
782 nmdc:mga0a205_2975_c1
783 Ga0501084_0002775
784 Ga0501084_0011922
785 Ga0501084_0026971
786 Ga0501084_0031671
787 Ga0501084_0162119
788 Ga0501084_0393261
789 Ga0590071_003831
790 Ga0590074_009630
791 Ga0590077_023486
792 Ga0501082_0016677
793 Ga0501082_0024083
794 Ga0501082_0026385
795 Ga0501082_0178031
796 Ga0530510_0002206
797 Ga0530510_0005990
798 Ga0530510_0018409
799 Ga0530510_0019301
800 Ga0530510_0403333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

7

135

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e2a-assembly1.cif.gz_C asp81leu enzyme iia from the lactose specific pts from lactococcus lactis 0.9485 56 102
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.8962 62 99
3bk9-assembly2.cif.gz_F h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris 0.8902 28 234
6a09-assembly1.cif.gz_A salmonella typhi yfdx in the p222 space group 0.8783 61 99
2nox-assembly3.cif.gz_I crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.8777 28 235
ID Description Score Start End Superfamily
af_Q94K88_63_147_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9726 60 98 1.25.40.10
3u8vB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.9545 64 102 1.20.120.660
2e2aC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9485 56 102 1.20.58.80
2lrkA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.936 56 107 1.20.58.80
1wcrC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8871 54 110 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A521T6A1-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9819 17 241 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A2V9U0P4-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9746 18 242 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A1I3N0L6-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9646 33 238 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A6V8LBX3-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9645 34 237 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A535C5V8-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9638 56 244 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872

Map