F434538

General Info

Members Datasets Scaffolds Average Seq Length
400 172 800 160

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10026159|Ga0081455_100261595
Length 166
Sequence VDPQAPPLHPDVEPLAGLLGTWRGEGAGEYPTISPFRYGEEVRFWHVGKPFLAYAQRTWSLDDGRPLHGETGYWRAKPGGVVELVLAHPTGIVEVQEGRQDGGRIELRSTTMAGTATAKEVTALRRRFDLDGDRLAYTVAMAAVGQPLQHHLAAELRRVEGDAVRG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
73 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
74 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
75 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
76 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
77 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
78 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
79 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
80 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
81 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
82 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
83 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
84 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
85 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
86 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
87 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
88 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
89 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
90 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
91 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
92 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
93 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 2643221617 Nocardioides sp. Root79 Isolate Unclassified
171 2643221620 Nocardioides sp. Root240 Isolate Unclassified
172 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.25
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 0.75
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10026159 3300005937 Bacteria 5375
2 JGI25406J46586_10012875 3300003203 Bacteria 3613
3 JGI25407J50210_10001491 3300003373 Bacteria 5310
4 JGI25407J50210_10020197 3300003373 Bacteria 1733
5 JGI25407J50210_10033079 3300003373 Bacteria 1336
6 JGI25407J50210_10036973 3300003373 Bacteria 1256
7 JGI25407J50210_10161719 3300003373 Bacteria 551
8 JGI25405J52794_10052631 3300003911 Bacteria 874
9 Ga0070668_100038902 3300005347 Bacteria 3638
10 Ga0070667_101038719 3300005367 Bacteria 765
11 Ga0070714_102033901 3300005435 Bacteria 560
12 Ga0070708_100449901 3300005445 Unclassified 1215
13 Ga0070662_100008838 3300005457 Bacteria 6566
14 Ga0070681_10485582 3300005458 Bacteria 1148
15 Ga0070706_100044158 3300005467 Bacteria 4118
16 Ga0070699_100236129 3300005518 Unclassified 1631
17 Ga0070686_100313558 3300005544 Bacteria 1167
18 Ga0068855_100289870 3300005563 Bacteria 1815
19 Ga0068861_100050476 3300005719 Bacteria 3154
20 Ga0081455_10001335 3300005937 Bacteria 30513
21 Ga0081455_10008669 3300005937 Bacteria 10533
22 Ga0081538_10000054 3300005981 Bacteria 107029
23 Ga0081538_10000512 3300005981 Bacteria 43332
24 Ga0081538_10000552 3300005981 Bacteria 41376
25 Ga0081538_10000996 3300005981 Bacteria 30100
26 Ga0081538_10002505 3300005981 Bacteria 17878
27 Ga0081538_10004343 3300005981 Bacteria 13094
28 Ga0081538_10005741 3300005981 Bacteria 11088
29 Ga0081538_10013893 3300005981 Bacteria 6345
30 Ga0081538_10045557 3300005981 Bacteria 2716
31 Ga0081538_10052647 3300005981 Bacteria 2430
32 Ga0081538_10076984 3300005981 Bacteria 1799
33 Ga0081538_10130211 3300005981 Bacteria 1184
34 Ga0081538_10244660 3300005981 Bacteria 689
35 Ga0081539_10000896 3300005985 Bacteria 56801
36 Ga0081539_10027970 3300005985 Bacteria 3556
37 Ga0081539_10089752 3300005985 Bacteria 1591
38 Ga0081539_10346851 3300005985 Bacteria 625
39 Ga0070717_11107071 3300006028 Unclassified 721
40 Ga0075365_10007233 3300006038 Bacteria 6202
41 Ga0075365_10148123 3300006038 Unclassified 1632
42 Ga0075363_100114054 3300006048 Bacteria 1504
43 Ga0075364_10055147 3300006051 Bacteria 2600
44 Ga0075432_10004188 3300006058 Bacteria 4911
45 Ga0075362_10039515 3300006177 Bacteria 2075
46 Ga0075367_10301345 3300006178 Bacteria 1009
47 Ga0075427_10032408 3300006194 Unclassified 861
48 Ga0075370_10082144 3300006353 Bacteria 1852
49 Ga0075428_100051655 3300006844 Bacteria 4507
50 Ga0075428_100134923 3300006844 Bacteria 2684
51 Ga0075428_100517758 3300006844 Bacteria 1276
52 Ga0075428_100736283 3300006844 Unclassified 1049
53 Ga0075430_100008854 3300006846 Bacteria 8493
54 Ga0075430_100154518 3300006846 Bacteria 1910
55 Ga0075431_100022825 3300006847 Bacteria 6396
56 Ga0075431_100172453 3300006847 Bacteria 2222
57 Ga0075433_10263471 3300006852 Unclassified 1528
58 Ga0075434_100136953 3300006871 Bacteria 2468
59 Ga0075429_100017126 3300006880 Bacteria 6266
60 Ga0075435_101103125 3300007076 Bacteria 694
61 Ga0105240_11164591 3300009093 Bacteria 818
62 Ga0111539_10008606 3300009094 Bacteria 12960
63 Ga0114129_10151074 3300009147 Bacteria 3178
64 Ga0114129_10245507 3300009147 Bacteria 2405
65 Ga0114129_10499787 3300009147 Bacteria 1588
66 Ga0114129_10844232 3300009147 Bacteria 1165
67 Ga0114129_10922830 3300009147 Unclassified 1105
68 Ga0114129_11584256 3300009147 Bacteria 802
69 Ga0105249_10006226 3300009553 Bacteria 10361
70 Ga0163162_10016713 3300013306 Bacteria 7171
71 Ga0163162_10529207 3300013306 Bacteria 1308
72 Ga0206350_11461440 3300020080 Bacteria 1297
73 Ga0213876_10158778 3300021384 Bacteria 1203
74 Ga0207684_10198484 3300025910 Bacteria 1731
75 Ga0207695_11231484 3300025913 Bacteria 629
76 Ga0207687_10576516 3300025927 Bacteria 946
77 Ga0207706_10005332 3300025933 Bacteria 11987
78 Ga0207667_11519014 3300025949 Unclassified 640
79 Ga0207712_10120179 3300025961 Bacteria 1987
80 Ga0207668_10132234 3300025972 Bacteria 1907
81 Ga0207675_100001854 3300026118 Bacteria 21183
82 Ga0207428_10013347 3300027907 Bacteria 7182
83 Ga0307408_100002780 3300031548 Bacteria 12146
84 Ga0307408_100012680 3300031548 Bacteria 5591
85 Ga0307408_100141466 3300031548 Bacteria 1889
86 Ga0307405_10003076 3300031731 Bacteria 7567
87 Ga0307405_10010424 3300031731 Bacteria 4815
88 Ga0307405_10019421 3300031731 Bacteria 3774
89 Ga0307405_10032536 3300031731 Bacteria 3083
90 Ga0307405_10067476 3300031731 Bacteria 2286
91 Ga0307405_10659835 3300031731 Bacteria 861
92 Ga0307405_11244252 3300031731 Bacteria 645
93 Ga0307413_10014781 3300031824 Bacteria 3979
94 Ga0307413_10025348 3300031824 Bacteria 3250
95 Ga0307413_10059515 3300031824 Bacteria 2347
96 Ga0307413_10081558 3300031824 Bacteria 2074
97 Ga0307413_10099494 3300031824 Bacteria 1917
98 Ga0307413_10580282 3300031824 Bacteria 914
99 Ga0307410_10002033 3300031852 Bacteria 9544
100 Ga0307410_10004655 3300031852 Bacteria 7128
101 Ga0307410_10036190 3300031852 Bacteria 3212
102 Ga0307410_10046725 3300031852 Bacteria 2889
103 Ga0307410_10249426 3300031852 Unclassified 1379
104 Ga0307410_10368208 3300031852 Bacteria 1153
105 Ga0307406_10006313 3300031901 Bacteria 6536
106 Ga0307406_10019046 3300031901 Bacteria 4023
107 Ga0307406_10089129 3300031901 Bacteria 2071
108 Ga0307406_10429686 3300031901 Bacteria 1054
109 Ga0307406_10453586 3300031901 Unclassified 1029
110 Ga0307407_10001080 3300031903 Bacteria 9483
111 Ga0307407_10004431 3300031903 Bacteria 5963
112 Ga0307407_10064999 3300031903 Bacteria 2146
113 Ga0307407_10099906 3300031903 Bacteria 1798
114 Ga0307412_10015181 3300031911 Bacteria 4558
115 Ga0307412_10100470 3300031911 Bacteria 2045
116 Ga0307412_10172122 3300031911 Bacteria 1620
117 Ga0307412_10181758 3300031911 Bacteria 1583
118 Ga0307412_10280015 3300031911 Bacteria 1309
119 Ga0307412_10866293 3300031911 Bacteria 789
120 Ga0307412_11024896 3300031911 Bacteria 730
121 Ga0307409_100001370 3300031995 Bacteria 11890
122 Ga0307409_100003500 3300031995 Bacteria 8548
123 Ga0307409_100043602 3300031995 Bacteria 3370
124 Ga0307409_100069695 3300031995 Bacteria 2788
125 Ga0307409_100132411 3300031995 Bacteria 2133
126 Ga0307409_100443315 3300031995 Unclassified 1251
127 Ga0307416_100003272 3300032002 Bacteria 9477
128 Ga0307416_100006063 3300032002 Bacteria 7527
129 Ga0307416_100165306 3300032002 Bacteria 2051
130 Ga0307416_100293724 3300032002 Unclassified 1610
131 Ga0307416_100335645 3300032002 Bacteria 1521
132 Ga0307416_101023355 3300032002 Bacteria 929
133 Ga0307414_10083702 3300032004 Bacteria 2344
134 Ga0307414_10114686 3300032004 Bacteria 2059
135 Ga0307414_10535670 3300032004 Unclassified 1041
136 Ga0307414_10565622 3300032004 Bacteria 1015
137 Ga0307411_10008742 3300032005 Bacteria 5268
138 Ga0307411_10026926 3300032005 Bacteria 3469
139 Ga0307411_10161865 3300032005 Bacteria 1677
140 Ga0307411_11217070 3300032005 Bacteria 683
141 Ga0307411_11455087 3300032005 Bacteria 628
142 Ga0307411_11648496 3300032005 Bacteria 593
143 Ga0307415_100000554 3300032126 Bacteria 16374
144 Ga0307415_100004269 3300032126 Bacteria 7391
145 Ga0307415_100007256 3300032126 Bacteria 6050
146 Ga0307415_100020375 3300032126 Bacteria 4049
147 Ga0307415_100038076 3300032126 Bacteria 3166
148 Ga0307415_100141995 3300032126 Bacteria 1835
149 Ga0307415_100160572 3300032126 Bacteria 1741
150 Ga0307415_100239584 3300032126 Bacteria 1466
151 Ga0373937_1051335 3300036401 Unclassified 763
152 Ga0395899_0213546 3300037312 Bacteria 1340
153 Ga0395900_0029025 3300037418 Bacteria 5673
154 Ga0395900_0172189 3300037418 Bacteria 2203
155 Ga0395900_0283917 3300037418 Bacteria 1646
156 Ga0395898_0051414 3300037466 Bacteria 4029
157 Ga0395898_0439160 3300037466 Bacteria 1243
158 Ga0395898_0617094 3300037466 Bacteria 1027
159 Ga0395905_0097521 3300037471 Bacteria 2760
160 Ga0395905_0153574 3300037471 Bacteria 2165
161 Ga0395905_0190433 3300037471 Bacteria 1924
162 Ga0395905_1112345 3300037471 Bacteria 693
163 Ga0395901_0012742 3300038443 Bacteria 8529
164 Ga0395901_0036454 3300038443 Bacteria 5084
165 Ga0395901_0104644 3300038443 Bacteria 2970
166 Ga0395901_0286857 3300038443 Unclassified 1709
167 Ga0395901_0572785 3300038443 Bacteria 1142
168 Ga0436365_0296904 3300039437 Bacteria 5669
169 Ga0436360_0155697 3300039438 Bacteria 1890
170 Ga0436361_0347923 3300039447 Unclassified 1293
171 Ga0436361_0805556 3300039447 Bacteria 2355
172 Ga0436361_0910221 3300039447 Bacteria 3830
173 Ga0436362_0006529 3300039453 Bacteria 3179
174 Ga0436362_0300265 3300039453 Bacteria 10387
175 Ga0436362_1256792 3300039453 Bacteria 2639
176 Ga0439466_0212201 3300041411 Bacteria 588
177 Ga0451797_0505619 3300041453 Bacteria 643
178 Ga0439443_000606 3300042003 Bacteria 3359
179 Ga0439443_002435 3300042003 Bacteria 2225
180 Ga0439443_003765 3300042003 Bacteria 1937
181 Ga0439448_0000457 3300042005 Bacteria 9415
182 Ga0439448_0001947 3300042005 Bacteria 5507
183 Ga0439448_0044986 3300042005 Bacteria 1436
184 Ga0439448_0086713 3300042005 Bacteria 1055
185 Ga0439448_0093543 3300042005 Bacteria 1017
186 Ga0439450_000279 3300042008 Bacteria 6263
187 Ga0439450_003252 3300042008 Bacteria 2663
188 Ga0439450_013518 3300042008 Bacteria 1642
189 Ga0439451_041156 3300042009 Bacteria 927
190 Ga0439454_001735 3300042011 Bacteria 2166
191 Ga0439454_035284 3300042011 Bacteria 800
192 Ga0439455_0002580 3300042012 Bacteria 3321
193 Ga0439455_0007979 3300042012 Bacteria 2258
194 Ga0439455_0077819 3300042012 Unclassified 898
195 Ga0439455_0214378 3300042012 Bacteria 559
196 Ga0439456_015740 3300042013 Bacteria 1581
197 Ga0439463_007407 3300042016 Bacteria 2710
198 Ga0439463_039034 3300042016 Bacteria 1205
199 Ga0439463_082025 3300042016 Bacteria 829
200 Ga0439463_123852 3300042016 Unclassified 668
201 Ga0450913_000269 3300042117 Bacteria 1945
202 Ga0450888_038649 3300042126 Bacteria 659
203 Ga0450903_015129 3300042138 Bacteria 1217
204 Ga0450905_002215 3300042142 Bacteria 2488
205 Ga0450905_060625 3300042142 Bacteria 631
206 Ga0439458_0048080 3300042157 Bacteria 1048
207 Ga0439435_0008838 3300042436 Bacteria 2347
208 Ga0439435_0027370 3300042436 Bacteria 1525
209 Ga0439444_0000275 3300042437 Bacteria 5231
210 Ga0439444_0029103 3300042437 Bacteria 1027
211 Ga0439444_0090021 3300042437 Bacteria 683
212 Ga0439464_0000785 3300042439 Bacteria 6937
213 Ga0439464_0007278 3300042439 Bacteria 2892
214 Ga0439464_0018779 3300042439 Bacteria 1883
215 Ga0439460_0000274 3300042461 Bacteria 10673
216 Ga0439460_0004369 3300042461 Bacteria 3447
217 Ga0439460_0009174 3300042461 Bacteria 2509
218 Ga0450918_047459 3300042531 Bacteria 778
219 Ga0450893_0033994 3300042532 Bacteria 917
220 Ga0450893_0040828 3300042532 Unclassified 850
221 Ga0439440_0000793 3300042993 Bacteria 5466
222 Ga0439440_0006958 3300042993 Bacteria 2289
223 Ga0439440_0010091 3300042993 Bacteria 1966
224 Ga0466970_0021500 3300044765 Bacteria 3360
225 Ga0466960_0118795 3300044901 Bacteria 1382
226 Ga0495592_0182250 3300046454 Bacteria 1429
227 Ga0495651_0086454 3300046462 Bacteria 2359
228 Ga0495584_0027568 3300046491 Bacteria 2878
229 Ga0495596_0191616 3300046500 Unclassified 795
230 Ga0495583_0267263 3300046506 Bacteria 683
231 Ga0495630_0042190 3300046517 Unclassified 3408
232 Ga0495631_0112304 3300046518 Unclassified 1172
233 Ga0495656_0005177 3300046615 Bacteria 4496
234 Ga0495668_0701800 3300046616 Bacteria 560
235 Ga0495659_0121169 3300046664 Unclassified 1030
236 Ga0495613_0090151 3300046689 Bacteria 2221
237 Ga0495670_0084477 3300046691 Unclassified 1620
238 Ga0495636_0060795 3300047318 Bacteria 1597
239 Ga0495679_053109 3300047446 Bacteria 1211
240 Ga0495684_0019677 3300047471 Bacteria 5201
241 Ga0496108_0943337 3300048911 Bacteria 739
242 Ga0496111_0890534 3300048914 Bacteria 641
243 Ga0501031_0037048 3300049568 Bacteria 3182
244 Ga0501031_0059218 3300049568 Bacteria 2496
245 Ga0501031_0256739 3300049568 Bacteria 1136
246 Ga0501031_0281707 3300049568 Bacteria 1078
247 Ga0501032_0005830 3300049569 Bacteria 9111
248 Ga0501032_0040440 3300049569 Bacteria 3170
249 Ga0501032_0322740 3300049569 Bacteria 996
250 Ga0501033_0007142 3300049570 Bacteria 8716
251 Ga0501033_0009505 3300049570 Bacteria 7485
252 Ga0501033_0051026 3300049570 Bacteria 3067
253 Ga0501033_0463243 3300049570 Bacteria 879
254 Ga0501034_0215692 3300049571 Bacteria 1873
255 Ga0501034_1516965 3300049571 Bacteria 544
256 Ga0501036_0005922 3300049572 Bacteria 9906
257 Ga0501036_0012907 3300049572 Bacteria 6938
258 Ga0501036_0044626 3300049572 Bacteria 3755
259 Ga0501036_0140852 3300049572 Bacteria 2035
260 Ga0501036_0452135 3300049572 Unclassified 1070
261 Ga0501036_0514174 3300049572 Bacteria 996
262 Ga0501037_0011835 3300049573 Bacteria 6426
263 Ga0501037_0044396 3300049573 Bacteria 3264
264 Ga0501037_0066134 3300049573 Bacteria 2634
265 Ga0501037_0070458 3300049573 Bacteria 2544
266 Ga0501038_0023293 3300049574 Bacteria 5538
267 Ga0501038_0029672 3300049574 Bacteria 4844
268 Ga0501038_0043272 3300049574 Bacteria 3916
269 Ga0501038_0120034 3300049574 Bacteria 2169
270 Ga0501039_0002693 3300049575 Bacteria 13258
271 Ga0501039_0003188 3300049575 Bacteria 12267
272 Ga0501039_0049414 3300049575 Bacteria 3251
273 Ga0501039_1018845 3300049575 Unclassified 643
274 Ga0501040_0000179 3300049576 Bacteria 36114
275 Ga0501040_0001899 3300049576 Bacteria 13428
276 Ga0501040_0002404 3300049576 Bacteria 12052
277 Ga0501040_0003800 3300049576 Bacteria 9793
278 Ga0501041_0001063 3300049577 Bacteria 15023
279 Ga0501041_0001286 3300049577 Bacteria 13806
280 Ga0501041_0087729 3300049577 Bacteria 1920
281 Ga0501041_0124915 3300049577 Bacteria 1601
282 Ga0501041_0128009 3300049577 Bacteria 1581
283 Ga0501042_0000030 3300049578 Bacteria 46210
284 Ga0501042_0004676 3300049578 Bacteria 8734
285 Ga0501042_0011415 3300049578 Bacteria 5994
286 Ga0501042_0018112 3300049578 Bacteria 4872
287 Ga0501043_0028213 3300049579 Bacteria 4406
288 Ga0501043_0116935 3300049579 Bacteria 2092
289 Ga0501043_0120855 3300049579 Bacteria 2054
290 Ga0501043_0171939 3300049579 Bacteria 1690
291 Ga0501046_0000637 3300049580 Bacteria 34276
292 Ga0501046_0004331 3300049580 Bacteria 12918
293 Ga0501046_0005539 3300049580 Bacteria 11281
294 Ga0501046_0021199 3300049580 Bacteria 5365
295 Ga0501047_0627448 3300049581 Bacteria 895
296 Ga0501048_0000527 3300049582 Bacteria 26925
297 Ga0501048_0009766 3300049582 Bacteria 7195
298 Ga0501048_0022536 3300049582 Bacteria 4605
299 Ga0501048_0203788 3300049582 Bacteria 1402
300 Ga0501067_0173191 3300049583 Bacteria 1202
301 Ga0501068_0019851 3300049584 Bacteria 3908
302 Ga0501068_0034851 3300049584 Bacteria 3004
303 Ga0501068_0162804 3300049584 Bacteria 1406
304 Ga0501069_0134995 3300049585 Bacteria 1414
305 Ga0501069_0145891 3300049585 Bacteria 1358
306 Ga0501070_0096120 3300049586 Bacteria 2451
307 Ga0501070_0652794 3300049586 Bacteria 835
308 Ga0501071_0008862 3300049587 Bacteria 6669
309 Ga0501071_0051256 3300049587 Bacteria 2973
310 Ga0501072_0041051 3300049588 Bacteria 3633
311 Ga0501072_0055019 3300049588 Bacteria 3136
312 Ga0501072_0108519 3300049588 Bacteria 2208
313 Ga0501072_0169652 3300049588 Bacteria 1742
314 Ga0501073_0372506 3300049589 Bacteria 986
315 Ga0501074_0000119 3300049590 Bacteria 39948
316 Ga0501074_0087986 3300049590 Bacteria 2224
317 Ga0501075_0003207 3300049591 Bacteria 10938
318 Ga0501075_0011638 3300049591 Bacteria 6231
319 Ga0501075_0013616 3300049591 Bacteria 5808
320 Ga0501075_0048011 3300049591 Bacteria 3208
321 Ga0501076_0000711 3300049592 Bacteria 21481
322 Ga0501076_0009854 3300049592 Bacteria 7063
323 Ga0501076_0013283 3300049592 Bacteria 6175
324 Ga0501077_0000500 3300049593 Bacteria 23803
325 Ga0501077_0003853 3300049593 Bacteria 9041
326 Ga0501077_0008637 3300049593 Bacteria 6313
327 Ga0501077_0029519 3300049593 Bacteria 3486
328 Ga0501077_0810706 3300049593 Unclassified 602
329 Ga0501079_0000605 3300049741 Bacteria 23765
330 Ga0501079_0015042 3300049741 Bacteria 5899
331 Ga0501079_0025480 3300049741 Bacteria 4535
332 Ga0501079_0246311 3300049741 Bacteria 1396
333 Ga0501079_1092148 3300049741 Unclassified 629
334 Ga0501080_0137578 3300049742 Bacteria 2260
335 Ga0501080_0244230 3300049742 Bacteria 1638
336 Ga0501081_0000227 3300049743 Bacteria 28267
337 Ga0501081_0007888 3300049743 Bacteria 6905
338 Ga0501081_0008516 3300049743 Bacteria 6665
339 Ga0501081_0037866 3300049743 Bacteria 3292
340 Ga0501083_0041341 3300049744 Bacteria 3127
341 Ga0501083_0066509 3300049744 Bacteria 2400
342 Ga0501083_0118713 3300049744 Bacteria 1735
343 Ga0501083_0124047 3300049744 Bacteria 1693
344 Ga0501035_0030947 3300049822 Bacteria 4875
345 Ga0501035_0159193 3300049822 Bacteria 1955
346 Ga0501045_0000169 3300049824 Bacteria 35650
347 Ga0501045_0009851 3300049824 Bacteria 6686
348 Ga0501045_0769465 3300049824 Bacteria 709
349 Ga0501212_077267 3300049851 Bacteria 598
350 nmdc:mga03683_67801_c1 3300050489 Bacteria 1519
351 nmdc:mga03n38_111469_c1 3300050490 Bacteria 1333
352 nmdc:mga03n38_21480_c1 3300050490 Bacteria 2598
353 nmdc:mga00v17_1709_c1 3300050491 Bacteria 11418
354 nmdc:mga0yw44_33910_c1 3300050492 Bacteria 2987
355 nmdc:mga0yw44_56619_c1 3300050492 Bacteria 2390
356 nmdc:mga0k408_242436_c1 3300050493 Bacteria 1076
357 nmdc:mga07m45_337724_c1 3300050496 Bacteria 875
358 nmdc:mga05p37_17505_c1 3300050507 Bacteria 8281
359 nmdc:mga05p37_249182_c1 3300050507 Bacteria 1157
360 nmdc:mga05p37_384903_c1 3300050507 Bacteria 1642
361 nmdc:mga05p37_476823_c1 3300050507 Bacteria 1438
362 nmdc:mga05p37_82851_c1 3300050507 Bacteria 3953
363 nmdc:mga09592_43349_c1 3300050508 Bacteria 3788
364 nmdc:mga09592_470340_c1 3300050508 Bacteria 1084
365 nmdc:mga0qj67_115477_c1 3300050509 Unclassified 2169
366 nmdc:mga0qj67_11725_c1 3300050509 Bacteria 6578
367 nmdc:mga0qj67_770691_c1 3300050509 Bacteria 762
368 nmdc:mga06r32_126305_c1 3300050510 Bacteria 2527
369 nmdc:mga06r32_134768_c1 3300050510 Bacteria 2444
370 nmdc:mga06r32_25851_c1 3300050510 Bacteria 5466
371 nmdc:mga06r32_385397_c1 3300050510 Bacteria 1384
372 nmdc:mga06r32_604354_c1 3300050510 Bacteria 1067
373 nmdc:mga08y16_493_c1 3300050511 Bacteria 36438
374 nmdc:mga0n895_48352_c1 3300050512 Bacteria 4163
375 nmdc:mga0rr50_910596_c1 3300050513 Bacteria 750
376 nmdc:mga0a205_10427_c1 3300050515 Bacteria 8535
377 nmdc:mga0a205_8125_c1 3300050515 Bacteria 9535
378 Ga0495601_0049390 3300053077 Unclassified 2652
379 Ga0495595_0010070 3300053084 Unclassified 3923
380 Ga0495619_0173057 3300053085 Bacteria 1493
381 Ga0500573_0037295 3300053140 Bacteria 2808
382 Ga0501084_0000290 3300054114 Bacteria 38089
383 Ga0501084_0000667 3300054114 Bacteria 26186
384 Ga0501084_0024029 3300054114 Bacteria 5083
385 Ga0501084_0047853 3300054114 Bacteria 3581
386 Ga0590071_019373 3300059421 Bacteria 1601
387 Ga0590074_001856 3300059423 Bacteria 3449
388 Ga0590075_005325 3300059424 Bacteria 3040
389 Ga0501082_0001092 3300060353 Bacteria 24030
390 Ga0501082_0003574 3300060353 Bacteria 13576
391 Ga0501082_0007436 3300060353 Bacteria 9451
392 Ga0501082_0112940 3300060353 Bacteria 2352
393 Ga0501082_1253885 3300060353 Unclassified 648
394 Ga0530510_0012134 3300061734 Bacteria 6048
395 Ga0530510_0013293 3300061734 Bacteria 5786
396 Ga0530510_0112211 3300061734 Bacteria 1997
397 Ga0530510_0832167 3300061734 Unclassified 705
398 2644099868 2643221617 Bacteria 5139111
399 2644117474 2643221620 Bacteria 5134593
400 2812331144 2811994874 Bacteria 5367947
401 Ga0081455_10026159
402 JGI25406J46586_10012875
403 JGI25407J50210_10001491
404 JGI25407J50210_10020197
405 JGI25407J50210_10033079
406 JGI25407J50210_10036973
407 JGI25407J50210_10161719
408 JGI25405J52794_10052631
409 Ga0070668_100038902
410 Ga0070667_101038719
411 Ga0070714_102033901
412 Ga0070708_100449901
413 Ga0070662_100008838
414 Ga0070681_10485582
415 Ga0070706_100044158
416 Ga0070699_100236129
417 Ga0070686_100313558
418 Ga0068855_100289870
419 Ga0068861_100050476
420 Ga0081455_10001335
421 Ga0081455_10008669
422 Ga0081538_10000054
423 Ga0081538_10000512
424 Ga0081538_10000552
425 Ga0081538_10000996
426 Ga0081538_10002505
427 Ga0081538_10004343
428 Ga0081538_10005741
429 Ga0081538_10013893
430 Ga0081538_10045557
431 Ga0081538_10052647
432 Ga0081538_10076984
433 Ga0081538_10130211
434 Ga0081538_10244660
435 Ga0081539_10000896
436 Ga0081539_10027970
437 Ga0081539_10089752
438 Ga0081539_10346851
439 Ga0070717_11107071
440 Ga0075365_10007233
441 Ga0075365_10148123
442 Ga0075363_100114054
443 Ga0075364_10055147
444 Ga0075432_10004188
445 Ga0075362_10039515
446 Ga0075367_10301345
447 Ga0075427_10032408
448 Ga0075370_10082144
449 Ga0075428_100051655
450 Ga0075428_100134923
451 Ga0075428_100517758
452 Ga0075428_100736283
453 Ga0075430_100008854
454 Ga0075430_100154518
455 Ga0075431_100022825
456 Ga0075431_100172453
457 Ga0075433_10263471
458 Ga0075434_100136953
459 Ga0075429_100017126
460 Ga0075435_101103125
461 Ga0105240_11164591
462 Ga0111539_10008606
463 Ga0114129_10151074
464 Ga0114129_10245507
465 Ga0114129_10499787
466 Ga0114129_10844232
467 Ga0114129_10922830
468 Ga0114129_11584256
469 Ga0105249_10006226
470 Ga0163162_10016713
471 Ga0163162_10529207
472 Ga0206350_11461440
473 Ga0213876_10158778
474 Ga0207684_10198484
475 Ga0207695_11231484
476 Ga0207687_10576516
477 Ga0207706_10005332
478 Ga0207667_11519014
479 Ga0207712_10120179
480 Ga0207668_10132234
481 Ga0207675_100001854
482 Ga0207428_10013347
483 Ga0307408_100002780
484 Ga0307408_100012680
485 Ga0307408_100141466
486 Ga0307405_10003076
487 Ga0307405_10010424
488 Ga0307405_10019421
489 Ga0307405_10032536
490 Ga0307405_10067476
491 Ga0307405_10659835
492 Ga0307405_11244252
493 Ga0307413_10014781
494 Ga0307413_10025348
495 Ga0307413_10059515
496 Ga0307413_10081558
497 Ga0307413_10099494
498 Ga0307413_10580282
499 Ga0307410_10002033
500 Ga0307410_10004655
501 Ga0307410_10036190
502 Ga0307410_10046725
503 Ga0307410_10249426
504 Ga0307410_10368208
505 Ga0307406_10006313
506 Ga0307406_10019046
507 Ga0307406_10089129
508 Ga0307406_10429686
509 Ga0307406_10453586
510 Ga0307407_10001080
511 Ga0307407_10004431
512 Ga0307407_10064999
513 Ga0307407_10099906
514 Ga0307412_10015181
515 Ga0307412_10100470
516 Ga0307412_10172122
517 Ga0307412_10181758
518 Ga0307412_10280015
519 Ga0307412_10866293
520 Ga0307412_11024896
521 Ga0307409_100001370
522 Ga0307409_100003500
523 Ga0307409_100043602
524 Ga0307409_100069695
525 Ga0307409_100132411
526 Ga0307409_100443315
527 Ga0307416_100003272
528 Ga0307416_100006063
529 Ga0307416_100165306
530 Ga0307416_100293724
531 Ga0307416_100335645
532 Ga0307416_101023355
533 Ga0307414_10083702
534 Ga0307414_10114686
535 Ga0307414_10535670
536 Ga0307414_10565622
537 Ga0307411_10008742
538 Ga0307411_10026926
539 Ga0307411_10161865
540 Ga0307411_11217070
541 Ga0307411_11455087
542 Ga0307411_11648496
543 Ga0307415_100000554
544 Ga0307415_100004269
545 Ga0307415_100007256
546 Ga0307415_100020375
547 Ga0307415_100038076
548 Ga0307415_100141995
549 Ga0307415_100160572
550 Ga0307415_100239584
551 Ga0373937_1051335
552 Ga0395899_0213546
553 Ga0395900_0029025
554 Ga0395900_0172189
555 Ga0395900_0283917
556 Ga0395898_0051414
557 Ga0395898_0439160
558 Ga0395898_0617094
559 Ga0395905_0097521
560 Ga0395905_0153574
561 Ga0395905_0190433
562 Ga0395905_1112345
563 Ga0395901_0012742
564 Ga0395901_0036454
565 Ga0395901_0104644
566 Ga0395901_0286857
567 Ga0395901_0572785
568 Ga0436365_0296904
569 Ga0436360_0155697
570 Ga0436361_0347923
571 Ga0436361_0805556
572 Ga0436361_0910221
573 Ga0436362_0006529
574 Ga0436362_0300265
575 Ga0436362_1256792
576 Ga0439466_0212201
577 Ga0451797_0505619
578 Ga0439443_000606
579 Ga0439443_002435
580 Ga0439443_003765
581 Ga0439448_0000457
582 Ga0439448_0001947
583 Ga0439448_0044986
584 Ga0439448_0086713
585 Ga0439448_0093543
586 Ga0439450_000279
587 Ga0439450_003252
588 Ga0439450_013518
589 Ga0439451_041156
590 Ga0439454_001735
591 Ga0439454_035284
592 Ga0439455_0002580
593 Ga0439455_0007979
594 Ga0439455_0077819
595 Ga0439455_0214378
596 Ga0439456_015740
597 Ga0439463_007407
598 Ga0439463_039034
599 Ga0439463_082025
600 Ga0439463_123852
601 Ga0450913_000269
602 Ga0450888_038649
603 Ga0450903_015129
604 Ga0450905_002215
605 Ga0450905_060625
606 Ga0439458_0048080
607 Ga0439435_0008838
608 Ga0439435_0027370
609 Ga0439444_0000275
610 Ga0439444_0029103
611 Ga0439444_0090021
612 Ga0439464_0000785
613 Ga0439464_0007278
614 Ga0439464_0018779
615 Ga0439460_0000274
616 Ga0439460_0004369
617 Ga0439460_0009174
618 Ga0450918_047459
619 Ga0450893_0033994
620 Ga0450893_0040828
621 Ga0439440_0000793
622 Ga0439440_0006958
623 Ga0439440_0010091
624 Ga0466970_0021500
625 Ga0466960_0118795
626 Ga0495592_0182250
627 Ga0495651_0086454
628 Ga0495584_0027568
629 Ga0495596_0191616
630 Ga0495583_0267263
631 Ga0495630_0042190
632 Ga0495631_0112304
633 Ga0495656_0005177
634 Ga0495668_0701800
635 Ga0495659_0121169
636 Ga0495613_0090151
637 Ga0495670_0084477
638 Ga0495636_0060795
639 Ga0495679_053109
640 Ga0495684_0019677
641 Ga0496108_0943337
642 Ga0496111_0890534
643 Ga0501031_0037048
644 Ga0501031_0059218
645 Ga0501031_0256739
646 Ga0501031_0281707
647 Ga0501032_0005830
648 Ga0501032_0040440
649 Ga0501032_0322740
650 Ga0501033_0007142
651 Ga0501033_0009505
652 Ga0501033_0051026
653 Ga0501033_0463243
654 Ga0501034_0215692
655 Ga0501034_1516965
656 Ga0501036_0005922
657 Ga0501036_0012907
658 Ga0501036_0044626
659 Ga0501036_0140852
660 Ga0501036_0452135
661 Ga0501036_0514174
662 Ga0501037_0011835
663 Ga0501037_0044396
664 Ga0501037_0066134
665 Ga0501037_0070458
666 Ga0501038_0023293
667 Ga0501038_0029672
668 Ga0501038_0043272
669 Ga0501038_0120034
670 Ga0501039_0002693
671 Ga0501039_0003188
672 Ga0501039_0049414
673 Ga0501039_1018845
674 Ga0501040_0000179
675 Ga0501040_0001899
676 Ga0501040_0002404
677 Ga0501040_0003800
678 Ga0501041_0001063
679 Ga0501041_0001286
680 Ga0501041_0087729
681 Ga0501041_0124915
682 Ga0501041_0128009
683 Ga0501042_0000030
684 Ga0501042_0004676
685 Ga0501042_0011415
686 Ga0501042_0018112
687 Ga0501043_0028213
688 Ga0501043_0116935
689 Ga0501043_0120855
690 Ga0501043_0171939
691 Ga0501046_0000637
692 Ga0501046_0004331
693 Ga0501046_0005539
694 Ga0501046_0021199
695 Ga0501047_0627448
696 Ga0501048_0000527
697 Ga0501048_0009766
698 Ga0501048_0022536
699 Ga0501048_0203788
700 Ga0501067_0173191
701 Ga0501068_0019851
702 Ga0501068_0034851
703 Ga0501068_0162804
704 Ga0501069_0134995
705 Ga0501069_0145891
706 Ga0501070_0096120
707 Ga0501070_0652794
708 Ga0501071_0008862
709 Ga0501071_0051256
710 Ga0501072_0041051
711 Ga0501072_0055019
712 Ga0501072_0108519
713 Ga0501072_0169652
714 Ga0501073_0372506
715 Ga0501074_0000119
716 Ga0501074_0087986
717 Ga0501075_0003207
718 Ga0501075_0011638
719 Ga0501075_0013616
720 Ga0501075_0048011
721 Ga0501076_0000711
722 Ga0501076_0009854
723 Ga0501076_0013283
724 Ga0501077_0000500
725 Ga0501077_0003853
726 Ga0501077_0008637
727 Ga0501077_0029519
728 Ga0501077_0810706
729 Ga0501079_0000605
730 Ga0501079_0015042
731 Ga0501079_0025480
732 Ga0501079_0246311
733 Ga0501079_1092148
734 Ga0501080_0137578
735 Ga0501080_0244230
736 Ga0501081_0000227
737 Ga0501081_0007888
738 Ga0501081_0008516
739 Ga0501081_0037866
740 Ga0501083_0041341
741 Ga0501083_0066509
742 Ga0501083_0118713
743 Ga0501083_0124047
744 Ga0501035_0030947
745 Ga0501035_0159193
746 Ga0501045_0000169
747 Ga0501045_0009851
748 Ga0501045_0769465
749 Ga0501212_077267
750 nmdc:mga03683_67801_c1
751 nmdc:mga03n38_111469_c1
752 nmdc:mga03n38_21480_c1
753 nmdc:mga00v17_1709_c1
754 nmdc:mga0yw44_33910_c1
755 nmdc:mga0yw44_56619_c1
756 nmdc:mga0k408_242436_c1
757 nmdc:mga07m45_337724_c1
758 nmdc:mga05p37_17505_c1
759 nmdc:mga05p37_249182_c1
760 nmdc:mga05p37_384903_c1
761 nmdc:mga05p37_476823_c1
762 nmdc:mga05p37_82851_c1
763 nmdc:mga09592_43349_c1
764 nmdc:mga09592_470340_c1
765 nmdc:mga0qj67_115477_c1
766 nmdc:mga0qj67_11725_c1
767 nmdc:mga0qj67_770691_c1
768 nmdc:mga06r32_126305_c1
769 nmdc:mga06r32_134768_c1
770 nmdc:mga06r32_25851_c1
771 nmdc:mga06r32_385397_c1
772 nmdc:mga06r32_604354_c1
773 nmdc:mga08y16_493_c1
774 nmdc:mga0n895_48352_c1
775 nmdc:mga0rr50_910596_c1
776 nmdc:mga0a205_10427_c1
777 nmdc:mga0a205_8125_c1
778 Ga0495601_0049390
779 Ga0495595_0010070
780 Ga0495619_0173057
781 Ga0500573_0037295
782 Ga0501084_0000290
783 Ga0501084_0000667
784 Ga0501084_0024029
785 Ga0501084_0047853
786 Ga0590071_019373
787 Ga0590074_001856
788 Ga0590075_005325
789 Ga0501082_0001092
790 Ga0501082_0003574
791 Ga0501082_0007436
792 Ga0501082_0112940
793 Ga0501082_1253885
794 Ga0530510_0012134
795 Ga0530510_0013293
796 Ga0530510_0112211
797 Ga0530510_0832167
798 2644099868
799 2644117474
800 2812331144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08768

THAP4_heme-bd

THAP4-like, heme-binding beta-barrel domain

11

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ia8-assembly1.cif.gz_A the structure of the c-terminal heme nitrobindin domain of thap domain-containing protein 4 from homo sapiens 0.9584 7 161
2a13-assembly1.cif.gz_A x-ray structure of protein from arabidopsis thaliana at1g79260 0.9448 7 160
3wjf-assembly1.cif.gz_B crystal structure of mutant nitrobindin m75l/h76l/q96c/v128w/m148l/h158l (nb9) from arabidopsis thaliana 0.9443 7 160
2fr2-assembly1.cif.gz_A crystal structure of rv2717c from m. tuberculosis 0.9442 8 161
4ymy-assembly1.cif.gz_A-2 crystal structure of mutant nitrobindin m75a/h76l/q96c/m148l/h158a (nb11) from arabidopsis thaliana 0.9441 7 160
ID Description Score Start End Superfamily
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9598 13 160 2.40.128.20
af_A0A1D6NFT9_14_110_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9539 8 102 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.945 7 160 2.40.128.20
2fr2A00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9442 8 161 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9395 9 161 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A7C1YBN1-F1-model_v4 Peroxynitrite isomerase (EC 5.99.-.-) (Ferric nitrobindin) (Nb(III)) 0.9952 8 161 GO:0020037
GO:0046872
GO:0062213
AF-A0A7Y2IFM1-F1-model_v4 FABP family protein 0.9938 8 160
AF-A0A538B7U8-F1-model_v4 FABP family protein 0.9938 25 161
AF-A0A538FD29-F1-model_v4 Peroxynitrite isomerase (EC 5.99.-.-) (Ferric nitrobindin) (Nb(III)) 0.9936 6 161 GO:0020037
GO:0046872
GO:0062213
AF-A0A502DJ38-F1-model_v4 Peroxynitrite isomerase (EC 5.99.-.-) (Ferric nitrobindin) (Nb(III)) 0.9872 8 160 GO:0020037
GO:0046872
GO:0062213

Map