F434647

General Info

Members Datasets Scaffolds Average Seq Length
400 305 272 382

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0030704|Ga0466970_0030704_908_2263
Length 438
Sequence MGARQSQGSGRLKPLSRLAAQRPRGAAAGPSIFTAPEKMKIQNADEYRLDDHGKAHSPGLENTRSLEETNDMASSDTFTTGTFVGRIWRPDVEGPALVTVRDGTLYDITSKDAPFVRAQKGEAVAKLGGLLSAKADVASVHLLAPIDLQAIKACGVTFARSMLERVIEERAAGNPDLAEAIRGKVTALIGDSLRNLKAGSPEALKVKAALIEEGVWSQYLEVGIGPDAEVFSKSQVMSSVGPGADVGLHPISKWNNPEPEIVLAVDSRGRVKGATLGNDVNLRDVEGRSALLLGKAKDNNASCSIGPFIRLFDETYDLDDVRNADLDLKVEGEDGYVLHGRSSMKEISRDPLDLVSQTIGRHHQYPDGFVLFMGTLFAPVEDRDTPGQGFTHKAGDIVTISNNKLGALQNRVLLSTECPPWTFGASHLMRNLARRGLI

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
5 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
6 2519103095 Burkholderia sp. KJ006 Isolate Nodule
7 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
8 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
9 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
10 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
11 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
12 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
13 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
14 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
15 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
16 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
17 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
18 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
19 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
20 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
21 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
22 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
23 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
24 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
25 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
26 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
27 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
28 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
29 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
30 2643221607 Rhizobium sp. Root73 Isolate Unclassified
31 2643221610 Ensifer sp. Root74 Isolate Unclassified
32 2643221618 Ensifer sp. Root231 Isolate Unclassified
33 2643221626 Ensifer sp. Root31 Isolate Unclassified
34 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
35 2643221655 Ensifer sp. Root1252 Isolate Unclassified
36 2643221659 Ensifer sp. Root127 Isolate Unclassified
37 2643221675 Ensifer sp. Root1298 Isolate Unclassified
38 2643221680 Ensifer sp. Root1312 Isolate Unclassified
39 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
40 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
41 2643221698 Ensifer sp. Root142 Isolate Unclassified
42 2643221712 Ensifer sp. Root258 Isolate Unclassified
43 2643221726 Ensifer sp. Root954 Isolate Unclassified
44 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
45 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
46 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
47 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
48 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
49 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
50 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
51 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
52 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
53 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
54 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
55 2808606372 Agromyces sp. 23-23 Isolate Unclassified
56 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
57 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
58 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
59 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
60 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
61 2818991452 Burkholderia cepacia 561 Isolate Unclassified
62 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
63 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
64 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
65 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
66 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
67 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
68 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
69 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
70 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
71 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
72 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
73 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
74 2844163670 Ensifer sp. 1H6 Isolate Unclassified
75 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
76 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
77 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
78 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
79 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
80 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
81 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
82 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
83 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
84 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
85 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
86 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
87 2904564687 Burkholderia sp. 571 Isolate Unclassified
88 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
89 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
90 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
91 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
92 2928170801 Burkholderia sp. 572 Isolate Unclassified
93 2928536128 Burkholderia sola 565 Isolate Unclassified
94 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
95 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
96 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
97 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
98 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
99 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
100 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
101 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
102 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
103 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
104 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
105 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
106 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
107 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
108 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
109 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
110 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
111 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
112 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
113 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
114 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
115 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
116 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
117 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
118 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
119 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
120 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
121 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
122 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
123 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
125 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
126 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
127 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
128 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
129 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
130 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
131 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
132 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
133 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
134 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
135 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
136 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
137 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
143 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
144 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
145 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
146 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
147 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
148 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
149 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
150 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
151 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
154 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
155 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
156 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
168 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
169 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
170 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
171 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
172 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
282 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
288 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
289 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
290 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
291 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
292 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
293 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
294 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
295 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
296 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
297 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
298 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
299 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
300 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
301 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
302 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
303 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
304 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
305 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68
Metatranscriptomes 0
Isolates 32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.25
Nodule 10
Rhizoplane 3.75
Rhizosphere 47.75
Stem 0
Stem Tuber 0.25
Unclassified 21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002497 3300001979 Bacteria 8312
2 JGI25155J39150_1000020 3300002704 Bacteria 152963
3 JGI25156J39149_1000021 3300002705 Bacteria 152968
4 JGI25162J39368_1001307 3300002737 Bacteria 14035
5 JGI25162J39368_1001310 3300002737 Bacteria 13993
6 JGI25162J39368_1001352 3300002737 Bacteria 13572
7 JGI25162J39368_1001559 3300002737 Bacteria 11743
8 JGI25154J39366_1000039 3300002738 Bacteria 152972
9 JGI25157J39369_1000019 3300002741 Bacteria 176591
10 JGI25159J45721_1000355 3300002987 Bacteria 21217
11 JGI25165J46597_1000018 3300003214 Bacteria 374701
12 JGI25165J46597_1000407 3300003214 Bacteria 45582
13 JGI25165J46597_1002998 3300003214 Bacteria 4652
14 JGI25165J46597_1003950 3300003214 Bacteria 3403
15 rootH1_10004415 3300003316 Bacteria 7698
16 JGI25160J50197_1000014 3300003354 Bacteria 259862
17 JGI25161J50226_1000022 3300003374 Bacteria 158544
18 Ga0055535_1000251 3300003761 Bacteria 56744
19 Ga0055542_1000280 3300003762 Bacteria 57147
20 Ga0055529_1000213 3300003763 Bacteria 76328
21 Ga0055526_1003676 3300003771 Bacteria 9596
22 Ga0055524_1001776 3300003775 Bacteria 11853
23 Ga0055524_1010333 3300003775 Bacteria 3727
24 Ga0055528_1008043 3300003790 Bacteria 4577
25 Ga0055528_1016908 3300003790 Bacteria 2553
26 Ga0055531_10003818 3300003794 Bacteria 9445
27 Ga0055543_1000005 3300004625 Bacteria 223621
28 Ga0065165_1002159 3300005262 Bacteria 17794
29 Ga0065712_10012919 3300005290 Bacteria 2082
30 Ga0065715_10011801 3300005293 Bacteria 3578
31 Ga0070683_100002043 3300005329 Bacteria 15891
32 Ga0070670_100000196 3300005331 Bacteria 56006
33 Ga0068869_100209969 3300005334 Bacteria 1539
34 Ga0070661_100073887 3300005344 Bacteria 2510
35 Ga0070661_100233847 3300005344 Bacteria 1413
36 Ga0070692_10121967 3300005345 Bacteria 1455
37 Ga0070671_100163804 3300005355 Bacteria 1880
38 Ga0070659_100138643 3300005366 Bacteria 1979
39 Ga0070667_100030810 3300005367 Bacteria 4473
40 Ga0070713_100047953 3300005436 Bacteria 3514
41 Ga0070694_100010289 3300005444 Bacteria 5766
42 Ga0070707_100092261 3300005468 Bacteria 2932
43 Ga0070699_100200962 3300005518 Bacteria 1772
44 Ga0070684_100001401 3300005535 Bacteria 17347
45 Ga0070672_100018210 3300005543 Bacteria 5072
46 Ga0070695_100033496 3300005545 Bacteria 3214
47 Ga0070696_100061150 3300005546 Bacteria 2634
48 Ga0070693_100057190 3300005547 Bacteria 2254
49 Ga0070665_100164658 3300005548 Bacteria 2220
50 Ga0068855_100156075 3300005563 Bacteria 2593
51 Ga0070664_100004864 3300005564 Bacteria 10759
52 Ga0068856_100002393 3300005614 Bacteria 19294
53 Ga0068851_10034082 3300005834 Bacteria 2540
54 Ga0068870_10102755 3300005840 Bacteria 1618
55 Ga0068860_100019222 3300005843 Bacteria 6631
56 Ga0075368_10044627 3300006042 Bacteria 1749
57 Ga0075364_10018455 3300006051 Bacteria 4367
58 Ga0075362_10015893 3300006177 Bacteria 3070
59 Ga0075370_10122764 3300006353 Bacteria 1513
60 Ga0075431_100019648 3300006847 Bacteria 6892
61 Ga0075431_100246701 3300006847 Bacteria 1815
62 Ga0075434_100005362 3300006871 Bacteria 11666
63 Ga0075429_100199177 3300006880 Bacteria 1754
64 Ga0105240_10000012 3300009093 Bacteria 496639
65 Ga0105240_10003737 3300009093 Bacteria 23511
66 Ga0111539_10011910 3300009094 Bacteria 10904
67 Ga0114129_10146480 3300009147 Bacteria 3234
68 Ga0105241_10119562 3300009174 Bacteria 2120
69 Ga0105248_10313071 3300009177 Bacteria 1768
70 Ga0105237_10000165 3300009545 Bacteria 93713
71 Ga0105237_10099236 3300009545 Bacteria 2904
72 Ga0105249_10009206 3300009553 Bacteria 8637
73 Ga0105033_102753 3300009986 Bacteria 1460
74 Ga0105239_10040047 3300010375 Bacteria 5133
75 Ga0105239_10180531 3300010375 Bacteria 2362
76 Ga0157370_10000571 3300013104 Bacteria 45989
77 Ga0157369_10141379 3300013105 Bacteria 2547
78 Ga0157375_10137492 3300013308 Bacteria 2568
79 Ga0182005_1001440 3300015265 Bacteria 9586
80 Ga0214544_1000012 3300021320 Bacteria 229808
81 Ga0214542_1000011 3300021321 Bacteria 238260
82 Ga0214542_1019076 3300021321 Bacteria 5543
83 Ga0214543_1000004 3300021327 Bacteria 527190
84 Ga0214543_1000256 3300021327 Bacteria 82084
85 Ga0209435_100025 3300025206 Bacteria 198776
86 Ga0209566_101415 3300025225 Bacteria 7241
87 Ga0209672_100044 3300025228 Bacteria 270292
88 Ga0209147_100037 3300025229 Bacteria 326977
89 Ga0209147_100039 3300025229 Bacteria 311101
90 Ga0207427_103141 3300025231 Bacteria 3705
91 Ga0209437_100022 3300025233 Bacteria 625694
92 Ga0209437_100040 3300025233 Bacteria 448096
93 Ga0209258_100062 3300025242 Bacteria 311101
94 Ga0209646_1000083 3300025246 Bacteria 198777
95 Ga0209026_1000078 3300025250 Bacteria 198777
96 Ga0209148_1000075 3300025254 Bacteria 311101
97 Ga0209148_1001184 3300025254 Bacteria 14992
98 Ga0209759_1000060 3300025256 Bacteria 198777
99 Ga0209129_1000533 3300025258 Bacteria 26514
100 Ga0209129_1002784 3300025258 Bacteria 8143
101 Ga0209233_1000031 3300025261 Bacteria 624646
102 Ga0209233_1000051 3300025261 Bacteria 447617
103 Ga0209233_1000146 3300025261 Bacteria 187269
104 Ga0209233_1001225 3300025261 Bacteria 10324
105 Ga0209565_1011037 3300025263 Bacteria 2216
106 Ga0209455_1000067 3300025272 Bacteria 311101
107 Ga0209455_1000549 3300025272 Bacteria 25580
108 Ga0209673_1000044 3300025273 Bacteria 290647
109 Ga0209673_1002331 3300025273 Bacteria 13445
110 Ga0209130_1000013 3300025284 Bacteria 412810
111 Ga0209676_1026695 3300025292 Bacteria 1829
112 Ga0209025_1000086 3300025294 Bacteria 262586
113 Ga0209025_1000291 3300025294 Bacteria 112755
114 Ga0209025_1002354 3300025294 Bacteria 20341
115 Ga0209025_1022635 3300025294 Bacteria 3322
116 Ga0209025_1045030 3300025294 Bacteria 1835
117 Ga0209564_1004254 3300025295 Bacteria 8890
118 Ga0209256_1000406 3300025299 Bacteria 68202
119 Ga0209256_1003382 3300025299 Bacteria 11271
120 Ga0209256_1007693 3300025299 Bacteria 5230
121 Ga0207426_1000022 3300025302 Bacteria 547377
122 Ga0207426_1001046 3300025302 Bacteria 26290
123 Ga0209051_1039622 3300025303 Bacteria 1699
124 Ga0209257_1000951 3300025304 Bacteria 39939
125 Ga0209257_1004821 3300025304 Bacteria 10010
126 Ga0207680_10063340 3300025903 Bacteria 2263
127 Ga0207695_10000120 3300025913 Bacteria 234247
128 Ga0207695_10000473 3300025913 Bacteria 87226
129 Ga0207671_10000513 3300025914 Bacteria 52462
130 Ga0207646_10101628 3300025922 Bacteria 2577
131 Ga0207650_10000347 3300025925 Bacteria 44769
132 Ga0207700_10038339 3300025928 Bacteria 3477
133 Ga0207700_10117517 3300025928 Bacteria 2151
134 Ga0207664_10008697 3300025929 Bacteria 7098
135 Ga0207690_10067104 3300025932 Bacteria 2460
136 Ga0207690_10227530 3300025932 Bacteria 1430
137 Ga0207661_10047310 3300025944 Bacteria 3414
138 Ga0207679_10001536 3300025945 Bacteria 14423
139 Ga0207712_10177767 3300025961 Bacteria 1669
140 Ga0207668_10026796 3300025972 Bacteria 3748
141 Ga0207658_10048198 3300025986 Bacteria 3123
142 Ga0207703_10138426 3300026035 Bacteria 2110
143 Ga0207702_10004200 3300026078 Bacteria 12873
144 Ga0207702_10118745 3300026078 Bacteria 2363
145 Ga0207674_10101626 3300026116 Bacteria 2855
146 Ga0209371_1000479 3300027312 Bacteria 38955
147 Ga0209371_1003917 3300027312 Bacteria 6845
148 Ga0207428_10046196 3300027907 Bacteria 3502
149 Ga0268266_10014315 3300028379 Bacteria 6822
150 Ga0268264_10024324 3300028381 Bacteria 4945
151 Ga0307515_10001124 3300028794 Bacteria 61171
152 Ga0268256_1000409 3300030500 Bacteria 38955
153 Ga0307513_10035557 3300031456 Bacteria 5571
154 Ga0307408_100053294 3300031548 Bacteria 2920
155 Ga0316215_1003012 3300033544 Bacteria 1599
156 Ga0316574_0004131 3300035398 Bacteria 7558
157 Ga0373935_0108326 3300035692 Bacteria 1841
158 Ga0373933_0010050 3300035724 Bacteria 5181
159 Ga0373937_0016589 3300036401 Bacteria 6543
160 Ga0373937_0019349 3300036401 Bacteria 6093
161 Ga0316584_0084626 3300036712 Bacteria 2375
162 Ga0395900_0099894 3300037418 Bacteria 2981
163 Ga0395900_0101484 3300037418 Bacteria 2955
164 Ga0395900_0104715 3300037418 Bacteria 2907
165 Ga0395905_0000428 3300037471 Bacteria 58781
166 Ga0395905_0004612 3300037471 Bacteria 14261
167 Ga0395905_0008580 3300037471 Bacteria 10071
168 Ga0395905_0013844 3300037471 Bacteria 7716
169 Ga0395901_0159280 3300038443 Bacteria 2370
170 Ga0395901_0226400 3300038443 Bacteria 1953
171 Ga0400483_147581 3300039062 Bacteria 2904
172 Ga0436365_1711446 3300039437 Bacteria 1725
173 Ga0436361_0029206 3300039447 Bacteria 1475
174 Ga0439436_0019872 3300041404 Bacteria 2002
175 Ga0450918_002904 3300042531 Bacteria 3222
176 Ga0466970_0030704 3300044765 Bacteria 2834
177 Ga0466958_0088055 3300045836 Bacteria 1918
178 Ga0495638_0015849 3300046460 Bacteria 5050
179 Ga0495638_0092094 3300046460 Bacteria 1825
180 Ga0495605_0116481 3300046474 Bacteria 1215
181 Ga0495606_0005274 3300046507 Bacteria 12457
182 Ga0495608_0095626 3300046511 Bacteria 1919
183 Ga0495648_0099492 3300046524 Bacteria 1608
184 Ga0495625_0023524 3300046660 Bacteria 4705
185 Ga0495686_0035500 3300047472 Bacteria 3204
186 Ga0495686_0096813 3300047472 Bacteria 1785
187 Ga0496104_0003243 3300048907 Bacteria 14015
188 Ga0496105_0018398 3300048908 Bacteria 5614
189 Ga0496105_0099777 3300048908 Bacteria 2398
190 Ga0496108_0006291 3300048911 Bacteria 9624
191 Ga0496109_0001400 3300048912 Bacteria 19988
192 Ga0496110_0008893 3300048913 Bacteria 8095
193 Ga0496111_0025038 3300048914 Bacteria 4210
194 Ga0496112_0014689 3300048915 Bacteria 7278
195 Ga0496114_0001036 3300048917 Bacteria 20908
196 Ga0496116_0009988 3300048919 Bacteria 8016
197 Ga0496116_0068804 3300048919 Bacteria 2254
198 Ga0496117_0001454 3300048920 Bacteria 34157
199 Ga0496117_0006651 3300048920 Bacteria 11588
200 Ga0496118_0021746 3300048921 Bacteria 5633
201 Ga0496121_0010609 3300048924 Bacteria 10351
202 Ga0496122_0001085 3300048925 Bacteria 47269
203 Ga0496122_0013542 3300048925 Bacteria 7972
204 Ga0496123_0000228 3300048926 Bacteria 113817
205 Ga0496123_0023306 3300048926 Bacteria 4740
206 Ga0496124_0000790 3300048927 Bacteria 51766
207 Ga0496124_0024850 3300048927 Bacteria 5438
208 Ga0496125_0000041 3300048928 Bacteria 310158
209 Ga0496125_0001126 3300048928 Bacteria 40818
210 Ga0496125_0081362 3300048928 Bacteria 2475
211 Ga0496125_0110092 3300048928 Bacteria 1998
212 Ga0496126_0004304 3300048929 Bacteria 17095
213 Ga0496126_0067110 3300048929 Bacteria 3206
214 Ga0496126_0173967 3300048929 Bacteria 1832
215 Ga0501032_0000663 3300049569 Bacteria 27949
216 Ga0501032_0194950 3300049569 Bacteria 1323
217 Ga0501033_0000304 3300049570 Bacteria 46485
218 Ga0501033_0183502 3300049570 Bacteria 1499
219 Ga0501034_0000703 3300049571 Bacteria 50785
220 Ga0501034_0007291 3300049571 Bacteria 11788
221 Ga0501037_0000154 3300049573 Bacteria 64077
222 Ga0501037_0056510 3300049573 Bacteria 2866
223 Ga0501038_0014331 3300049574 Bacteria 7224
224 Ga0501043_0000007 3300049579 Bacteria 224595
225 Ga0501047_0062580 3300049581 Bacteria 3589
226 Ga0501047_0065326 3300049581 Bacteria 3507
227 Ga0501047_0395710 3300049581 Bacteria 1215
228 Ga0501067_0006027 3300049583 Bacteria 6721
229 Ga0501069_0000027 3300049585 Bacteria 106217
230 Ga0501069_0027239 3300049585 Bacteria 3132
231 Ga0501070_0000231 3300049586 Bacteria 52768
232 Ga0501070_0009169 3300049586 Bacteria 8366
233 Ga0501070_0015254 3300049586 Bacteria 6465
234 Ga0501070_0257892 3300049586 Bacteria 1425
235 Ga0501073_0086067 3300049589 Bacteria 2186
236 Ga0501074_0000066 3300049590 Bacteria 50258
237 Ga0501074_0219803 3300049590 Bacteria 1353
238 Ga0501080_0000667 3300049742 Bacteria 27300
239 Ga0501080_0081607 3300049742 Bacteria 3004
240 Ga0501080_0086866 3300049742 Bacteria 2906
241 Ga0501083_0000012 3300049744 Bacteria 178668
242 Ga0501083_0007661 3300049744 Bacteria 7655
243 Ga0501083_0074771 3300049744 Bacteria 2250
244 Ga0501035_0000073 3300049822 Bacteria 122603
245 Ga0501035_0016462 3300049822 Bacteria 6818
246 Ga0501035_0061039 3300049822 Bacteria 3356
247 Ga0501035_0130363 3300049822 Bacteria 2192
248 Ga0501035_0145296 3300049822 Bacteria 2060
249 Ga0501035_0162074 3300049822 Bacteria 1935
250 Ga0501044_0000118 3300049823 Bacteria 95218
251 Ga0501044_0038514 3300049823 Bacteria 4992
252 Ga0501044_0047069 3300049823 Bacteria 4462
253 Ga0501044_0052015 3300049823 Bacteria 4223
254 Ga0501044_0097505 3300049823 Bacteria 2961
255 Ga0501044_0187361 3300049823 Bacteria 2033
256 Ga0501044_0217290 3300049823 Bacteria 1863
257 Ga0501044_0240945 3300049823 Bacteria 1752
258 nmdc:mga03n38_22290_c1 3300050490 Bacteria 2561
259 nmdc:mga09592_48651_c1 3300050508 Bacteria 3575
260 nmdc:mga0qj67_26450_c1 3300050509 Bacteria 4492
261 nmdc:mga06r32_63625_c1 3300050510 Bacteria 3557
262 nmdc:mga08y16_255794_c1 3300050511 Bacteria 1809
263 nmdc:mga08y16_8219_c1 3300050511 Bacteria 10915
264 nmdc:mga0n895_84199_c1 3300050512 Bacteria 3173
265 Ga0500583_0082410 3300053092 Bacteria 1556
266 Ga0500618_007193 3300053125 Bacteria 3199
267 Ga0500559_0010978 3300053136 Bacteria 3879
268 Ga0500559_0026860 3300053136 Bacteria 2454
269 Ga0500627_0109060 3300053158 Bacteria 1246
270 Ga0501084_0013467 3300054114 Bacteria 6769
271 Ga0501082_0003084 3300060353 Bacteria 14532
272 Ga0501082_0015316 3300060353 Bacteria 6601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0010978 Ga0500559_0010978_2845_3867 336
2 3300049581 Ga0501047_0395710 Ga0501047_0395710_124_1200 343
3 3300003790 Ga0055528_1008043 Ga0055528_10080433 346
4 3300025229 Ga0209147_100037 Ga0209147_100037220 346
5 3300025263 Ga0209565_1011037 Ga0209565_10110372 346
6 3300025273 Ga0209673_1000044 Ga0209673_1000044197 346
7 3300003761 Ga0055535_1000251 Ga0055535_100025120 347
8 3300003762 Ga0055542_1000280 Ga0055542_100028020 347
9 3300003763 Ga0055529_1000213 Ga0055529_100021320 347
10 3300025225 Ga0209566_101415 Ga0209566_1014152 347
11 3300025228 Ga0209672_100044 Ga0209672_10004494 347
12 3300025229 Ga0209147_100039 Ga0209147_10003994 347
13 3300025242 Ga0209258_100062 Ga0209258_10006294 347
14 3300025254 Ga0209148_1000075 Ga0209148_100007594 347
15 3300025272 Ga0209455_1000067 Ga0209455_100006794 347
16 3300027312 Ga0209371_1000479 Ga0209371_10004799 347
17 3300030500 Ga0268256_1000409 Ga0268256_10004099 347
18 3300046474 Ga0495605_0116481 Ga0495605_0116481_56_1132 352
19 3300009986 Ga0105033_102753 Ga0105033_1027532 354
20 3300005546 Ga0070696_100061150 Ga0070696_1000611502 358
21 3300005843 Ga0068860_100019222 Ga0068860_1000192222 358
22 3300009093 Ga0105240_10003737 Ga0105240_100037379 358
23 3300025913 Ga0207695_10000473 Ga0207695_1000047310 358
24 3300028381 Ga0268264_10024324 Ga0268264_100243244 358
25 3300039062 Ga0400483_147581 Ga0400483_147581_234_1331 359
26 3300049822 Ga0501035_0162074 Ga0501035_0162074_22_1113 359
27 3300006847 Ga0075431_100246701 Ga0075431_1002467012 360
28 3300006880 Ga0075429_100199177 Ga0075429_1001991771 360
29 3300050508 nmdc:mga09592_48651_c1 nmdc:mga09592_48651_c1_560_1672 360
30 3300050509 nmdc:mga0qj67_26450_c1 nmdc:mga0qj67_26450_c1_416_1528 360
31 3300050510 nmdc:mga06r32_63625_c1 nmdc:mga06r32_63625_c1_829_1941 360
32 3300009177 Ga0105248_10313071 Ga0105248_103130711 362
33 3300013308 Ga0157375_10137492 Ga0157375_101374922 362
34 3300048907 Ga0496104_0003243 Ga0496104_0003243_12512_13639 362
35 3300048908 Ga0496105_0099777 Ga0496105_0099777_421_1548 362
36 3300048911 Ga0496108_0006291 Ga0496108_0006291_4928_6055 362
37 3300048912 Ga0496109_0001400 Ga0496109_0001400_574_1701 362
38 3300048913 Ga0496110_0008893 Ga0496110_0008893_3857_4984 362
39 3300048914 Ga0496111_0025038 Ga0496111_0025038_417_1544 362
40 3300048915 Ga0496112_0014689 Ga0496112_0014689_1157_2284 362
41 3300006051 Ga0075364_10018455 Ga0075364_100184554 364
42 3300009147 Ga0114129_10146480 Ga0114129_101464802 364
43 3300050511 nmdc:mga08y16_255794_c1 nmdc:mga08y16_255794_c1_587_1720 364
44 iso_pu_bacteria 2871451962 2871452035 364
45 iso_pu_bacteria 2524023250 2524613053 365
46 3300033544 Ga0316215_1003012 Ga0316215_10030122 366
47 3300035724 Ga0373933_0010050 Ga0373933_0010050_2943_4046 366
48 3300036401 Ga0373937_0019349 Ga0373937_0019349_2607_3710 366
49 3300046511 Ga0495608_0095626 Ga0495608_0095626_119_1222 366
50 iso_pu_bacteria 2891373044 2891374051 366
51 3300006847 Ga0075431_100019648 Ga0075431_1000196483 367
52 3300044765 Ga0466970_0030704 Ga0466970_0030704_908_2263 367
53 3300045836 Ga0466958_0088055 Ga0466958_0088055_419_1660 367
54 3300049823 Ga0501044_0217290 Ga0501044_0217290_548_1723 367
55 3300025928 Ga0207700_10038339 Ga0207700_100383393 368
56 3300003316 rootH1_10004415 rootH1_100044155 369
57 3300005547 Ga0070693_100057190 Ga0070693_1000571901 369
58 3300046460 Ga0495638_0092094 Ga0495638_0092094_541_1662 369
59 iso_pu_bacteria 2995392953 2995394383 369
60 3300036712 Ga0316584_0084626 Ga0316584_0084626_770_1909 370
61 iso_pu_bacteria 2599185239 2599737864 370
62 iso_pu_bacteria 2599185240 2599748625 370
63 iso_pu_bacteria 2599185355 2600210536 370
64 iso_pu_bacteria 2675903129 2676746797 370
65 iso_pu_bacteria 2713897090 2715500561 370
66 iso_pu_bacteria 2818991452 2819631709 370
67 iso_pu_bacteria 2863421361 2863422963 370
68 iso_pu_bacteria 2870068957 2870075707 370
69 iso_pu_bacteria 2904564687 2904566419 370
70 iso_pu_bacteria 2904571731 2904573464 370
71 iso_pu_bacteria 2928170801 2928173565 370
72 iso_pu_bacteria 2928536128 2928539696 370
73 iso_pu_bacteria 8018845410 8018847437 370
74 iso_pu_bacteria 8020938398 8020940472 370
75 iso_pu_bacteria 8020945358 8020951151 370
76 iso_pu_bacteria 8020953355 8020955149 370
77 iso_pu_bacteria 8021120328 8021124978 370
78 3300005334 Ga0068869_100209969 Ga0068869_1002099692 371
79 3300005344 Ga0070661_100073887 Ga0070661_1000738872 371
80 3300005345 Ga0070692_10121967 Ga0070692_101219671 371
81 3300005366 Ga0070659_100138643 Ga0070659_1001386432 371
82 3300005436 Ga0070713_100047953 Ga0070713_1000479532 371
83 3300005444 Ga0070694_100010289 Ga0070694_1000102894 371
84 3300005468 Ga0070707_100092261 Ga0070707_1000922612 371
85 3300005545 Ga0070695_100033496 Ga0070695_1000334962 371
86 3300009174 Ga0105241_10119562 Ga0105241_101195621 371
87 3300009545 Ga0105237_10099236 Ga0105237_100992363 371
88 3300010375 Ga0105239_10040047 Ga0105239_100400474 371
89 3300025922 Ga0207646_10101628 Ga0207646_101016283 371
90 3300025928 Ga0207700_10117517 Ga0207700_101175172 371
91 3300025929 Ga0207664_10008697 Ga0207664_100086973 371
92 3300025932 Ga0207690_10067104 Ga0207690_100671041 371
93 3300026078 Ga0207702_10118745 Ga0207702_101187452 371
94 3300026116 Ga0207674_10101626 Ga0207674_101016262 371
95 3300028794 Ga0307515_10001124 Ga0307515_1000112411 371
96 3300036401 Ga0373937_0016589 Ga0373937_0016589_5066_6244 371
97 3300037418 Ga0395900_0099894 Ga0395900_0099894_217_1410 371
98 3300037471 Ga0395905_0000428 Ga0395905_0000428_42403_43596 371
99 3300037471 Ga0395905_0004612 Ga0395905_0004612_5085_6212 371
100 3300037471 Ga0395905_0008580 Ga0395905_0008580_1077_2204 371
101 3300037471 Ga0395905_0013844 Ga0395905_0013844_648_1781 371
102 3300046460 Ga0495638_0015849 Ga0495638_0015849_1333_2460 371
103 3300049569 Ga0501032_0194950 Ga0501032_0194950_54_1193 371
104 3300049571 Ga0501034_0000703 Ga0501034_0000703_44205_45344 371
105 3300053136 Ga0500559_0026860 Ga0500559_0026860_305_1438 371
106 3300053158 Ga0500627_0109060 Ga0500627_0109060_57_1184 371
107 iso_pu_bacteria 2837651117 2837654048 371
108 iso_pu_bacteria 2891048133 2891048529 371
109 3300003214 JGI25165J46597_1003950 JGI25165J46597_10039502 372
110 3300025231 Ga0207427_103141 Ga0207427_1031414 372
111 3300025261 Ga0209233_1001225 Ga0209233_10012253 372
112 iso_pu_bacteria 2513237150 2513955231 372
113 iso_pu_bacteria 2519103095 2519462444 372
114 iso_pu_bacteria 2582581311 2585294914 372
115 iso_pu_bacteria 2657244999 2657681928 372
116 iso_pu_bacteria 2802429268 2804750947 372
117 iso_pu_bacteria 2808606447 2809225462 372
118 iso_pu_bacteria 2816332253 2817263177 372
119 iso_pu_bacteria 2816332256 2817276595 372
120 iso_pu_bacteria 2816332286 2817455741 372
121 iso_pu_bacteria 2841911363 2841913853 372
122 iso_pu_bacteria 2841917233 2841919538 372
123 iso_pu_bacteria 2855020534 2855021794 372
124 iso_pu_bacteria 644736347 644747964 372
125 iso_pu_bacteria 8020807995 8020811462 372
126 iso_pu_bacteria 8040173305 8040178719 372
127 3300005563 Ga0068855_100156075 Ga0068855_1001560752 373
128 3300006177 Ga0075362_10015893 Ga0075362_100158932 373
129 3300013105 Ga0157369_10141379 Ga0157369_101413792 373
130 3300025254 Ga0209148_1001184 Ga0209148_10011846 373
131 3300025272 Ga0209455_1000549 Ga0209455_10005496 373
132 3300025303 Ga0209051_1039622 Ga0209051_10396222 373
133 3300035692 Ga0373935_0108326 Ga0373935_0108326_412_1539 373
134 3300037418 Ga0395900_0101484 Ga0395900_0101484_1531_2685 373
135 3300038443 Ga0395901_0159280 Ga0395901_0159280_491_1645 373
136 3300047472 Ga0495686_0096813 Ga0495686_0096813_161_1315 373
137 3300049571 Ga0501034_0007291 Ga0501034_0007291_10461_11615 373
138 3300049586 Ga0501070_0009169 Ga0501070_0009169_1476_2627 373
139 3300049822 Ga0501035_0061039 Ga0501035_0061039_1574_2710 373
140 3300049823 Ga0501044_0097505 Ga0501044_0097505_492_1628 373
141 3300049823 Ga0501044_0187361 Ga0501044_0187361_703_1854 373
142 3300050490 nmdc:mga03n38_22290_c1 nmdc:mga03n38_22290_c1_257_1414 373
143 iso_pu_bacteria 2599185352 2600196691 373
144 iso_pu_bacteria 2643221610 2644066840 373
145 iso_pu_bacteria 2643221675 2644417786 373
146 iso_pu_bacteria 2643221680 2644451062 373
147 iso_pu_bacteria 2643221698 2644545489 373
148 iso_pu_bacteria 2643221726 2644691719 373
149 iso_pu_bacteria 2791355082 2792582889 373
150 iso_pu_bacteria 2844163670 2844168032 373
151 iso_pu_bacteria 2920822456 2920827480 373
152 iso_pu_bacteria 2941499720 2941506028 373
153 iso_pu_bacteria 8049293176 8049293506 373
154 iso_pu_bacteria 2508501122 2509107134 374
155 iso_pu_bacteria 2509276019 2509374973 374
156 iso_pu_bacteria 2558860100 2558865974 374
157 iso_pu_bacteria 2690316117 2692317220 374
158 iso_pu_bacteria 2791355091 2792622424 374
159 iso_pu_bacteria 2791355092 2792628007 374
160 iso_pu_bacteria 2791355094 2792643871 374
161 iso_pu_bacteria 2847417321 2847417712 374
162 iso_pu_bacteria 2848992105 2848992517 374
163 iso_pu_bacteria 2850079185 2850080010 374
164 iso_pu_bacteria 2855872281 2855874502 374
165 iso_pu_bacteria 2913295892 2913297957 374
166 3300005518 Ga0070699_100200962 Ga0070699_1002009622 375
167 3300025294 Ga0209025_1000291 Ga0209025_100029143 375
168 3300037418 Ga0395900_0104715 Ga0395900_0104715_817_2001 375
169 3300038443 Ga0395901_0226400 Ga0395901_0226400_330_1514 375
170 3300046507 Ga0495606_0005274 Ga0495606_0005274_5447_6574 375
171 3300048908 Ga0496105_0018398 Ga0496105_0018398_1446_2642 375
172 3300048917 Ga0496114_0001036 Ga0496114_0001036_5821_7017 375
173 iso_pu_bacteria 2643221698 2644542876 375
174 iso_pu_bacteria 2808606372 2808903593 375
175 iso_pu_bacteria 2844163670 2844170711 375
176 iso_pu_bacteria 2939660829 2939664354 375
177 iso_pu_bacteria 2941499720 2941500672 375
178 3300005290 Ga0065712_10012919 Ga0065712_100129192 376
179 3300005293 Ga0065715_10011801 Ga0065715_100118013 376
180 3300006042 Ga0075368_10044627 Ga0075368_100446272 376
181 3300021320 Ga0214544_1000012 Ga0214544_1000012182 376
182 3300021321 Ga0214542_1000011 Ga0214542_1000011175 376
183 3300021327 Ga0214543_1000004 Ga0214543_1000004325 376
184 3300039437 Ga0436365_1711446 Ga0436365_1711446_224_1372 376
185 3300039447 Ga0436361_0029206 Ga0436361_0029206_81_1259 376
186 3300049569 Ga0501032_0000663 Ga0501032_0000663_7398_8558 376
187 3300049570 Ga0501033_0000304 Ga0501033_0000304_44548_45708 376
188 3300049570 Ga0501033_0183502 Ga0501033_0183502_324_1484 376
189 3300049573 Ga0501037_0000154 Ga0501037_0000154_26123_27283 376
190 3300049574 Ga0501038_0014331 Ga0501038_0014331_5465_6625 376
191 3300049579 Ga0501043_0000007 Ga0501043_0000007_55221_56381 376
192 3300049581 Ga0501047_0062580 Ga0501047_0062580_462_1622 376
193 3300049581 Ga0501047_0065326 Ga0501047_0065326_769_1929 376
194 3300049583 Ga0501067_0006027 Ga0501067_0006027_54_1214 376
195 3300049585 Ga0501069_0000027 Ga0501069_0000027_49832_50992 376
196 3300049585 Ga0501069_0027239 Ga0501069_0027239_1435_2595 376
197 3300049586 Ga0501070_0000231 Ga0501070_0000231_11211_12371 376
198 3300049586 Ga0501070_0015254 Ga0501070_0015254_2589_3749 376
199 3300049586 Ga0501070_0257892 Ga0501070_0257892_23_1183 376
200 3300049589 Ga0501073_0086067 Ga0501073_0086067_361_1521 376
201 3300049590 Ga0501074_0000066 Ga0501074_0000066_133_1293 376
202 3300049742 Ga0501080_0000667 Ga0501080_0000667_2748_3908 376
203 3300049742 Ga0501080_0081607 Ga0501080_0081607_1068_2228 376
204 3300049742 Ga0501080_0086866 Ga0501080_0086866_429_1589 376
205 3300049744 Ga0501083_0000012 Ga0501083_0000012_122131_123291 376
206 3300049822 Ga0501035_0000073 Ga0501035_0000073_82720_83880 376
207 3300049822 Ga0501035_0016462 Ga0501035_0016462_3003_4163 376
208 3300049822 Ga0501035_0130363 Ga0501035_0130363_748_1908 376
209 3300049822 Ga0501035_0145296 Ga0501035_0145296_747_1907 376
210 3300049823 Ga0501044_0000118 Ga0501044_0000118_38810_39970 376
211 3300049823 Ga0501044_0038514 Ga0501044_0038514_3509_4669 376
212 3300049823 Ga0501044_0047069 Ga0501044_0047069_2710_3870 376
213 3300049823 Ga0501044_0052015 Ga0501044_0052015_1185_2345 376
214 3300049823 Ga0501044_0240945 Ga0501044_0240945_63_1223 376
215 3300060353 Ga0501082_0015316 Ga0501082_0015316_28_1188 376
216 iso_pu_bacteria 2510917022 2511132916 376
217 iso_pu_bacteria 2524023209 2524457114 376
218 iso_pu_bacteria 2582581307 2585272369 376
219 iso_pu_bacteria 2582581308 2585278432 376
220 iso_pu_bacteria 2582581315 2585324724 376
221 iso_pu_bacteria 2582581316 2585332157 376
222 iso_pu_bacteria 2585427527 2585531912 376
223 iso_pu_bacteria 2585427530 2585552271 376
224 iso_pu_bacteria 2585427531 2585561568 376
225 iso_pu_bacteria 2585427608 2585899420 376
226 iso_pu_bacteria 2585427609 2585906796 376
227 iso_pu_bacteria 2585428125 2587982217 376
228 iso_pu_bacteria 2615840626 2616307950 376
229 iso_pu_bacteria 2615840698 2616552522 376
230 iso_pu_bacteria 2643221618 2644106290 376
231 iso_pu_bacteria 2643221626 2644146724 376
232 iso_pu_bacteria 2643221655 2644310900 376
233 iso_pu_bacteria 2643221659 2644334296 376
234 iso_pu_bacteria 2643221689 2644502024 376
235 iso_pu_bacteria 2643221712 2644616734 376
236 iso_pu_bacteria 2667528174 2671112944 376
237 iso_pu_bacteria 2775507266 2778178219 376
238 iso_pu_bacteria 2818991448 2819608048 376
239 iso_pu_bacteria 2818991453 2819640155 376
240 iso_pu_bacteria 2838029111 2838033787 376
241 iso_pu_bacteria 2842298080 2842299333 376
242 iso_pu_bacteria 2842357229 2842362461 376
243 iso_pu_bacteria 2842475841 2842480534 376
244 iso_pu_bacteria 2842482326 2842484107 376
245 iso_pu_bacteria 2842502639 2842507185 376
246 iso_pu_bacteria 2842509118 2842512229 376
247 iso_pu_bacteria 2852387548 2852394503 376
248 iso_pu_bacteria 2919408235 2919412733 376
249 iso_pu_bacteria 3005416602 3005421094 376
250 iso_pu_bacteria 643692032 643824571 376
251 iso_pu_bacteria 8005314921 8005319171 376
252 iso_pu_bacteria 8005484373 8005489508 376
253 iso_pu_bacteria 8005645114 8005650375 376
254 iso_pu_bacteria 8005682033 8005684021 376
255 iso_pu_bacteria 8046767195 8046774664 376
256 iso_pu_bacteria 8057575449 8057577680 376
257 3300003771 Ga0055526_1003676 Ga0055526_100367610 377
258 3300003775 Ga0055524_1001776 Ga0055524_10017762 377
259 3300003775 Ga0055524_1010333 Ga0055524_10103333 377
260 3300003790 Ga0055528_1016908 Ga0055528_10169083 377
261 3300003794 Ga0055531_10003818 Ga0055531_100038182 377
262 3300025258 Ga0209129_1002784 Ga0209129_10027843 377
263 3300025273 Ga0209673_1002331 Ga0209673_10023313 377
264 3300025294 Ga0209025_1002354 Ga0209025_100235410 377
265 3300025294 Ga0209025_1022635 Ga0209025_10226352 377
266 3300025295 Ga0209564_1004254 Ga0209564_10042543 377
267 3300025299 Ga0209256_1000406 Ga0209256_10004062 377
268 3300025299 Ga0209256_1003382 Ga0209256_100338210 377
269 3300025299 Ga0209256_1007693 Ga0209256_10076933 377
270 3300025302 Ga0207426_1001046 Ga0207426_10010464 377
271 3300025304 Ga0209257_1000951 Ga0209257_100095120 377
272 3300025304 Ga0209257_1004821 Ga0209257_10048212 377
273 3300035398 Ga0316574_0004131 Ga0316574_0004131_2333_3523 377
274 3300046660 Ga0495625_0023524 Ga0495625_0023524_2610_3755 377
275 3300048919 Ga0496116_0068804 Ga0496116_0068804_961_2109 377
276 3300048925 Ga0496122_0013542 Ga0496122_0013542_1792_2931 377
277 3300048927 Ga0496124_0000790 Ga0496124_0000790_12126_13262 377
278 3300048927 Ga0496124_0024850 Ga0496124_0024850_3086_4234 377
279 3300048928 Ga0496125_0001126 Ga0496125_0001126_34061_35200 377
280 3300048928 Ga0496125_0081362 Ga0496125_0081362_1163_2311 377
281 3300048928 Ga0496125_0110092 Ga0496125_0110092_418_1554 377
282 3300048929 Ga0496126_0004304 Ga0496126_0004304_340_1476 377
283 3300048929 Ga0496126_0067110 Ga0496126_0067110_1243_2391 377
284 iso_pu_bacteria 2513237159 2513996195 377
285 iso_pu_bacteria 2582581306 2585264588 377
286 iso_pu_bacteria 2582581865 2585389955 377
287 iso_pu_bacteria 2582581866 2585396372 377
288 iso_pu_bacteria 2643221607 2644051712 377
289 iso_pu_bacteria 2643221636 2644200196 377
290 iso_pu_bacteria 2643221686 2644480580 377
291 iso_pu_bacteria 2643221689 2644498709 377
292 iso_pu_bacteria 2842521101 2842521151 377
293 iso_pu_bacteria 2889914905 2889918977 377
294 iso_pu_bacteria 2891373044 2891376100 377
295 iso_pu_bacteria 2989349275 2989351570 377
296 iso_pu_bacteria 2989771324 2989772977 377
297 iso_pu_bacteria 3002141150 3002145812 377
298 iso_pu_bacteria 3003930520 3003931380 377
299 iso_pu_bacteria 8024486573 8024491251 377
300 3300021321 Ga0214542_1019076 Ga0214542_10190767 378
301 3300021327 Ga0214543_1000256 Ga0214543_10002566 378
302 3300025972 Ga0207668_10026796 Ga0207668_100267962 378
303 3300049590 Ga0501074_0219803 Ga0501074_0219803_38_1213 378
304 iso_pu_bacteria 2643221607 2644048090 378
305 iso_pu_bacteria 2643221636 2644200346 378
306 iso_pu_bacteria 2643221686 2644480885 378
307 iso_pu_bacteria 8054558443 8054560436 378
308 3300005329 Ga0070683_100002043 Ga0070683_1000020432 379
309 3300005344 Ga0070661_100233847 Ga0070661_1002338471 379
310 3300005355 Ga0070671_100163804 Ga0070671_1001638041 379
311 3300005535 Ga0070684_100001401 Ga0070684_10000140112 379
312 3300005543 Ga0070672_100018210 Ga0070672_1000182102 379
313 3300005564 Ga0070664_100004864 Ga0070664_1000048645 379
314 3300005840 Ga0068870_10102755 Ga0068870_101027552 379
315 3300006871 Ga0075434_100005362 Ga0075434_1000053626 379
316 3300009094 Ga0111539_10011910 Ga0111539_100119104 379
317 3300009553 Ga0105249_10009206 Ga0105249_100092064 379
318 3300025258 Ga0209129_1000533 Ga0209129_10005335 379
319 3300025903 Ga0207680_10063340 Ga0207680_100633402 379
320 3300025932 Ga0207690_10227530 Ga0207690_102275301 379
321 3300025944 Ga0207661_10047310 Ga0207661_100473102 379
322 3300025945 Ga0207679_10001536 Ga0207679_100015369 379
323 3300025961 Ga0207712_10177767 Ga0207712_101777672 379
324 3300026035 Ga0207703_10138426 Ga0207703_101384261 379
325 3300027907 Ga0207428_10046196 Ga0207428_100461962 379
326 3300031456 Ga0307513_10035557 Ga0307513_100355572 379
327 3300049744 Ga0501083_0007661 Ga0501083_0007661_4623_5819 379
328 3300049744 Ga0501083_0074771 Ga0501083_0074771_790_1986 379
329 3300050511 nmdc:mga08y16_8219_c1 nmdc:mga08y16_8219_c1_4287_5489 379
330 3300050512 nmdc:mga0n895_84199_c1 nmdc:mga0n895_84199_c1_1826_3013 379
331 3300053092 Ga0500583_0082410 Ga0500583_0082410_255_1523 379
332 3300054114 Ga0501084_0013467 Ga0501084_0013467_1589_2785 379
333 3300060353 Ga0501082_0003084 Ga0501082_0003084_3143_4339 379
334 iso_pu_bacteria 8040167225 8040171412 379
335 3300001979 JGI24740J21852_10002497 JGI24740J21852_100024975 380
336 3300002704 JGI25155J39150_1000020 JGI25155J39150_1000020122 380
337 3300002705 JGI25156J39149_1000021 JGI25156J39149_100002127 380
338 3300002737 JGI25162J39368_1001307 JGI25162J39368_10013078 380
339 3300002737 JGI25162J39368_1001310 JGI25162J39368_10013105 380
340 3300002737 JGI25162J39368_1001352 JGI25162J39368_10013522 380
341 3300002737 JGI25162J39368_1001559 JGI25162J39368_100155910 380
342 3300002738 JGI25154J39366_1000039 JGI25154J39366_1000039122 380
343 3300002741 JGI25157J39369_1000019 JGI25157J39369_100001927 380
344 3300002987 JGI25159J45721_1000355 JGI25159J45721_100035510 380
345 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018279 380
346 3300003214 JGI25165J46597_1000407 JGI25165J46597_10004077 380
347 3300003214 JGI25165J46597_1002998 JGI25165J46597_10029982 380
348 3300003354 JGI25160J50197_1000014 JGI25160J50197_1000014144 380
349 3300003374 JGI25161J50226_1000022 JGI25161J50226_100002244 380
350 3300004625 Ga0055543_1000005 Ga0055543_100000588 380
351 3300005262 Ga0065165_1002159 Ga0065165_100215912 380
352 3300005331 Ga0070670_100000196 Ga0070670_1000001968 380
353 3300005367 Ga0070667_100030810 Ga0070667_1000308102 380
354 3300005548 Ga0070665_100164658 Ga0070665_1001646582 380
355 3300005614 Ga0068856_100002393 Ga0068856_10000239316 380
356 3300005834 Ga0068851_10034082 Ga0068851_100340823 380
357 3300006353 Ga0075370_10122764 Ga0075370_101227641 380
358 3300009093 Ga0105240_10000012 Ga0105240_1000001261 380
359 3300009545 Ga0105237_10000165 Ga0105237_1000016572 380
360 3300010375 Ga0105239_10180531 Ga0105239_101805312 380
361 3300013104 Ga0157370_10000571 Ga0157370_1000057132 380
362 3300015265 Ga0182005_1001440 Ga0182005_10014404 380
363 3300025206 Ga0209435_100025 Ga0209435_100025143 380
364 3300025233 Ga0209437_100022 Ga0209437_100022341 380
365 3300025233 Ga0209437_100040 Ga0209437_100040318 380
366 3300025246 Ga0209646_1000083 Ga0209646_1000083143 380
367 3300025250 Ga0209026_1000078 Ga0209026_1000078143 380
368 3300025256 Ga0209759_1000060 Ga0209759_1000060143 380
369 3300025261 Ga0209233_1000031 Ga0209233_1000031341 380
370 3300025261 Ga0209233_1000051 Ga0209233_1000051319 380
371 3300025261 Ga0209233_1000146 Ga0209233_1000146151 380
372 3300025284 Ga0209130_1000013 Ga0209130_1000013293 380
373 3300025292 Ga0209676_1026695 Ga0209676_10266952 380
374 3300025294 Ga0209025_1000086 Ga0209025_1000086205 380
375 3300025294 Ga0209025_1045030 Ga0209025_10450302 380
376 3300025302 Ga0207426_1000022 Ga0207426_100002288 380
377 3300025913 Ga0207695_10000120 Ga0207695_10000120153 380
378 3300025914 Ga0207671_10000513 Ga0207671_1000051323 380
379 3300025925 Ga0207650_10000347 Ga0207650_100003472 380
380 3300025986 Ga0207658_10048198 Ga0207658_100481984 380
381 3300026078 Ga0207702_10004200 Ga0207702_100042003 380
382 3300027312 Ga0209371_1003917 Ga0209371_10039172 380
383 3300028379 Ga0268266_10014315 Ga0268266_100143155 380
384 3300031548 Ga0307408_100053294 Ga0307408_1000532942 380
385 3300041404 Ga0439436_0019872 Ga0439436_0019872_72_1229 380
386 3300042531 Ga0450918_002904 Ga0450918_002904_849_2006 380
387 3300046524 Ga0495648_0099492 Ga0495648_0099492_387_1532 380
388 3300047472 Ga0495686_0035500 Ga0495686_0035500_1346_2494 380
389 3300048919 Ga0496116_0009988 Ga0496116_0009988_6481_7641 380
390 3300048920 Ga0496117_0001454 Ga0496117_0001454_25936_27084 380
391 3300048920 Ga0496117_0006651 Ga0496117_0006651_1472_2632 380
392 3300048921 Ga0496118_0021746 Ga0496118_0021746_3182_4324 380
393 3300048924 Ga0496121_0010609 Ga0496121_0010609_2969_4129 380
394 3300048925 Ga0496122_0001085 Ga0496122_0001085_34191_35339 380
395 3300048926 Ga0496123_0000228 Ga0496123_0000228_34187_35335 380
396 3300048926 Ga0496123_0023306 Ga0496123_0023306_3122_4282 380
397 3300048928 Ga0496125_0000041 Ga0496125_0000041_34136_35284 380
398 3300048929 Ga0496126_0173967 Ga0496126_0173967_450_1610 380
399 3300049573 Ga0501037_0056510 Ga0501037_0056510_1594_2769 380
400 3300053125 Ga0500618_007193 Ga0500618_007193_696_1838 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

224

413

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8507 9 356
2q19-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase apo form 0.8487 9 356
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8478 9 356
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8394 9 356
2q19-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase apo form 0.8375 9 356
ID Description Score Start End Superfamily
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.915 159 356 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8091 159 356 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8005 170 356 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7941 169 356 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7893 169 355 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A3C2BTK7-F1-model_v4 Fumarylacetoacetate hydrolase 0.986 173 378 GO:0016787
GO:0044281
AF-A0A7C7PRQ4-F1-model_v4 Fumarylacetoacetate hydrolase 0.9845 173 380 GO:0016787
GO:0044281
AF-A0A3B9VWR8-F1-model_v4 Fumarylacetoacetate hydrolase 0.982 158 378 GO:0016787
GO:0044281
AF-A0A358GU30-F1-model_v4 deleted 0.9752 185 380
AF-A0A7C7PRQ4-F1-model_v4 Fumarylacetoacetate hydrolase 0.9752 173 380 GO:0016787
GO:0044281

Feature Viewer

pLDDT pTM Quality
88.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map