F434367

General Info

Members Datasets Scaffolds Average Seq Length
399 230 391 131

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0011093|Ga0495590_0011093_2775_3233
Length 152
Sequence VTTGDIAMTDNRDLQAQNASKVQAQPQSQPPXXXGASRAPQDERAMVPRVDVLEDEAGITLLADLPGVPREQLELKVEGDTLLIEGTVAAFAPEGLEALYAEVRLPRYRRAFTLSRELDTNAIQAQLRDGVLNLRIPKQAHAQPRRIDVQVG

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
5 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221656 Pelomonas sp. Root405 Isolate Unclassified
8 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
160 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
161 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
162 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
163 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
164 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
165 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
204 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
205 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
208 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
227 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
228 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0.5
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.55
Nodule 0
Rhizoplane 1.75
Rhizosphere 67.92
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10016154 3300003316 Bacteria 6196
2 rootH1_10048792 3300003316 Bacteria 4403
3 rootH1_10103668 3300003316 Bacteria 1471
4 rootH2_10302748 3300003320 Bacteria 1913
5 rootL2_10029916 3300003322 Bacteria 7715
6 rootL2_10038151 3300003322 Bacteria 5854
7 rootH1_10022985 3300003316 Bacteria 2204
8 rootH1_10022985 3300003323 Bacteria 17952
9 rootH1_10183195 3300003323 Bacteria 1456
10 Ga0055531_10000134 3300003794 Bacteria 84304
11 Ga0055543_1003274 3300004625 Bacteria 4879
12 Ga0065165_1000233 3300005262 Bacteria 96768
13 Ga0065707_10900120 3300005295 Bacteria 567
14 Ga0070676_10561310 3300005328 Bacteria 818
15 Ga0070670_100638443 3300005331 Bacteria 955
16 Ga0068869_100843298 3300005334 Bacteria 790
17 Ga0068869_101394285 3300005334 Bacteria 620
18 Ga0068868_100050943 3300005338 Bacteria 3254
19 Ga0068868_100198372 3300005338 Bacteria 1672
20 Ga0068868_101541612 3300005338 Bacteria 623
21 Ga0070689_100218136 3300005340 Bacteria 1564
22 Ga0070687_100059572 3300005343 Bacteria 2011
23 Ga0070669_100208837 3300005353 Bacteria 1539
24 Ga0070675_100174358 3300005354 Bacteria 1856
25 Ga0070671_100013732 3300005355 Bacteria 6533
26 Ga0070671_100031634 3300005355 Bacteria 4372
27 Ga0070674_100124067 3300005356 Bacteria 1916
28 Ga0070674_100362240 3300005356 Bacteria 1174
29 Ga0070659_100093268 3300005366 Bacteria 2416
30 Ga0070667_100071445 3300005367 Bacteria 2956
31 Ga0070667_100306892 3300005367 Bacteria 1430
32 Ga0070667_101003480 3300005367 Bacteria 779
33 Ga0070667_101068549 3300005367 Bacteria 754
34 Ga0070667_102212909 3300005367 Bacteria 518
35 Ga0070700_100021124 3300005441 Bacteria 3781
36 Ga0070700_100844802 3300005441 Bacteria 741
37 Ga0070663_100535200 3300005455 Bacteria 977
38 Ga0070678_100275132 3300005456 Bacteria 1421
39 Ga0068867_100002610 3300005459 Bacteria 12706
40 Ga0068867_100071873 3300005459 Bacteria 2589
41 Ga0068867_100107165 3300005459 Bacteria 2142
42 Ga0070706_100000789 3300005467 Bacteria 35385
43 Ga0070707_100115017 3300005468 Bacteria 2611
44 Ga0070707_100451554 3300005468 Bacteria 1246
45 Ga0070698_100105217 3300005471 Bacteria 2792
46 Ga0070699_100171430 3300005518 Bacteria 1923
47 Ga0070672_100007169 3300005543 Bacteria 7545
48 Ga0070672_100099033 3300005543 Bacteria 2362
49 Ga0070686_100569710 3300005544 Bacteria 888
50 Ga0070665_100038803 3300005548 Bacteria 4788
51 Ga0070665_100060190 3300005548 Bacteria 3807
52 Ga0068856_100256370 3300005614 Bacteria 1764
53 Ga0070702_100421807 3300005615 Bacteria 960
54 Ga0070702_100524953 3300005615 Bacteria 874
55 Ga0068852_100259637 3300005616 Bacteria 1668
56 Ga0068859_100028152 3300005617 Bacteria 5634
57 Ga0068859_100734794 3300005617 Bacteria 1076
58 Ga0068864_100054499 3300005618 Bacteria 3451
59 Ga0068864_100166616 3300005618 Bacteria 2006
60 Ga0068866_10361705 3300005718 Bacteria 925
61 Ga0068861_100002798 3300005719 Bacteria 11463
62 Ga0068861_100695505 3300005719 Bacteria 944
63 Ga0068861_101404936 3300005719 Bacteria 682
64 Ga0068870_10317172 3300005840 Bacteria 989
65 Ga0068863_100074081 3300005841 Bacteria 3221
66 Ga0068863_100156062 3300005841 Bacteria 2185
67 Ga0068863_100951598 3300005841 Unclassified 860
68 Ga0068863_101184812 3300005841 Bacteria 770
69 Ga0068858_100027233 3300005842 Bacteria 5311
70 Ga0068858_100596459 3300005842 Bacteria 1071
71 Ga0068860_100001383 3300005843 Bacteria 26323
72 Ga0068860_100014759 3300005843 Bacteria 7640
73 Ga0068860_100056671 3300005843 Bacteria 3724
74 Ga0068862_100003437 3300005844 Bacteria 13623
75 Ga0068862_100043169 3300005844 Bacteria 3844
76 Ga0068862_100209370 3300005844 Bacteria 1761
77 Ga0075365_10083799 3300006038 Bacteria 2163
78 Ga0075368_10024741 3300006042 Bacteria 2301
79 Ga0075368_10087155 3300006042 Bacteria 1275
80 Ga0075363_100297930 3300006048 Bacteria 935
81 Ga0075363_100783904 3300006048 Bacteria 579
82 Ga0075364_10157623 3300006051 Bacteria 1531
83 Ga0075362_10022343 3300006177 Bacteria 2664
84 Ga0075362_10086422 3300006177 Bacteria 1451
85 Ga0075362_10444739 3300006177 Bacteria 658
86 Ga0075367_10098841 3300006178 Bacteria 1782
87 Ga0075367_10432713 3300006178 Bacteria 833
88 Ga0075369_10069088 3300006186 Bacteria 1553
89 Ga0075369_10262827 3300006186 Bacteria 802
90 Ga0075366_10005152 3300006195 Bacteria 7071
91 Ga0075366_10017365 3300006195 Bacteria 4142
92 Ga0075366_10033642 3300006195 Bacteria 3020
93 Ga0075366_10052758 3300006195 Bacteria 2416
94 Ga0075366_10059146 3300006195 Bacteria 2276
95 Ga0075366_10138162 3300006195 Bacteria 1472
96 Ga0075366_10159819 3300006195 Bacteria 1365
97 Ga0075366_10161528 3300006195 Bacteria 1358
98 Ga0075366_10170427 3300006195 Bacteria 1321
99 Ga0075366_10288793 3300006195 Bacteria 1003
100 Ga0075366_10424046 3300006195 Bacteria 820
101 Ga0075366_10530801 3300006195 Bacteria 728
102 Ga0097621_100173266 3300006237 Bacteria 1861
103 Ga0097621_100470912 3300006237 Bacteria 1134
104 Ga0075370_10002077 3300006353 Bacteria 9121
105 Ga0075370_10004911 3300006353 Bacteria 6568
106 Ga0075370_10025900 3300006353 Bacteria 3246
107 Ga0075370_10040147 3300006353 Bacteria 2639
108 Ga0075370_10041452 3300006353 Bacteria 2599
109 Ga0075370_10091360 3300006353 Bacteria 1756
110 Ga0075370_10742394 3300006353 Bacteria 597
111 Ga0075430_100020831 3300006846 Bacteria 5573
112 Ga0075429_100000422 3300006880 Bacteria 31585
113 Ga0075429_100465327 3300006880 Bacteria 1108
114 Ga0068865_100115792 3300006881 Bacteria 1985
115 Ga0097620_100028153 3300006931 Bacteria 5634
116 Ga0097620_100734774 3300006931 Bacteria 1076
117 Ga0105245_10008948 3300009098 Bacteria 8732
118 Ga0105245_10047974 3300009098 Bacteria 3819
119 Ga0105245_10729554 3300009098 Bacteria 1026
120 Ga0105243_10019900 3300009148 Bacteria 5089
121 Ga0105243_10057970 3300009148 Bacteria 3085
122 Ga0105243_10560438 3300009148 Bacteria 1093
123 Ga0105248_10075522 3300009177 Bacteria 3788
124 Ga0105249_10604465 3300009553 Bacteria 1151
125 Ga0105249_10674051 3300009553 Bacteria 1093
126 Ga0105249_10902078 3300009553 Bacteria 951
127 Ga0105249_10972938 3300009553 Bacteria 917
128 Ga0105239_11762353 3300010375 Bacteria 717
129 Ga0105246_10355378 3300011119 Bacteria 1202
130 Ga0157315_1049999 3300012508 Bacteria 559
131 Ga0157374_10037033 3300013296 Bacteria 4474
132 Ga0157374_10243980 3300013296 Bacteria 1767
133 Ga0157378_10053004 3300013297 Bacteria 3611
134 Ga0163162_10004516 3300013306 Bacteria 13402
135 Ga0157375_10034805 3300013308 Bacteria 4801
136 Ga0157375_10109336 3300013308 Bacteria 2860
137 Ga0157375_10120500 3300013308 Bacteria 2732
138 Ga0157375_10854883 3300013308 Bacteria 1056
139 Ga0157380_10017649 3300014326 Bacteria 5284
140 Ga0157380_10060700 3300014326 Bacteria 3022
141 Ga0157379_10020498 3300014968 Bacteria 5845
142 Ga0157379_10063850 3300014968 Bacteria 3292
143 Ga0157379_10148571 3300014968 Bacteria 2114
144 Ga0157379_10274037 3300014968 Bacteria 1535
145 Ga0157379_10854740 3300014968 Bacteria 861
146 Ga0157376_12261176 3300014969 Bacteria 583
147 Ga0163161_10079450 3300017792 Bacteria 2412
148 Ga0163161_10869242 3300017792 Bacteria 762
149 Ga0206351_10747366 3300020077 Bacteria 1102
150 Ga0209050_1004512 3300025298 Bacteria 9359
151 Ga0209051_1001621 3300025303 Bacteria 18339
152 Ga0209051_1002692 3300025303 Bacteria 12369
153 Ga0209257_1000053 3300025304 Bacteria 425160
154 Ga0207682_10012985 3300025893 Bacteria 3247
155 Ga0207642_10323279 3300025899 Bacteria 901
156 Ga0207643_10271567 3300025908 Bacteria 1049
157 Ga0207684_10003750 3300025910 Bacteria 14685
158 Ga0207671_10072885 3300025914 Bacteria 2564
159 Ga0207662_10073547 3300025918 Bacteria 2073
160 Ga0207662_11236169 3300025918 Bacteria 531
161 Ga0207646_10717745 3300025922 Bacteria 893
162 Ga0207650_10404640 3300025925 Bacteria 1130
163 Ga0207650_10792137 3300025925 Bacteria 803
164 Ga0207659_10067736 3300025926 Bacteria 2594
165 Ga0207687_10081249 3300025927 Bacteria 2342
166 Ga0207687_10166183 3300025927 Bacteria 1698
167 Ga0207687_10393323 3300025927 Bacteria 1138
168 Ga0207644_10016582 3300025931 Bacteria 4958
169 Ga0207644_10069917 3300025931 Bacteria 2564
170 Ga0207686_10362109 3300025934 Bacteria 1095
171 Ga0207709_10042763 3300025935 Bacteria 2727
172 Ga0207709_10073130 3300025935 Bacteria 2183
173 Ga0207709_10111752 3300025935 Bacteria 1828
174 Ga0207709_10416784 3300025935 Bacteria 1030
175 Ga0207670_10162206 3300025936 Bacteria 1669
176 Ga0207669_10081671 3300025937 Bacteria 2072
177 Ga0207704_10002656 3300025938 Bacteria 8071
178 Ga0207704_10860022 3300025938 Bacteria 760
179 Ga0207691_10018133 3300025940 Bacteria 6667
180 Ga0207691_10221806 3300025940 Bacteria 1639
181 Ga0207711_10095196 3300025941 Bacteria 2626
182 Ga0207689_10571898 3300025942 Bacteria 950
183 Ga0207689_11052410 3300025942 Bacteria 686
184 Ga0207712_10213583 3300025961 Bacteria 1538
185 Ga0207712_10743601 3300025961 Bacteria 859
186 Ga0207668_10058928 3300025972 Bacteria 2687
187 Ga0207640_10376975 3300025981 Bacteria 1148
188 Ga0207658_10010318 3300025986 Bacteria 6349
189 Ga0207658_10095762 3300025986 Bacteria 2313
190 Ga0207658_10246304 3300025986 Bacteria 1517
191 Ga0207658_10937922 3300025986 Bacteria 789
192 Ga0207658_11169164 3300025986 Bacteria 703
193 Ga0207677_10204710 3300026023 Bacteria 1571
194 Ga0207677_10466316 3300026023 Bacteria 1085
195 Ga0207677_10609505 3300026023 Bacteria 959
196 Ga0207703_10008960 3300026035 Bacteria 7883
197 Ga0207703_10462402 3300026035 Bacteria 1187
198 Ga0207639_10056990 3300026041 Bacteria 2998
199 Ga0207678_10527475 3300026067 Bacteria 1031
200 Ga0207678_10795330 3300026067 Bacteria 835
201 Ga0207708_10053750 3300026075 Bacteria 3069
202 Ga0207702_10270487 3300026078 Bacteria 1603
203 Ga0207641_10017347 3300026088 Bacteria 5894
204 Ga0207641_10938030 3300026088 Unclassified 860
205 Ga0207648_10000799 3300026089 Bacteria 35474
206 Ga0207648_10067429 3300026089 Bacteria 3119
207 Ga0207648_10094332 3300026089 Bacteria 2617
208 Ga0207648_10503496 3300026089 Bacteria 1108
209 Ga0207648_12211408 3300026089 Bacteria 511
210 Ga0207676_10015965 3300026095 Bacteria 5432
211 Ga0207676_10038658 3300026095 Bacteria 3644
212 Ga0207676_11219887 3300026095 Unclassified 746
213 Ga0207674_10292029 3300026116 Bacteria 1579
214 Ga0207675_100003220 3300026118 Bacteria 16019
215 Ga0207675_101100213 3300026118 Bacteria 814
216 Ga0207675_101668305 3300026118 Unclassified 657
217 Ga0207683_10929940 3300026121 Bacteria 807
218 Ga0207698_10412689 3300026142 Bacteria 1294
219 Ga0209813_10072026 3300027866 Bacteria 1126
220 Ga0209813_10215436 3300027866 Bacteria 717
221 Ga0268266_10082295 3300028379 Bacteria 2808
222 Ga0268265_10118348 3300028380 Bacteria 2178
223 Ga0268265_10138558 3300028380 Bacteria 2034
224 Ga0268265_10179555 3300028380 Bacteria 1817
225 Ga0268264_10002625 3300028381 Bacteria 15693
226 Ga0268264_10011276 3300028381 Bacteria 7385
227 Ga0268264_10080098 3300028381 Bacteria 2788
228 Ga0268264_11643711 3300028381 Bacteria 653
229 Ga0307517_10094857 3300028786 Bacteria 2406
230 Ga0307515_10015833 3300028794 Bacteria 13863
231 Ga0307515_10060390 3300028794 Bacteria 5407
232 Ga0307515_10148170 3300028794 Bacteria 2471
233 Ga0307515_10279419 3300028794 Bacteria 1379
234 Ga0307512_10025373 3300030522 Bacteria 5252
235 Ga0307513_10015205 3300031456 Bacteria 9341
236 Ga0307513_10089310 3300031456 Bacteria 3146
237 Ga0307513_10133169 3300031456 Unclassified 2427
238 Ga0307509_10147867 3300031507 Bacteria 2271
239 Ga0307408_100535837 3300031548 Bacteria 1031
240 Ga0307408_100582792 3300031548 Bacteria 991
241 Ga0307408_101680992 3300031548 Bacteria 604
242 Ga0307408_102207479 3300031548 Bacteria 532
243 Ga0307508_10034866 3300031616 Bacteria 4534
244 Ga0307508_10093023 3300031616 Bacteria 2605
245 Ga0307508_10238789 3300031616 Bacteria 1415
246 Ga0307514_10521340 3300031649 Bacteria 558
247 Ga0307516_10013229 3300031730 Bacteria 8810
248 Ga0307516_10216332 3300031730 Bacteria 1628
249 Ga0307516_10430254 3300031730 Bacteria 977
250 Ga0307516_10459824 3300031730 Bacteria 928
251 Ga0307405_10162738 3300031731 Bacteria 1583
252 Ga0307410_10559352 3300031852 Bacteria 949
253 Ga0307410_11114652 3300031852 Bacteria 685
254 Ga0307410_12061465 3300031852 Bacteria 510
255 Ga0307406_10440261 3300031901 Bacteria 1043
256 Ga0307412_10307399 3300031911 Bacteria 1256
257 Ga0307409_100864706 3300031995 Bacteria 916
258 Ga0307416_100283401 3300032002 Bacteria 1635
259 Ga0307414_11221227 3300032004 Bacteria 696
260 Ga0307411_10000087 3300032005 Bacteria 28540
261 Ga0307411_10099973 3300032005 Bacteria 2049
262 Ga0307415_100284439 3300032126 Bacteria 1362
263 Ga0307510_10013058 3300033180 Bacteria 9849
264 Ga0373941_0403370 3300035115 Bacteria 566
265 Ga0373925_0226977 3300037068 Bacteria 1492
266 Ga0373925_0538284 3300037068 Bacteria 960
267 Ga0395899_0019713 3300037312 Bacteria 5120
268 Ga0395900_0197969 3300037418 Bacteria 2034
269 Ga0395898_0113210 3300037466 Bacteria 2600
270 Ga0395905_0004144 3300037471 Bacteria 15172
271 Ga0395905_0014806 3300037471 Bacteria 7436
272 Ga0395905_0120696 3300037471 Bacteria 2464
273 Ga0395905_0163449 3300037471 Bacteria 2092
274 Ga0395905_0179258 3300037471 Bacteria 1989
275 Ga0395905_0645373 3300037471 Bacteria 960
276 Ga0395905_0701479 3300037471 Bacteria 914
277 Ga0395901_0093014 3300038443 Bacteria 3156
278 Ga0451793_0741937 3300041452 Bacteria 768
279 Ga0451793_1348609 3300041452 Bacteria 619
280 Ga0451795_1513579 3300041456 Unclassified 1201
281 Ga0451802_0450597 3300041460 Bacteria 526
282 Ga0451839_1513997 3300041496 Bacteria 1025
283 Ga0451851_0770704 3300041507 Bacteria 644
284 Ga0451843_1362482 3300041509 Bacteria 2226
285 Ga0451853_0507755 3300041512 Bacteria 756
286 Ga0451853_0542749 3300041512 Bacteria 964
287 Ga0439445_0126147 3300042004 Bacteria 737
288 Ga0450917_000811 3300042120 Bacteria 2307
289 Ga0450888_000125 3300042126 Bacteria 6200
290 Ga0450890_000238 3300042127 Bacteria 8252
291 Ga0450890_010914 3300042127 Bacteria 1170
292 Ga0450891_000099 3300042129 Bacteria 7345
293 Ga0450892_000278 3300042130 Bacteria 6108
294 Ga0450889_000041 3300042144 Bacteria 11391
295 Ga0450916_005069 3300042530 Bacteria 1511
296 Ga0450893_0061459 3300042532 Bacteria 717
297 Ga0451577_0071644 3300042876 Bacteria 3090
298 Ga0451577_1529030 3300042876 Unclassified 590
299 Ga0466972_0002120 3300044658 Bacteria 9740
300 Ga0453683_0672317 3300044673 Bacteria 678
301 Ga0466965_0211098 3300044683 Bacteria 1032
302 Ga0466965_0259624 3300044683 Bacteria 933
303 Ga0466961_0075678 3300044693 Bacteria 2134
304 Ga0466964_0154140 3300044706 Bacteria 1068
305 Ga0466964_0567597 3300044706 Bacteria 618
306 Ga0466960_0239381 3300044901 Bacteria 1004
307 Ga0451576_0017955 3300045051 Bacteria 7764
308 Ga0451576_0770723 3300045051 Bacteria 1010
309 Ga0451576_1019544 3300045051 Bacteria 867
310 Ga0466967_1971417 3300045976 Bacteria 581
311 Ga0495592_0000421 3300046454 Bacteria 32129
312 Ga0495590_0011093 3300046457 Bacteria 3377
313 Ga0495638_0441474 3300046460 Bacteria 666
314 Ga0495580_0035433 3300046472 Bacteria 3589
315 Ga0495610_0130837 3300046512 Bacteria 1090
316 Ga0495632_0001485 3300046519 Bacteria 19446
317 Ga0495632_0021336 3300046519 Bacteria 3491
318 Ga0495632_0306722 3300046519 Bacteria 703
319 Ga0495643_0038648 3300046522 Bacteria 2613
320 Ga0495643_0080830 3300046522 Bacteria 1691
321 Ga0495648_0129197 3300046524 Bacteria 1346
322 Ga0495642_0172582 3300046528 Bacteria 940
323 Ga0495621_0410935 3300046539 Bacteria 575
324 Ga0495668_0096765 3300046616 Bacteria 1615
325 Ga0495625_0009057 3300046660 Bacteria 8402
326 Ga0495625_0171978 3300046660 Bacteria 1446
327 Ga0495660_0088078 3300046810 Bacteria 1618
328 Ga0495686_0075764 3300047472 Bacteria 2062
329 Ga0495602_0144137 3300048088 Bacteria 1882
330 Ga0495626_0204911 3300048091 Bacteria 807
331 Ga0496109_0017783 3300048912 Bacteria 6235
332 Ga0496110_0170877 3300048913 Bacteria 1972
333 Ga0496111_0154486 3300048914 Bacteria 1703
334 Ga0496121_0007596 3300048924 Bacteria 13052
335 Ga0496124_0003153 3300048927 Bacteria 20392
336 Ga0496125_0003117 3300048928 Bacteria 20619
337 Ga0496125_0277273 3300048928 Bacteria 1041
338 Ga0501322_029126 3300049538 Bacteria 515
339 Ga0501043_0031313 3300049579 Bacteria 4182
340 Ga0501067_0835032 3300049583 Bacteria 519
341 Ga0501206_049381 3300049653 Bacteria 667
342 Ga0501235_008853 3300049669 Bacteria 2194
343 Ga0501221_000089 3300049704 Bacteria 10670
344 Ga0501225_0056170 3300049705 Bacteria 1102
345 Ga0501229_002145 3300049706 Bacteria 2315
346 Ga0501079_1104308 3300049741 Bacteria 625
347 Ga0501267_005496 3300049764 Bacteria 1200
348 Ga0501272_006808 3300049769 Bacteria 1228
349 Ga0501045_0995286 3300049824 Bacteria 615
350 nmdc:mga03683_281457_c1 3300050489 Bacteria 777
351 nmdc:mga03683_34660_c1 3300050489 Bacteria 2044
352 nmdc:mga03683_55509_c1 3300050489 Bacteria 1664
353 nmdc:mga03n38_224011_c1 3300050490 Bacteria 983
354 nmdc:mga00v17_20043_c1 3300050491 Bacteria 3826
355 nmdc:mga0yw44_222484_c1 3300050492 Bacteria 1251
356 nmdc:mga0k408_150879_c1 3300050493 Bacteria 1384
357 nmdc:mga0k408_152982_c1 3300050493 Bacteria 1374
358 nmdc:mga0k408_156855_c1 3300050493 Bacteria 1356
359 nmdc:mga0k408_192081_c1 3300050493 Bacteria 1218
360 nmdc:mga0k408_27118_c1 3300050493 Bacteria 3252
361 nmdc:mga0k408_32766_c1 3300050493 Bacteria 2969
362 nmdc:mga0k408_49369_c1 3300050493 Bacteria 2435
363 nmdc:mga0k408_596923_c1 3300050493 Bacteria 651
364 nmdc:mga0k408_597965_c1 3300050493 Bacteria 651
365 nmdc:mga0k408_6822_c1 3300050493 Bacteria 6089
366 nmdc:mga06z11_38946_c1 3300050494 Bacteria 2364
367 nmdc:mga06z11_418816_c1 3300050494 Bacteria 807
368 nmdc:mga04h51_13087_c1 3300050495 Bacteria 2343
369 nmdc:mga04h51_189297_c1 3300050495 Bacteria 804
370 nmdc:mga07m45_271549_c1 3300050496 Bacteria 986
371 nmdc:mga07m45_33751_c1 3300050496 Bacteria 2843
372 nmdc:mga07m45_4979_c1 3300050496 Bacteria 6560
373 nmdc:mga07m45_5867_c1 3300050496 Bacteria 6164
374 nmdc:mga07m45_65155_c1 3300050496 Bacteria 2069
375 nmdc:mga07m45_71381_c1 3300050496 Bacteria 1976
376 nmdc:mga07m45_902139_c1 3300050496 Bacteria 506
377 nmdc:mga09592_12002_c1 3300050508 Bacteria 7048
378 nmdc:mga09592_434587_c1 3300050508 Bacteria 1133
379 nmdc:mga0qj67_66724_c1 3300050509 Bacteria 2264
380 nmdc:mga0sz30_100777_c1 3300050516 Bacteria 1261
381 nmdc:mga0sz30_248932_c1 3300050516 Bacteria 791
382 nmdc:mga0sz30_25734_c1 3300050516 Bacteria 2408
383 Ga0495655_0242511 3300053083 Bacteria 604
384 Ga0500647_0446266 3300053091 Bacteria 513
385 Ga0500583_0313514 3300053092 Bacteria 766
386 Ga0500651_0577363 3300053093 Bacteria 612
387 Ga0500559_0453523 3300053136 Bacteria 593
388 Ga0500564_042237 3300053138 Bacteria 2097
389 Ga0500619_061051 3300053154 Bacteria 1240
390 Ga0500587_006995 3300053739 Bacteria 1479
391 Ga0466962_0329973 3300061719 Bacteria 758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025981 Ga0207640_10376975 Ga0207640_103769753 117
2 3300037471 Ga0395905_0004144 Ga0395905_0004144_4669_5076 120
3 iso_pu_bacteria 2643221625 2644139478 120
4 iso_pu_bacteria 2643221648 2644272292 120
5 3300044683 Ga0466965_0259624 Ga0466965_0259624_120_539 122
6 3300048927 Ga0496124_0003153 Ga0496124_0003153_3099_3518 122
7 3300048928 Ga0496125_0003117 Ga0496125_0003117_2884_3303 122
8 iso_pu_bacteria 2643221585 2643935563 122
9 iso_pu_bacteria 2643221639 2644221025 122
10 iso_pu_bacteria 2643221656 2644317346 122
11 3300037471 Ga0395905_0014806 Ga0395905_0014806_4553_4975 123
12 iso_pu_bacteria 2834641062 2834644196 123
13 iso_pu_bacteria 8003400568 8003401900 123
14 3300005295 Ga0065707_10900120 Ga0065707_109001202 124
15 3300005328 Ga0070676_10561310 Ga0070676_105613102 124
16 3300005331 Ga0070670_100638443 Ga0070670_1006384432 124
17 3300005338 Ga0068868_100198372 Ga0068868_1001983722 124
18 3300005353 Ga0070669_100208837 Ga0070669_1002088371 124
19 3300005355 Ga0070671_100013732 Ga0070671_1000137326 124
20 3300005367 Ga0070667_101003480 Ga0070667_1010034802 124
21 3300005441 Ga0070700_100021124 Ga0070700_1000211243 124
22 3300005441 Ga0070700_100844802 Ga0070700_1008448022 124
23 3300005455 Ga0070663_100535200 Ga0070663_1005352002 124
24 3300005459 Ga0068867_100002610 Ga0068867_1000026104 124
25 3300005459 Ga0068867_100071873 Ga0068867_1000718734 124
26 3300005543 Ga0070672_100099033 Ga0070672_1000990333 124
27 3300005544 Ga0070686_100569710 Ga0070686_1005697102 124
28 3300005615 Ga0070702_100421807 Ga0070702_1004218072 124
29 3300005617 Ga0068859_100734794 Ga0068859_1007347942 124
30 3300005618 Ga0068864_100166616 Ga0068864_1001666162 124
31 3300005719 Ga0068861_100002798 Ga0068861_10000279810 124
32 3300005841 Ga0068863_100156062 Ga0068863_1001560623 124
33 3300005843 Ga0068860_100001383 Ga0068860_10000138322 124
34 3300005844 Ga0068862_100003437 Ga0068862_1000034372 124
35 3300005844 Ga0068862_100043169 Ga0068862_1000431695 124
36 3300006048 Ga0075363_100783904 Ga0075363_1007839041 124
37 3300006177 Ga0075362_10444739 Ga0075362_104447392 124
38 3300006195 Ga0075366_10005152 Ga0075366_100051523 124
39 3300006195 Ga0075366_10017365 Ga0075366_100173654 124
40 3300006195 Ga0075366_10159819 Ga0075366_101598192 124
41 3300006195 Ga0075366_10424046 Ga0075366_104240462 124
42 3300006353 Ga0075370_10002077 Ga0075370_100020776 124
43 3300006931 Ga0097620_100734774 Ga0097620_1007347742 124
44 3300009553 Ga0105249_10604465 Ga0105249_106044652 124
45 3300009553 Ga0105249_10674051 Ga0105249_106740512 124
46 3300009553 Ga0105249_10972938 Ga0105249_109729382 124
47 3300010375 Ga0105239_11762353 Ga0105239_117623532 124
48 3300013297 Ga0157378_10053004 Ga0157378_100530041 124
49 3300013306 Ga0163162_10004516 Ga0163162_100045164 124
50 3300014326 Ga0157380_10060700 Ga0157380_100607002 124
51 3300014968 Ga0157379_10274037 Ga0157379_102740372 124
52 3300014968 Ga0157379_10854740 Ga0157379_108547402 124
53 3300014969 Ga0157376_12261176 Ga0157376_122611762 124
54 3300017792 Ga0163161_10079450 Ga0163161_100794502 124
55 3300017792 Ga0163161_10869242 Ga0163161_108692421 124
56 3300025893 Ga0207682_10012985 Ga0207682_100129852 124
57 3300025899 Ga0207642_10323279 Ga0207642_103232792 124
58 3300025925 Ga0207650_10792137 Ga0207650_107921371 124
59 3300025931 Ga0207644_10069917 Ga0207644_100699173 124
60 3300025934 Ga0207686_10362109 Ga0207686_103621092 124
61 3300025935 Ga0207709_10111752 Ga0207709_101117524 124
62 3300025935 Ga0207709_10416784 Ga0207709_104167842 124
63 3300025938 Ga0207704_10002656 Ga0207704_100026568 124
64 3300025940 Ga0207691_10221806 Ga0207691_102218062 124
65 3300025961 Ga0207712_10213583 Ga0207712_102135832 124
66 3300025961 Ga0207712_10743601 Ga0207712_107436012 124
67 3300025972 Ga0207668_10058928 Ga0207668_100589282 124
68 3300025986 Ga0207658_11169164 Ga0207658_111691642 124
69 3300026023 Ga0207677_10466316 Ga0207677_104663162 124
70 3300026067 Ga0207678_10527475 Ga0207678_105274752 124
71 3300026067 Ga0207678_10795330 Ga0207678_107953302 124
72 3300026075 Ga0207708_10053750 Ga0207708_100537503 124
73 3300026089 Ga0207648_10000799 Ga0207648_1000079914 124
74 3300026089 Ga0207648_10067429 Ga0207648_100674293 124
75 3300026095 Ga0207676_10038658 Ga0207676_100386584 124
76 3300026118 Ga0207675_100003220 Ga0207675_10000322014 124
77 3300026142 Ga0207698_10412689 Ga0207698_104126891 124
78 3300028380 Ga0268265_10138558 Ga0268265_101385583 124
79 3300028380 Ga0268265_10179555 Ga0268265_101795552 124
80 3300028381 Ga0268264_10002625 Ga0268264_100026255 124
81 3300028381 Ga0268264_11643711 Ga0268264_116437111 124
82 3300031616 Ga0307508_10238789 Ga0307508_102387892 124
83 3300031852 Ga0307410_12061465 Ga0307410_120614651 124
84 3300031901 Ga0307406_10440261 Ga0307406_104402612 124
85 3300031995 Ga0307409_100864706 Ga0307409_1008647062 124
86 3300032002 Ga0307416_100283401 Ga0307416_1002834012 124
87 3300032126 Ga0307415_100284439 Ga0307415_1002844392 124
88 3300037471 Ga0395905_0645373 Ga0395905_0645373_299_673 124
89 3300041460 Ga0451802_0450597 Ga0451802_0450597_17_430 124
90 3300041512 Ga0451853_0507755 Ga0451853_0507755_60_455 124
91 3300045976 Ga0466967_1971417 Ga0466967_1971417_132_536 124
92 3300048091 Ga0495626_0204911 Ga0495626_0204911_246_662 124
93 3300048912 Ga0496109_0017783 Ga0496109_0017783_5423_5797 124
94 3300048914 Ga0496111_0154486 Ga0496111_0154486_586_960 124
95 3300049579 Ga0501043_0031313 Ga0501043_0031313_3352_3726 124
96 3300049583 Ga0501067_0835032 Ga0501067_0835032_47_454 124
97 3300049741 Ga0501079_1104308 Ga0501079_1104308_62_442 124
98 3300049824 Ga0501045_0995286 Ga0501045_0995286_168_548 124
99 3300050493 nmdc:mga0k408_49369_c1 nmdc:mga0k408_49369_c1_1468_1863 124
100 3300050493 nmdc:mga0k408_597965_c1 nmdc:mga0k408_597965_c1_148_522 124
101 3300050493 nmdc:mga0k408_6822_c1 nmdc:mga0k408_6822_c1_5573_5953 124
102 3300050496 nmdc:mga07m45_33751_c1 nmdc:mga07m45_33751_c1_1975_2370 124
103 iso_pu_bacteria 2585428062 2587759736 124
104 3300005338 Ga0068868_101541612 Ga0068868_1015416121 125
105 3300005354 Ga0070675_100174358 Ga0070675_1001743582 125
106 3300005356 Ga0070674_100362240 Ga0070674_1003622401 125
107 3300005459 Ga0068867_100107165 Ga0068867_1001071652 125
108 3300005467 Ga0070706_100000789 Ga0070706_10000078914 125
109 3300005468 Ga0070707_100115017 Ga0070707_1001150173 125
110 3300005471 Ga0070698_100105217 Ga0070698_1001052174 125
111 3300005518 Ga0070699_100171430 Ga0070699_1001714302 125
112 3300005718 Ga0068866_10361705 Ga0068866_103617051 125
113 3300005719 Ga0068861_101404936 Ga0068861_1014049361 125
114 3300005840 Ga0068870_10317172 Ga0068870_103171721 125
115 3300006038 Ga0075365_10083799 Ga0075365_100837992 125
116 3300006042 Ga0075368_10024741 Ga0075368_100247413 125
117 3300006042 Ga0075368_10087155 Ga0075368_100871552 125
118 3300006048 Ga0075363_100297930 Ga0075363_1002979302 125
119 3300006051 Ga0075364_10157623 Ga0075364_101576232 125
120 3300006177 Ga0075362_10022343 Ga0075362_100223432 125
121 3300006177 Ga0075362_10086422 Ga0075362_100864222 125
122 3300006178 Ga0075367_10098841 Ga0075367_100988412 125
123 3300006178 Ga0075367_10432713 Ga0075367_104327132 125
124 3300006186 Ga0075369_10069088 Ga0075369_100690882 125
125 3300006186 Ga0075369_10262827 Ga0075369_102628272 125
126 3300006195 Ga0075366_10052758 Ga0075366_100527582 125
127 3300006195 Ga0075366_10059146 Ga0075366_100591462 125
128 3300006195 Ga0075366_10138162 Ga0075366_101381622 125
129 3300006195 Ga0075366_10161528 Ga0075366_101615282 125
130 3300006195 Ga0075366_10170427 Ga0075366_101704272 125
131 3300006353 Ga0075370_10004911 Ga0075370_100049113 125
132 3300006353 Ga0075370_10025900 Ga0075370_100259003 125
133 3300006353 Ga0075370_10041452 Ga0075370_100414523 125
134 3300006353 Ga0075370_10091360 Ga0075370_100913602 125
135 3300006353 Ga0075370_10742394 Ga0075370_107423941 125
136 3300006846 Ga0075430_100020831 Ga0075430_1000208314 125
137 3300006880 Ga0075429_100000422 Ga0075429_1000004225 125
138 3300006880 Ga0075429_100465327 Ga0075429_1004653271 125
139 3300009148 Ga0105243_10019900 Ga0105243_100199005 125
140 3300013296 Ga0157374_10037033 Ga0157374_100370333 125
141 3300025908 Ga0207643_10271567 Ga0207643_102715672 125
142 3300025910 Ga0207684_10003750 Ga0207684_100037507 125
143 3300025922 Ga0207646_10717745 Ga0207646_107177452 125
144 3300025926 Ga0207659_10067736 Ga0207659_100677364 125
145 3300025935 Ga0207709_10042763 Ga0207709_100427633 125
146 3300025942 Ga0207689_10571898 Ga0207689_105718982 125
147 3300026089 Ga0207648_10094332 Ga0207648_100943323 125
148 3300026116 Ga0207674_10292029 Ga0207674_102920292 125
149 3300027866 Ga0209813_10072026 Ga0209813_100720262 125
150 3300027866 Ga0209813_10215436 Ga0209813_102154361 125
151 3300031548 Ga0307408_102207479 Ga0307408_1022074791 125
152 3300037471 Ga0395905_0163449 Ga0395905_0163449_1111_1491 125
153 3300041512 Ga0451853_0542749 Ga0451853_0542749_92_508 125
154 3300046522 Ga0495643_0038648 Ga0495643_0038648_1376_1774 125
155 3300050489 nmdc:mga03683_34660_c1 nmdc:mga03683_34660_c1_320_718 125
156 3300050489 nmdc:mga03683_55509_c1 nmdc:mga03683_55509_c1_120_518 125
157 3300050490 nmdc:mga03n38_224011_c1 nmdc:mga03n38_224011_c1_513_911 125
158 3300050491 nmdc:mga00v17_20043_c1 nmdc:mga00v17_20043_c1_3206_3604 125
159 3300050492 nmdc:mga0yw44_222484_c1 nmdc:mga0yw44_222484_c1_731_1129 125
160 3300050493 nmdc:mga0k408_150879_c1 nmdc:mga0k408_150879_c1_239_637 125
161 3300050493 nmdc:mga0k408_152982_c1 nmdc:mga0k408_152982_c1_760_1173 125
162 3300050493 nmdc:mga0k408_156855_c1 nmdc:mga0k408_156855_c1_270_668 125
163 3300050493 nmdc:mga0k408_192081_c1 nmdc:mga0k408_192081_c1_200_604 125
164 3300050493 nmdc:mga0k408_27118_c1 nmdc:mga0k408_27118_c1_2361_2759 125
165 3300050493 nmdc:mga0k408_32766_c1 nmdc:mga0k408_32766_c1_333_749 125
166 3300050494 nmdc:mga06z11_38946_c1 nmdc:mga06z11_38946_c1_1638_2036 125
167 3300050494 nmdc:mga06z11_418816_c1 nmdc:mga06z11_418816_c1_237_635 125
168 3300050495 nmdc:mga04h51_13087_c1 nmdc:mga04h51_13087_c1_1645_2043 125
169 3300050496 nmdc:mga07m45_271549_c1 nmdc:mga07m45_271549_c1_574_972 125
170 3300050496 nmdc:mga07m45_4979_c1 nmdc:mga07m45_4979_c1_3999_4397 125
171 3300050496 nmdc:mga07m45_5867_c1 nmdc:mga07m45_5867_c1_5102_5506 125
172 3300050496 nmdc:mga07m45_65155_c1 nmdc:mga07m45_65155_c1_1327_1725 125
173 3300050496 nmdc:mga07m45_71381_c1 nmdc:mga07m45_71381_c1_675_1091 125
174 3300050508 nmdc:mga09592_12002_c1 nmdc:mga09592_12002_c1_2336_2731 125
175 3300050508 nmdc:mga09592_434587_c1 nmdc:mga09592_434587_c1_47_424 125
176 3300050509 nmdc:mga0qj67_66724_c1 nmdc:mga0qj67_66724_c1_1032_1427 125
177 3300050516 nmdc:mga0sz30_100777_c1 nmdc:mga0sz30_100777_c1_327_743 125
178 3300050516 nmdc:mga0sz30_25734_c1 nmdc:mga0sz30_25734_c1_1129_1527 125
179 iso_pu_bacteria 2643221544 2643746892 125
180 3300003316 rootH1_10048792 rootH1_100487926 126
181 3300003320 rootH2_10302748 rootH2_103027482 126
182 3300003322 rootL2_10038151 rootL2_100381514 126
183 3300003323 rootH1_10183195 rootH1_101831952 126
184 3300005334 Ga0068869_100843298 Ga0068869_1008432981 126
185 3300005719 Ga0068861_100695505 Ga0068861_1006955052 126
186 3300005844 Ga0068862_100209370 Ga0068862_1002093702 126
187 3300009148 Ga0105243_10560438 Ga0105243_105604381 126
188 3300025935 Ga0207709_10073130 Ga0207709_100731303 126
189 3300026118 Ga0207675_101100213 Ga0207675_1011002132 126
190 3300028380 Ga0268265_10118348 Ga0268265_101183484 126
191 3300028794 Ga0307515_10060390 Ga0307515_100603903 126
192 3300031548 Ga0307408_100535837 Ga0307408_1005358371 126
193 3300042004 Ga0439445_0126147 Ga0439445_0126147_77_484 126
194 3300042120 Ga0450917_000811 Ga0450917_000811_1431_1838 126
195 3300042126 Ga0450888_000125 Ga0450888_000125_3856_4263 126
196 3300042127 Ga0450890_000238 Ga0450890_000238_5094_5501 126
197 3300042129 Ga0450891_000099 Ga0450891_000099_2336_2743 126
198 3300042130 Ga0450892_000278 Ga0450892_000278_609_1016 126
199 3300042144 Ga0450889_000041 Ga0450889_000041_1125_1532 126
200 3300042530 Ga0450916_005069 Ga0450916_005069_562_969 126
201 3300042532 Ga0450893_0061459 Ga0450893_0061459_260_667 126
202 3300044706 Ga0466964_0567597 Ga0466964_0567597_127_534 126
203 3300045051 Ga0451576_0017955 Ga0451576_0017955_5333_5740 126
204 3300048913 Ga0496110_0170877 Ga0496110_0170877_93_497 126
205 3300053093 Ga0500651_0577363 Ga0500651_0577363_46_426 126
206 3300005334 Ga0068869_101394285 Ga0068869_1013942851 127
207 3300005338 Ga0068868_100050943 Ga0068868_1000509435 127
208 3300005340 Ga0070689_100218136 Ga0070689_1002181362 127
209 3300005343 Ga0070687_100059572 Ga0070687_1000595723 127
210 3300005355 Ga0070671_100031634 Ga0070671_1000316345 127
211 3300005366 Ga0070659_100093268 Ga0070659_1000932682 127
212 3300005367 Ga0070667_100306892 Ga0070667_1003068922 127
213 3300005367 Ga0070667_101068549 Ga0070667_1010685492 127
214 3300005543 Ga0070672_100007169 Ga0070672_1000071696 127
215 3300005548 Ga0070665_100038803 Ga0070665_1000388033 127
216 3300005615 Ga0070702_100524953 Ga0070702_1005249532 127
217 3300005616 Ga0068852_100259637 Ga0068852_1002596373 127
218 3300005617 Ga0068859_100028152 Ga0068859_1000281523 127
219 3300005618 Ga0068864_100054499 Ga0068864_1000544992 127
220 3300005841 Ga0068863_100074081 Ga0068863_1000740815 127
221 3300005841 Ga0068863_100951598 Ga0068863_1009515981 127
222 3300005841 Ga0068863_101184812 Ga0068863_1011848122 127
223 3300005842 Ga0068858_100027233 Ga0068858_1000272336 127
224 3300005842 Ga0068858_100596459 Ga0068858_1005964592 127
225 3300005843 Ga0068860_100014759 Ga0068860_1000147596 127
226 3300005843 Ga0068860_100056671 Ga0068860_1000566715 127
227 3300006931 Ga0097620_100028153 Ga0097620_1000281533 127
228 3300009098 Ga0105245_10008948 Ga0105245_1000894811 127
229 3300009098 Ga0105245_10729554 Ga0105245_107295542 127
230 3300009177 Ga0105248_10075522 Ga0105248_100755225 127
231 3300009553 Ga0105249_10902078 Ga0105249_109020782 127
232 3300011119 Ga0105246_10355378 Ga0105246_103553782 127
233 3300013296 Ga0157374_10243980 Ga0157374_102439802 127
234 3300013308 Ga0157375_10034805 Ga0157375_100348054 127
235 3300013308 Ga0157375_10854883 Ga0157375_108548832 127
236 3300014326 Ga0157380_10017649 Ga0157380_100176495 127
237 3300014968 Ga0157379_10020498 Ga0157379_100204985 127
238 3300014968 Ga0157379_10063850 Ga0157379_100638503 127
239 3300025918 Ga0207662_10073547 Ga0207662_100735473 127
240 3300025925 Ga0207650_10404640 Ga0207650_104046402 127
241 3300025927 Ga0207687_10166183 Ga0207687_101661832 127
242 3300025927 Ga0207687_10393323 Ga0207687_103933232 127
243 3300025931 Ga0207644_10016582 Ga0207644_100165825 127
244 3300025936 Ga0207670_10162206 Ga0207670_101622062 127
245 3300025940 Ga0207691_10018133 Ga0207691_100181335 127
246 3300025941 Ga0207711_10095196 Ga0207711_100951962 127
247 3300025942 Ga0207689_11052410 Ga0207689_110524102 127
248 3300025986 Ga0207658_10095762 Ga0207658_100957622 127
249 3300025986 Ga0207658_10937922 Ga0207658_109379222 127
250 3300026023 Ga0207677_10204710 Ga0207677_102047103 127
251 3300026035 Ga0207703_10008960 Ga0207703_100089605 127
252 3300026035 Ga0207703_10462402 Ga0207703_104624021 127
253 3300026041 Ga0207639_10056990 Ga0207639_100569902 127
254 3300026088 Ga0207641_10017347 Ga0207641_100173473 127
255 3300026088 Ga0207641_10938030 Ga0207641_109380302 127
256 3300026089 Ga0207648_12211408 Ga0207648_122114081 127
257 3300026095 Ga0207676_10015965 Ga0207676_100159652 127
258 3300026095 Ga0207676_11219887 Ga0207676_112198872 127
259 3300026118 Ga0207675_101668305 Ga0207675_1016683052 127
260 3300028381 Ga0268264_10011276 Ga0268264_100112768 127
261 3300028381 Ga0268264_10080098 Ga0268264_100800982 127
262 3300028794 Ga0307515_10015833 Ga0307515_100158332 127
263 3300030522 Ga0307512_10025373 Ga0307512_100253735 127
264 3300031730 Ga0307516_10216332 Ga0307516_102163322 127
265 3300033180 Ga0307510_10013058 Ga0307510_100130583 127
266 3300037471 Ga0395905_0179258 Ga0395905_0179258_306_761 127
267 3300042127 Ga0450890_010914 Ga0450890_010914_364_759 127
268 3300042876 Ga0451577_1529030 Ga0451577_1529030_98_502 127
269 3300045051 Ga0451576_1019544 Ga0451576_1019544_62_463 127
270 3300046519 Ga0495632_0306722 Ga0495632_0306722_117_503 127
271 3300046524 Ga0495648_0129197 Ga0495648_0129197_488_889 127
272 3300046616 Ga0495668_0096765 Ga0495668_0096765_161_547 127
273 3300049538 Ga0501322_029126 Ga0501322_029126_15_449 127
274 3300049653 Ga0501206_049381 Ga0501206_049381_177_611 127
275 3300049669 Ga0501235_008853 Ga0501235_008853_570_1004 127
276 3300049704 Ga0501221_000089 Ga0501221_000089_2238_2672 127
277 3300049705 Ga0501225_0056170 Ga0501225_0056170_637_1071 127
278 3300049706 Ga0501229_002145 Ga0501229_002145_691_1125 127
279 3300049764 Ga0501267_005496 Ga0501267_005496_10_444 127
280 3300049769 Ga0501272_006808 Ga0501272_006808_39_473 127
281 3300003316 rootH1_10103668 rootH1_101036682 128
282 3300003794 Ga0055531_10000134 Ga0055531_1000013411 128
283 3300005356 Ga0070674_100124067 Ga0070674_1001240674 128
284 3300005367 Ga0070667_100071445 Ga0070667_1000714453 128
285 3300005367 Ga0070667_102212909 Ga0070667_1022129091 128
286 3300005456 Ga0070678_100275132 Ga0070678_1002751322 128
287 3300005548 Ga0070665_100060190 Ga0070665_1000601904 128
288 3300005614 Ga0068856_100256370 Ga0068856_1002563702 128
289 3300006195 Ga0075366_10033642 Ga0075366_100336423 128
290 3300006195 Ga0075366_10530801 Ga0075366_105308012 128
291 3300006237 Ga0097621_100173266 Ga0097621_1001732663 128
292 3300006237 Ga0097621_100470912 Ga0097621_1004709122 128
293 3300006353 Ga0075370_10040147 Ga0075370_100401471 128
294 3300006881 Ga0068865_100115792 Ga0068865_1001157922 128
295 3300013308 Ga0157375_10109336 Ga0157375_101093364 128
296 3300014968 Ga0157379_10148571 Ga0157379_101485713 128
297 3300025298 Ga0209050_1004512 Ga0209050_100451211 128
298 3300025303 Ga0209051_1002692 Ga0209051_10026924 128
299 3300025304 Ga0209257_1000053 Ga0209257_1000053460 128
300 3300025914 Ga0207671_10072885 Ga0207671_100728853 128
301 3300025937 Ga0207669_10081671 Ga0207669_100816712 128
302 3300025938 Ga0207704_10860022 Ga0207704_108600222 128
303 3300025986 Ga0207658_10010318 Ga0207658_100103183 128
304 3300025986 Ga0207658_10246304 Ga0207658_102463041 128
305 3300026023 Ga0207677_10609505 Ga0207677_106095051 128
306 3300026078 Ga0207702_10270487 Ga0207702_102704872 128
307 3300026121 Ga0207683_10929940 Ga0207683_109299401 128
308 3300028379 Ga0268266_10082295 Ga0268266_100822954 128
309 3300028786 Ga0307517_10094857 Ga0307517_100948573 128
310 3300028794 Ga0307515_10148170 Ga0307515_101481704 128
311 3300031456 Ga0307513_10015205 Ga0307513_100152056 128
312 3300031507 Ga0307509_10147867 Ga0307509_101478672 128
313 3300031616 Ga0307508_10034866 Ga0307508_100348664 128
314 3300031616 Ga0307508_10093023 Ga0307508_100930233 128
315 3300031649 Ga0307514_10521340 Ga0307514_105213401 128
316 3300031730 Ga0307516_10013229 Ga0307516_100132292 128
317 3300031730 Ga0307516_10459824 Ga0307516_104598242 128
318 3300031852 Ga0307410_10559352 Ga0307410_105593521 128
319 3300031911 Ga0307412_10307399 Ga0307412_103073991 128
320 3300032005 Ga0307411_10099973 Ga0307411_100999731 128
321 3300035115 Ga0373941_0403370 Ga0373941_0403370_94_495 128
322 3300037068 Ga0373925_0226977 Ga0373925_0226977_154_555 128
323 3300037068 Ga0373925_0538284 Ga0373925_0538284_252_650 128
324 3300041456 Ga0451795_1513579 Ga0451795_1513579_744_1169 128
325 3300041496 Ga0451839_1513997 Ga0451839_1513997_408_833 128
326 3300041507 Ga0451851_0770704 Ga0451851_0770704_200_625 128
327 3300041509 Ga0451843_1362482 Ga0451843_1362482_1050_1475 128
328 3300044673 Ga0453683_0672317 Ga0453683_0672317_137_559 128
329 3300046454 Ga0495592_0000421 Ga0495592_0000421_26031_26432 128
330 3300046457 Ga0495590_0011093 Ga0495590_0011093_2775_3233 128
331 3300046460 Ga0495638_0441474 Ga0495638_0441474_70_474 128
332 3300046472 Ga0495580_0035433 Ga0495580_0035433_1493_1891 128
333 3300046512 Ga0495610_0130837 Ga0495610_0130837_519_944 128
334 3300046519 Ga0495632_0001485 Ga0495632_0001485_12083_12475 128
335 3300046519 Ga0495632_0021336 Ga0495632_0021336_31_456 128
336 3300046522 Ga0495643_0080830 Ga0495643_0080830_1156_1581 128
337 3300046660 Ga0495625_0009057 Ga0495625_0009057_3911_4336 128
338 3300046660 Ga0495625_0171978 Ga0495625_0171978_258_662 128
339 3300046810 Ga0495660_0088078 Ga0495660_0088078_1142_1600 128
340 3300047472 Ga0495686_0075764 Ga0495686_0075764_1389_1814 128
341 3300048088 Ga0495602_0144137 Ga0495602_0144137_357_758 128
342 3300050493 nmdc:mga0k408_596923_c1 nmdc:mga0k408_596923_c1_159_551 128
343 3300050495 nmdc:mga04h51_189297_c1 nmdc:mga04h51_189297_c1_19_444 128
344 3300050496 nmdc:mga07m45_902139_c1 nmdc:mga07m45_902139_c1_26_451 128
345 3300053083 Ga0495655_0242511 Ga0495655_0242511_64_489 128
346 3300053091 Ga0500647_0446266 Ga0500647_0446266_26_427 128
347 3300053092 Ga0500583_0313514 Ga0500583_0313514_348_752 128
348 3300053136 Ga0500559_0453523 Ga0500559_0453523_78_479 128
349 3300053138 Ga0500564_042237 Ga0500564_042237_1406_1807 128
350 3300053154 Ga0500619_061051 Ga0500619_061051_136_537 128
351 3300053739 Ga0500587_006995 Ga0500587_006995_140_565 128
352 3300003316 rootH1_10016154 rootH1_100161544 129
353 3300003322 rootL2_10029916 rootL2_100299164 129
354 3300003323 rootH1_10022985 rootH1_1002298516 129
355 3300004625 Ga0055543_1003274 Ga0055543_10032744 129
356 3300005262 Ga0065165_1000233 Ga0065165_100023336 129
357 3300005468 Ga0070707_100451554 Ga0070707_1004515542 129
358 3300006195 Ga0075366_10288793 Ga0075366_102887932 129
359 3300009098 Ga0105245_10047974 Ga0105245_100479744 129
360 3300009148 Ga0105243_10057970 Ga0105243_100579705 129
361 3300012508 Ga0157315_1049999 Ga0157315_10499991 129
362 3300013308 Ga0157375_10120500 Ga0157375_101205002 129
363 3300020077 Ga0206351_10747366 Ga0206351_107473661 129
364 3300025303 Ga0209051_1001621 Ga0209051_100162112 129
365 3300025918 Ga0207662_11236169 Ga0207662_112361691 129
366 3300025927 Ga0207687_10081249 Ga0207687_100812493 129
367 3300026089 Ga0207648_10503496 Ga0207648_105034962 129
368 3300028794 Ga0307515_10279419 Ga0307515_102794192 129
369 3300031456 Ga0307513_10089310 Ga0307513_100893103 129
370 3300031456 Ga0307513_10133169 Ga0307513_101331692 129
371 3300031548 Ga0307408_100582792 Ga0307408_1005827922 129
372 3300031548 Ga0307408_101680992 Ga0307408_1016809922 129
373 3300031730 Ga0307516_10430254 Ga0307516_104302542 129
374 3300031731 Ga0307405_10162738 Ga0307405_101627383 129
375 3300031852 Ga0307410_11114652 Ga0307410_111146521 129
376 3300032004 Ga0307414_11221227 Ga0307414_112212272 129
377 3300032005 Ga0307411_10000087 Ga0307411_1000008713 129
378 3300037312 Ga0395899_0019713 Ga0395899_0019713_653_1054 129
379 3300037418 Ga0395900_0197969 Ga0395900_0197969_653_1054 129
380 3300037466 Ga0395898_0113210 Ga0395898_0113210_525_926 129
381 3300037471 Ga0395905_0120696 Ga0395905_0120696_956_1357 129
382 3300037471 Ga0395905_0701479 Ga0395905_0701479_222_722 129
383 3300038443 Ga0395901_0093014 Ga0395901_0093014_980_1381 129
384 3300041452 Ga0451793_0741937 Ga0451793_0741937_235_651 129
385 3300041452 Ga0451793_1348609 Ga0451793_1348609_48_458 129
386 3300042876 Ga0451577_0071644 Ga0451577_0071644_794_1249 129
387 3300044658 Ga0466972_0002120 Ga0466972_0002120_7671_8087 129
388 3300044683 Ga0466965_0211098 Ga0466965_0211098_79_495 129
389 3300044693 Ga0466961_0075678 Ga0466961_0075678_793_1209 129
390 3300044706 Ga0466964_0154140 Ga0466964_0154140_563_979 129
391 3300044901 Ga0466960_0239381 Ga0466960_0239381_240_650 129
392 3300045051 Ga0451576_0770723 Ga0451576_0770723_518_973 129
393 3300046528 Ga0495642_0172582 Ga0495642_0172582_346_765 129
394 3300046539 Ga0495621_0410935 Ga0495621_0410935_31_450 129
395 3300048924 Ga0496121_0007596 Ga0496121_0007596_4794_5195 129
396 3300048928 Ga0496125_0277273 Ga0496125_0277273_65_484 129
397 3300050489 nmdc:mga03683_281457_c1 nmdc:mga03683_281457_c1_162_581 129
398 3300050516 nmdc:mga0sz30_248932_c1 nmdc:mga0sz30_248932_c1_231_644 129
399 3300061719 Ga0466962_0329973 Ga0466962_0329973_158_574 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

51

150

0.94

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

56

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lum-assembly2.cif.gz_C alpha-crystallin domain of human hspb6 patched with its n-terminal peptide 0.8621 37 116
4m5t-assembly3.cif.gz_E disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8392 28 116
6bp9-assembly1.cif.gz_B hspb5 alpha-crystallin domain mutant r120g-acd 0.8331 30 117
2y22-assembly1.cif.gz_A human alphab-crystallin domain (residues 67-157) 0.8315 28 116
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8309 24 115
ID Description Score Start End Superfamily
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8674 21 115 2.60.40.790
af_B6TR54_18_129_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8639 26 117 2.60.40.790
af_F4HWW7_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8632 21 115 2.60.40.790
af_A0A144A1J3_25_143_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8577 23 116 2.60.40.790
af_F1QZY5_45_141_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8512 25 118 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A0D9YNV8-F1-model_v4 SHSP domain-containing protein 0.8783 22 125 GO:0009408
AF-A0A1G3KWX4-F1-model_v4 SHSP domain-containing protein 0.8583 21 127
AF-A0A421K594-F1-model_v4 Heat-shock protein 0.8474 16 129 GO:0009408
AF-D5BZM4-F1-model_v4 Heat shock protein Hsp20 0.8426 16 127
AF-A0A1F8ZT18-F1-model_v4 Heat-shock protein Hsp20 0.8421 24 127

Feature Viewer

pLDDT pTM Quality
82.97 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map