F434314

General Info

Members Datasets Scaffolds Average Seq Length
399 238 798 214

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10000634|Ga0207712_100006347
Length 244
Sequence VRYSEQKAKWVPAFAGMTAEGVERNEWAEPGMGYLLRLFFYGVLVRLVVLFVLGLNVRHRERLPAKGPAILAANHNSHLDAMAMISLLPLHLLPRVRPVAAADYFLRNRVLAWFALNVVGIVPLNRQRRHIHDDLLAPVAAALDRGEILVFFPEGSRGEPEQLAEFKTGLARIAERRPDVPVIPVFTHGLGKALPKGEWMIVPFFVDIFVGAPLRFGGDRAAYMQDYRAAMAVLAAEERHSEWL

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
131 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
146 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
151 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
152 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
163 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
227 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
230 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.77
Nodule 0
Rhizoplane 3.01
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10000634 3300025961 Bacteria 27702
2 Ga0070676_10058440 3300005328 Bacteria 2285
3 Ga0070670_100161111 3300005331 Bacteria 1944
4 Ga0070670_100384130 3300005331 Bacteria 1237
5 Ga0070677_10029876 3300005333 Bacteria 2070
6 Ga0068869_100503475 3300005334 Bacteria 1011
7 Ga0070666_10087855 3300005335 Bacteria 2131
8 Ga0070666_10395831 3300005335 Bacteria 992
9 Ga0070666_10511939 3300005335 Bacteria 871
10 Ga0070666_10565625 3300005335 Bacteria 828
11 Ga0068868_100095770 3300005338 Bacteria 2396
12 Ga0068868_100486662 3300005338 Bacteria 1079
13 Ga0070689_100016354 3300005340 Bacteria 5428
14 Ga0070689_100097604 3300005340 Bacteria 2323
15 Ga0070661_100312920 3300005344 Bacteria 1225
16 Ga0070661_100636696 3300005344 Bacteria 865
17 Ga0070668_100156796 3300005347 Bacteria 1845
18 Ga0070668_100297036 3300005347 Bacteria 1354
19 Ga0070669_100149597 3300005353 Bacteria 1806
20 Ga0070669_100178533 3300005353 Bacteria 1660
21 Ga0070675_100462089 3300005354 Bacteria 1139
22 Ga0070671_100047408 3300005355 Bacteria 3573
23 Ga0070671_100626341 3300005355 Bacteria 931
24 Ga0070674_100033317 3300005356 Bacteria 3428
25 Ga0070673_100101514 3300005364 Bacteria 2370
26 Ga0070688_100133540 3300005365 Bacteria 1677
27 Ga0070667_100001917 3300005367 Bacteria 18458
28 Ga0070667_100010548 3300005367 Bacteria 7625
29 Ga0070667_100059100 3300005367 Bacteria 3243
30 Ga0070667_100123926 3300005367 Bacteria 2251
31 Ga0070667_100132718 3300005367 Bacteria 2175
32 Ga0070667_100157786 3300005367 Bacteria 1996
33 Ga0070709_10000093 3300005434 Bacteria 63072
34 Ga0070709_10477178 3300005434 Bacteria 944
35 Ga0070711_100312148 3300005439 Bacteria 1253
36 Ga0070694_100008142 3300005444 Bacteria 6405
37 Ga0070663_100000500 3300005455 Bacteria 20724
38 Ga0070663_100187544 3300005455 Bacteria 1608
39 Ga0070678_100092233 3300005456 Bacteria 2326
40 Ga0070678_100260645 3300005456 Bacteria 1458
41 Ga0070678_100283045 3300005456 Bacteria 1403
42 Ga0070681_10071746 3300005458 Bacteria 3428
43 Ga0068867_100024699 3300005459 Bacteria 4307
44 Ga0070684_101069887 3300005535 Bacteria 758
45 Ga0068853_100011793 3300005539 Bacteria 7105
46 Ga0068853_100056289 3300005539 Bacteria 3390
47 Ga0068853_100455563 3300005539 Bacteria 1203
48 Ga0070672_100060961 3300005543 Bacteria 2972
49 Ga0070695_100001802 3300005545 Bacteria 12084
50 Ga0070693_100079587 3300005547 Bacteria 1950
51 Ga0070665_100000057 3300005548 Bacteria 237271
52 Ga0070665_100100429 3300005548 Bacteria 2897
53 Ga0070665_100176649 3300005548 Bacteria 2136
54 Ga0070704_100096857 3300005549 Bacteria 2213
55 Ga0068855_100009974 3300005563 Bacteria 11447
56 Ga0068855_100267181 3300005563 Bacteria 1903
57 Ga0068855_100853559 3300005563 Bacteria 965
58 Ga0068857_100412184 3300005577 Bacteria 1258
59 Ga0068857_100579802 3300005577 Bacteria 1059
60 Ga0068854_100026068 3300005578 Bacteria 4014
61 Ga0068856_100362207 3300005614 Bacteria 1468
62 Ga0070702_100022675 3300005615 Bacteria 3324
63 Ga0068859_100008850 3300005617 Bacteria 10163
64 Ga0068864_100004586 3300005618 Bacteria 11336
65 Ga0068864_101036691 3300005618 Bacteria 815
66 Ga0068866_10075206 3300005718 Bacteria 1798
67 Ga0068851_10025360 3300005834 Bacteria 2908
68 Ga0068870_10034111 3300005840 Bacteria 2603
69 Ga0068870_10081428 3300005840 Bacteria 1791
70 Ga0068863_100011112 3300005841 Bacteria 8730
71 Ga0068863_100081115 3300005841 Bacteria 3073
72 Ga0068863_100149358 3300005841 Bacteria 2235
73 Ga0068863_100274791 3300005841 Bacteria 1631
74 Ga0068858_100134718 3300005842 Bacteria 2317
75 Ga0068858_100456235 3300005842 Bacteria 1232
76 Ga0068858_100795146 3300005842 Bacteria 923
77 Ga0068860_100464629 3300005843 Bacteria 1259
78 Ga0068862_100000354 3300005844 Bacteria 49717
79 Ga0068862_100047584 3300005844 Bacteria 3660
80 Ga0068862_100633351 3300005844 Bacteria 1030
81 Ga0081455_10055574 3300005937 Bacteria 3366
82 Ga0070717_10123432 3300006028 Bacteria 2221
83 Ga0070716_100175519 3300006173 Bacteria 1402
84 Ga0070716_100228249 3300006173 Bacteria 1255
85 Ga0097621_100024352 3300006237 Bacteria 4726
86 Ga0097621_100106273 3300006237 Bacteria 2367
87 Ga0097621_100268212 3300006237 Bacteria 1499
88 Ga0068871_100013810 3300006358 Bacteria 6004
89 Ga0068871_100035525 3300006358 Bacteria 3961
90 Ga0068871_100079141 3300006358 Bacteria 2719
91 Ga0068871_100241195 3300006358 Bacteria 1571
92 Ga0075430_100780111 3300006846 Unclassified 788
93 Ga0075431_100001719 3300006847 Bacteria 20591
94 Ga0075429_100022631 3300006880 Bacteria 5448
95 Ga0068865_100186419 3300006881 Bacteria 1601
96 Ga0097620_100008850 3300006931 Bacteria 10163
97 Ga0105250_10000314 3300009092 Bacteria 37777
98 Ga0105250_10000481 3300009092 Bacteria 28079
99 Ga0105240_10438705 3300009093 Bacteria 1464
100 Ga0111539_10547938 3300009094 Bacteria 1347
101 Ga0105247_10062277 3300009101 Bacteria 2314
102 Ga0114129_11127979 3300009147 Bacteria 980
103 Ga0105243_10017122 3300009148 Bacteria 5482
104 Ga0105248_10019325 3300009177 Bacteria 7537
105 Ga0105248_10140038 3300009177 Bacteria 2729
106 Ga0105237_10004111 3300009545 Bacteria 16972
107 Ga0105237_10392035 3300009545 Bacteria 1393
108 Ga0105238_10375606 3300009551 Bacteria 1412
109 Ga0105249_10000498 3300009553 Bacteria 36320
110 Ga0105249_10301074 3300009553 Bacteria 1608
111 Ga0105239_10138739 3300010375 Bacteria 2708
112 Ga0105239_10572013 3300010375 Bacteria 1288
113 Ga0105239_11025986 3300010375 Bacteria 949
114 Ga0105246_10099035 3300011119 Bacteria 2119
115 Ga0105246_10472787 3300011119 Bacteria 1058
116 Ga0157370_10094377 3300013104 Bacteria 2807
117 Ga0157374_10026716 3300013296 Bacteria 5197
118 Ga0157378_10040281 3300013297 Bacteria 4142
119 Ga0163162_10107353 3300013306 Bacteria 2887
120 Ga0163162_10167693 3300013306 Bacteria 2320
121 Ga0157372_10004562 3300013307 Bacteria 14747
122 Ga0157372_10285720 3300013307 Bacteria 1918
123 Ga0157375_10014873 3300013308 Bacteria 6954
124 Ga0163163_10219117 3300014325 Bacteria 1952
125 Ga0157380_10046350 3300014326 Bacteria 3414
126 Ga0182008_10249690 3300014497 Bacteria 915
127 Ga0157379_10215141 3300014968 Bacteria 1740
128 Ga0157379_10275927 3300014968 Bacteria 1529
129 Ga0157376_10014388 3300014969 Bacteria 5938
130 Ga0157376_10255138 3300014969 Bacteria 1640
131 Ga0163161_10005484 3300017792 Bacteria 8799
132 Ga0163161_10167985 3300017792 Bacteria 1676
133 Ga0213876_10006134 3300021384 Bacteria 6569
134 Ga0209675_1028294 3300025291 Bacteria 1364
135 Ga0209676_1009044 3300025292 Bacteria 4351
136 Ga0209758_1032075 3300025297 Bacteria 2141
137 Ga0209257_1061820 3300025304 Bacteria 1015
138 Ga0207697_10002742 3300025315 Bacteria 8981
139 Ga0207656_10024546 3300025321 Bacteria 2439
140 Ga0207656_10068542 3300025321 Bacteria 1572
141 Ga0207696_1000088 3300025711 Bacteria 190313
142 Ga0207696_1006871 3300025711 Bacteria 4527
143 Ga0207682_10006579 3300025893 Bacteria 4676
144 Ga0207642_10026665 3300025899 Bacteria 2355
145 Ga0207710_10086206 3300025900 Bacteria 1463
146 Ga0207688_10012014 3300025901 Bacteria 4713
147 Ga0207680_10188406 3300025903 Bacteria 1399
148 Ga0207680_10712752 3300025903 Bacteria 719
149 Ga0207699_10000097 3300025906 Bacteria 63020
150 Ga0207645_10091174 3300025907 Bacteria 1960
151 Ga0207645_10092807 3300025907 Bacteria 1942
152 Ga0207643_10011447 3300025908 Bacteria 4790
153 Ga0207671_10001379 3300025914 Bacteria 28266
154 Ga0207671_10241982 3300025914 Bacteria 1417
155 Ga0207649_10392766 3300025920 Bacteria 1036
156 Ga0207649_10477935 3300025920 Bacteria 945
157 Ga0207681_10147657 3300025923 Bacteria 1758
158 Ga0207650_10003571 3300025925 Bacteria 10664
159 Ga0207650_10092899 3300025925 Bacteria 2309
160 Ga0207659_10453375 3300025926 Bacteria 1080
161 Ga0207700_10053865 3300025928 Bacteria 3017
162 Ga0207700_10849644 3300025928 Bacteria 817
163 Ga0207644_10075853 3300025931 Bacteria 2471
164 Ga0207706_10092264 3300025933 Bacteria 2663
165 Ga0207670_10036336 3300025936 Bacteria 3202
166 Ga0207669_10080107 3300025937 Bacteria 2087
167 Ga0207704_10109618 3300025938 Bacteria 1863
168 Ga0207711_10001336 3300025941 Bacteria 23339
169 Ga0207711_10160302 3300025941 Bacteria 2035
170 Ga0207689_10090463 3300025942 Bacteria 2515
171 Ga0207689_10210810 3300025942 Bacteria 1605
172 Ga0207679_10150161 3300025945 Bacteria 1895
173 Ga0207667_10031171 3300025949 Bacteria 5758
174 Ga0207667_10049676 3300025949 Bacteria 4429
175 Ga0207651_10032507 3300025960 Bacteria 3352
176 Ga0207651_10389777 3300025960 Bacteria 1183
177 Ga0207651_10723382 3300025960 Bacteria 878
178 Ga0207712_10085720 3300025961 Bacteria 2306
179 Ga0207668_10059923 3300025972 Bacteria 2669
180 Ga0207668_10153791 3300025972 Bacteria 1784
181 Ga0207658_10000098 3300025986 Bacteria 96611
182 Ga0207658_10007077 3300025986 Bacteria 7642
183 Ga0207658_10104715 3300025986 Bacteria 2224
184 Ga0207658_10177671 3300025986 Bacteria 1759
185 Ga0207658_10227697 3300025986 Bacteria 1572
186 Ga0207658_10341647 3300025986 Bacteria 1301
187 Ga0207677_10496519 3300026023 Bacteria 1054
188 Ga0207703_10114873 3300026035 Bacteria 2303
189 Ga0207703_10229013 3300026035 Bacteria 1665
190 Ga0207703_10940915 3300026035 Bacteria 828
191 Ga0207639_10001111 3300026041 Bacteria 18285
192 Ga0207639_10033213 3300026041 Bacteria 3804
193 Ga0207639_10629622 3300026041 Bacteria 991
194 Ga0207678_10000281 3300026067 Bacteria 46171
195 Ga0207678_10043949 3300026067 Bacteria 3866
196 Ga0207708_10060222 3300026075 Bacteria 2898
197 Ga0207702_10125986 3300026078 Bacteria 2299
198 Ga0207641_10014907 3300026088 Bacteria 6373
199 Ga0207641_10029311 3300026088 Bacteria 4549
200 Ga0207648_10003243 3300026089 Bacteria 17119
201 Ga0207676_10989593 3300026095 Bacteria 828
202 Ga0207674_10028014 3300026116 Bacteria 5953
203 Ga0207674_10108718 3300026116 Bacteria 2749
204 Ga0207674_10515429 3300026116 Bacteria 1155
205 Ga0207674_10602347 3300026116 Bacteria 1061
206 Ga0207675_100018900 3300026118 Bacteria 6432
207 Ga0207683_10030084 3300026121 Bacteria 4704
208 Ga0207683_10451053 3300026121 Bacteria 1186
209 Ga0207683_10594192 3300026121 Bacteria 1024
210 Ga0268266_10000001 3300028379 Bacteria 4040580
211 Ga0268266_10018664 3300028379 Bacteria 5910
212 Ga0268266_10041904 3300028379 Bacteria 3909
213 Ga0268266_10229609 3300028379 Bacteria 1709
214 Ga0268266_10485761 3300028379 Bacteria 1178
215 Ga0268265_10000775 3300028380 Bacteria 30819
216 Ga0268265_10040173 3300028380 Bacteria 3453
217 Ga0268265_10057969 3300028380 Bacteria 2954
218 Ga0268265_10131782 3300028380 Bacteria 2079
219 Ga0268264_10025215 3300028381 Bacteria 4857
220 Ga0307511_10105078 3300030521 Bacteria 1829
221 Ga0307512_10068133 3300030522 Bacteria 2672
222 Ga0265329_10148104 3300031242 Unclassified 760
223 Ga0265327_10000388 3300031251 Bacteria 82847
224 Ga0265316_10000487 3300031344 Bacteria 45011
225 Ga0307513_10310057 3300031456 Bacteria 1341
226 Ga0307509_10092245 3300031507 Bacteria 3097
227 Ga0307508_10038551 3300031616 Bacteria 4295
228 Ga0316575_10037514 3300031665 Bacteria 1909
229 Ga0316575_10064571 3300031665 Bacteria 1466
230 Ga0316579_10028392 3300031691 Bacteria 2547
231 Ga0316576_10007292 3300031727 Bacteria 6948
232 Ga0316576_10360285 3300031727 Bacteria 1081
233 Ga0316578_10000520 3300031728 Bacteria 13105
234 Ga0316577_10000145 3300031733 Bacteria 21623
235 Ga0307413_10069375 3300031824 Bacteria 2212
236 Ga0307406_10788729 3300031901 Bacteria 801
237 Ga0316583_10035161 3300032133 Bacteria 1778
238 Ga0316585_10001236 3300032137 Bacteria 6685
239 Ga0316580_10026206 3300032139 Bacteria 1802
240 Ga0316574_0009166 3300035398 Bacteria 5531
241 Ga0316574_0041828 3300035398 Bacteria 2826
242 Ga0316574_0401205 3300035398 Bacteria 863
243 Ga0316582_0003462 3300036647 Bacteria 7745
244 Ga0316582_0010954 3300036647 Unclassified 4994
245 Ga0316582_0143532 3300036647 Bacteria 1611
246 Ga0316584_0066979 3300036712 Unclassified 2691
247 Ga0400490_13527 3300038726 Bacteria 25482
248 Ga0400488_21977 3300038741 Bacteria 8572
249 Ga0400489_64343 3300039093 Unclassified 3333
250 Ga0436365_0220588 3300039437 Bacteria 103839
251 Ga0451787_213551 3300041441 Bacteria 716
252 Ga0451791_0530729 3300041451 Bacteria 813
253 Ga0451791_1241968 3300041451 Unclassified 822
254 Ga0451797_0038299 3300041453 Bacteria 764
255 Ga0451798_0115836 3300041458 Unclassified 1333
256 Ga0451802_0464216 3300041460 Bacteria 6240
257 Ga0451804_0616028 3300041463 Bacteria 1482
258 Ga0451833_0955805 3300041491 Bacteria 2235
259 Ga0451837_1268864 3300041494 Bacteria 1291
260 Ga0451847_0262956 3300041503 Bacteria 1078
261 Ga0451855_0153956 3300041511 Bacteria 952
262 Ga0451853_3452631 3300041512 Bacteria 2703
263 Ga0451853_4051180 3300041512 Bacteria 3227
264 Ga0451577_0160659 3300042876 Bacteria 2023
265 Ga0451577_0234667 3300042876 Bacteria 1659
266 Ga0453684_0004279 3300044712 Bacteria 30464
267 Ga0453684_0395403 3300044712 Bacteria 1549
268 Ga0451576_0000030 3300045051 Bacteria 403352
269 Ga0451576_0249037 3300045051 Bacteria 1857
270 Ga0495638_0135774 3300046460 Bacteria 1441
271 Ga0495598_0152202 3300046537 Bacteria 808
272 Ga0495621_0092634 3300046539 Bacteria 1141
273 Ga0495597_0000342 3300046542 Bacteria 41718
274 Ga0495625_0346709 3300046660 Bacteria 940
275 Ga0495588_0008261 3300046674 Bacteria 4768
276 Ga0495679_064930 3300047446 Bacteria 1063
277 Ga0495686_0001504 3300047472 Bacteria 25161
278 Ga0496102_0387638 3300048905 Unclassified 1315
279 Ga0496109_0142947 3300048912 Bacteria 2238
280 Ga0496110_0306811 3300048913 Bacteria 1446
281 Ga0496113_0097115 3300048916 Bacteria 2279
282 Ga0496115_0226258 3300048918 Bacteria 1543
283 Ga0496117_0007264 3300048920 Bacteria 10887
284 Ga0496118_0000166 3300048921 Bacteria 119204
285 Ga0496118_0009603 3300048921 Bacteria 9740
286 Ga0496118_0026629 3300048921 Bacteria 4919
287 Ga0496118_0045215 3300048921 Bacteria 3440
288 Ga0496121_0454694 3300048924 Bacteria 824
289 Ga0496122_0000734 3300048925 Bacteria 64135
290 Ga0496123_0002732 3300048926 Bacteria 21150
291 Ga0496125_0000009 3300048928 Bacteria 677678
292 Ga0501031_0021475 3300049568 Bacteria 4207
293 Ga0501031_0102293 3300049568 Bacteria 1869
294 Ga0501032_0069024 3300049569 Bacteria 2358
295 Ga0501032_0076139 3300049569 Bacteria 2234
296 Ga0501032_0092566 3300049569 Bacteria 2005
297 Ga0501033_0000413 3300049570 Bacteria 40930
298 Ga0501033_0070866 3300049570 Bacteria 2560
299 Ga0501033_0155915 3300049570 Bacteria 1645
300 Ga0501033_0285882 3300049570 Bacteria 1163
301 Ga0501034_0002423 3300049571 Bacteria 22561
302 Ga0501034_0050054 3300049571 Bacteria 4214
303 Ga0501034_0484784 3300049571 Bacteria 1151
304 Ga0501036_0252631 3300049572 Bacteria 1477
305 Ga0501036_0383146 3300049572 Bacteria 1173
306 Ga0501037_0039759 3300049573 Bacteria 3461
307 Ga0501037_0111018 3300049573 Bacteria 1975
308 Ga0501037_0155453 3300049573 Bacteria 1633
309 Ga0501038_0042297 3300049574 Bacteria 3968
310 Ga0501038_0083506 3300049574 Bacteria 2688
311 Ga0501038_0118102 3300049574 Bacteria 2190
312 Ga0501038_0131788 3300049574 Bacteria 2052
313 Ga0501038_0494076 3300049574 Bacteria 936
314 Ga0501038_0706482 3300049574 Bacteria 755
315 Ga0501039_0082649 3300049575 Bacteria 2500
316 Ga0501043_0009886 3300049579 Bacteria 7479
317 Ga0501043_0071476 3300049579 Bacteria 2726
318 Ga0501043_0220476 3300049579 Bacteria 1467
319 Ga0501046_0019786 3300049580 Bacteria 5576
320 Ga0501046_0039906 3300049580 Bacteria 3755
321 Ga0501046_0400243 3300049580 Bacteria 992
322 Ga0501047_0002796 3300049581 Bacteria 16571
323 Ga0501047_0028836 3300049581 Bacteria 5354
324 Ga0501047_0055776 3300049581 Bacteria 3820
325 Ga0501047_0289944 3300049581 Bacteria 1480
326 Ga0501048_0003086 3300049582 Bacteria 12699
327 Ga0501067_0118194 3300049583 Bacteria 1474
328 Ga0501068_0015702 3300049584 Bacteria 4354
329 Ga0501068_0050952 3300049584 Bacteria 2503
330 Ga0501068_0191636 3300049584 Bacteria 1295
331 Ga0501069_0072162 3300049585 Bacteria 1935
332 Ga0501070_0015538 3300049586 Bacteria 6402
333 Ga0501070_0031985 3300049586 Bacteria 4406
334 Ga0501070_0103870 3300049586 Unclassified 2350
335 Ga0501070_0142386 3300049586 Bacteria 1979
336 Ga0501070_0160497 3300049586 Bacteria 1853
337 Ga0501070_0354685 3300049586 Bacteria 1190
338 Ga0501071_0060348 3300049587 Bacteria 2745
339 Ga0501071_0151104 3300049587 Bacteria 1732
340 Ga0501072_0084334 3300049588 Bacteria 2519
341 Ga0501073_0470835 3300049589 Unclassified 869
342 Ga0501074_0004474 3300049590 Bacteria 10003
343 Ga0501074_0041890 3300049590 Bacteria 3313
344 Ga0501076_0214858 3300049592 Bacteria 1572
345 Ga0501076_0581233 3300049592 Bacteria 924
346 Ga0501076_0603393 3300049592 Bacteria 906
347 Ga0501079_0065113 3300049741 Bacteria 2811
348 Ga0501079_0076160 3300049741 Bacteria 2595
349 Ga0501080_0011938 3300049742 Bacteria 7956
350 Ga0501080_0037045 3300049742 Bacteria 4554
351 Ga0501080_0048181 3300049742 Bacteria 3967
352 Ga0501080_0226269 3300049742 Bacteria 1710
353 Ga0501080_0326435 3300049742 Bacteria 1388
354 Ga0501081_0281762 3300049743 Bacteria 1217
355 Ga0501083_0049283 3300049744 Bacteria 2839
356 Ga0501035_0006354 3300049822 Bacteria 11111
357 Ga0501035_0008363 3300049822 Bacteria 9633
358 Ga0501035_0147661 3300049822 Bacteria 2041
359 Ga0501035_0526841 3300049822 Bacteria 970
360 Ga0501044_0047326 3300049823 Bacteria 4448
361 Ga0501044_0062930 3300049823 Bacteria 3791
362 Ga0501044_0093673 3300049823 Bacteria 3028
363 Ga0501044_0109976 3300049823 Bacteria 2764
364 Ga0501044_0357006 3300049823 Bacteria 1380
365 Ga0501044_0417877 3300049823 Bacteria 1251
366 Ga0501044_0620795 3300049823 Bacteria 972
367 Ga0501044_0759410 3300049823 Bacteria 851
368 nmdc:mga09592_19239_c1 3300050508 Bacteria 5605
369 nmdc:mga06r32_7183_c1 3300050510 Bacteria 10038
370 nmdc:mga08y16_1223816_c1 3300050511 Bacteria 721
371 Ga0500610_0000098 3300053079 Bacteria 25847
372 Ga0500578_0157941 3300053086 Bacteria 1409
373 Ga0500643_055212 3300053087 Bacteria 1125
374 Ga0500644_0053609 3300053088 Bacteria 1393
375 Ga0500644_0083689 3300053088 Bacteria 1179
376 Ga0500651_0008801 3300053093 Bacteria 5966
377 Ga0500651_0020696 3300053093 Bacteria 4097
378 Ga0500651_0045398 3300053093 Bacteria 2764
379 Ga0500566_0177596 3300053094 Bacteria 1095
380 Ga0500555_021652 3300053103 Bacteria 1851
381 Ga0500594_0034119 3300053118 Bacteria 1357
382 Ga0500595_001358 3300053119 Bacteria 13165
383 Ga0500597_000155 3300053120 Bacteria 13729
384 Ga0500614_040826 3300053123 Bacteria 1179
385 Ga0500642_0001556 3300053130 Bacteria 6597
386 Ga0500655_047561 3300053133 Bacteria 851
387 Ga0500561_0060483 3300053137 Bacteria 1060
388 Ga0500568_0000145 3300053139 Bacteria 62300
389 Ga0500568_0004583 3300053139 Bacteria 7361
390 Ga0500577_0105811 3300053142 Bacteria 1155
391 Ga0500588_0004889 3300053146 Bacteria 2934
392 Ga0500604_0122252 3300053151 Bacteria 871
393 Ga0500609_004762 3300053731 Bacteria 1867
394 Ga0501084_0100401 3300054114 Bacteria 2430
395 Ga0501084_0182070 3300054114 Bacteria 1774
396 Ga0501082_0005028 3300060353 Bacteria 11537
397 Ga0501082_0022588 3300060353 Bacteria 5418
398 Ga0501082_0443574 3300060353 Bacteria 1134
399 8001525568 8001522603 Bacteria 4726425
400 Ga0207712_10000634
401 Ga0070676_10058440
402 Ga0070670_100161111
403 Ga0070670_100384130
404 Ga0070677_10029876
405 Ga0068869_100503475
406 Ga0070666_10087855
407 Ga0070666_10395831
408 Ga0070666_10511939
409 Ga0070666_10565625
410 Ga0068868_100095770
411 Ga0068868_100486662
412 Ga0070689_100016354
413 Ga0070689_100097604
414 Ga0070661_100312920
415 Ga0070661_100636696
416 Ga0070668_100156796
417 Ga0070668_100297036
418 Ga0070669_100149597
419 Ga0070669_100178533
420 Ga0070675_100462089
421 Ga0070671_100047408
422 Ga0070671_100626341
423 Ga0070674_100033317
424 Ga0070673_100101514
425 Ga0070688_100133540
426 Ga0070667_100001917
427 Ga0070667_100010548
428 Ga0070667_100059100
429 Ga0070667_100123926
430 Ga0070667_100132718
431 Ga0070667_100157786
432 Ga0070709_10000093
433 Ga0070709_10477178
434 Ga0070711_100312148
435 Ga0070694_100008142
436 Ga0070663_100000500
437 Ga0070663_100187544
438 Ga0070678_100092233
439 Ga0070678_100260645
440 Ga0070678_100283045
441 Ga0070681_10071746
442 Ga0068867_100024699
443 Ga0070684_101069887
444 Ga0068853_100011793
445 Ga0068853_100056289
446 Ga0068853_100455563
447 Ga0070672_100060961
448 Ga0070695_100001802
449 Ga0070693_100079587
450 Ga0070665_100000057
451 Ga0070665_100100429
452 Ga0070665_100176649
453 Ga0070704_100096857
454 Ga0068855_100009974
455 Ga0068855_100267181
456 Ga0068855_100853559
457 Ga0068857_100412184
458 Ga0068857_100579802
459 Ga0068854_100026068
460 Ga0068856_100362207
461 Ga0070702_100022675
462 Ga0068859_100008850
463 Ga0068864_100004586
464 Ga0068864_101036691
465 Ga0068866_10075206
466 Ga0068851_10025360
467 Ga0068870_10034111
468 Ga0068870_10081428
469 Ga0068863_100011112
470 Ga0068863_100081115
471 Ga0068863_100149358
472 Ga0068863_100274791
473 Ga0068858_100134718
474 Ga0068858_100456235
475 Ga0068858_100795146
476 Ga0068860_100464629
477 Ga0068862_100000354
478 Ga0068862_100047584
479 Ga0068862_100633351
480 Ga0081455_10055574
481 Ga0070717_10123432
482 Ga0070716_100175519
483 Ga0070716_100228249
484 Ga0097621_100024352
485 Ga0097621_100106273
486 Ga0097621_100268212
487 Ga0068871_100013810
488 Ga0068871_100035525
489 Ga0068871_100079141
490 Ga0068871_100241195
491 Ga0075430_100780111
492 Ga0075431_100001719
493 Ga0075429_100022631
494 Ga0068865_100186419
495 Ga0097620_100008850
496 Ga0105250_10000314
497 Ga0105250_10000481
498 Ga0105240_10438705
499 Ga0111539_10547938
500 Ga0105247_10062277
501 Ga0114129_11127979
502 Ga0105243_10017122
503 Ga0105248_10019325
504 Ga0105248_10140038
505 Ga0105237_10004111
506 Ga0105237_10392035
507 Ga0105238_10375606
508 Ga0105249_10000498
509 Ga0105249_10301074
510 Ga0105239_10138739
511 Ga0105239_10572013
512 Ga0105239_11025986
513 Ga0105246_10099035
514 Ga0105246_10472787
515 Ga0157370_10094377
516 Ga0157374_10026716
517 Ga0157378_10040281
518 Ga0163162_10107353
519 Ga0163162_10167693
520 Ga0157372_10004562
521 Ga0157372_10285720
522 Ga0157375_10014873
523 Ga0163163_10219117
524 Ga0157380_10046350
525 Ga0182008_10249690
526 Ga0157379_10215141
527 Ga0157379_10275927
528 Ga0157376_10014388
529 Ga0157376_10255138
530 Ga0163161_10005484
531 Ga0163161_10167985
532 Ga0213876_10006134
533 Ga0209675_1028294
534 Ga0209676_1009044
535 Ga0209758_1032075
536 Ga0209257_1061820
537 Ga0207697_10002742
538 Ga0207656_10024546
539 Ga0207656_10068542
540 Ga0207696_1000088
541 Ga0207696_1006871
542 Ga0207682_10006579
543 Ga0207642_10026665
544 Ga0207710_10086206
545 Ga0207688_10012014
546 Ga0207680_10188406
547 Ga0207680_10712752
548 Ga0207699_10000097
549 Ga0207645_10091174
550 Ga0207645_10092807
551 Ga0207643_10011447
552 Ga0207671_10001379
553 Ga0207671_10241982
554 Ga0207649_10392766
555 Ga0207649_10477935
556 Ga0207681_10147657
557 Ga0207650_10003571
558 Ga0207650_10092899
559 Ga0207659_10453375
560 Ga0207700_10053865
561 Ga0207700_10849644
562 Ga0207644_10075853
563 Ga0207706_10092264
564 Ga0207670_10036336
565 Ga0207669_10080107
566 Ga0207704_10109618
567 Ga0207711_10001336
568 Ga0207711_10160302
569 Ga0207689_10090463
570 Ga0207689_10210810
571 Ga0207679_10150161
572 Ga0207667_10031171
573 Ga0207667_10049676
574 Ga0207651_10032507
575 Ga0207651_10389777
576 Ga0207651_10723382
577 Ga0207712_10085720
578 Ga0207668_10059923
579 Ga0207668_10153791
580 Ga0207658_10000098
581 Ga0207658_10007077
582 Ga0207658_10104715
583 Ga0207658_10177671
584 Ga0207658_10227697
585 Ga0207658_10341647
586 Ga0207677_10496519
587 Ga0207703_10114873
588 Ga0207703_10229013
589 Ga0207703_10940915
590 Ga0207639_10001111
591 Ga0207639_10033213
592 Ga0207639_10629622
593 Ga0207678_10000281
594 Ga0207678_10043949
595 Ga0207708_10060222
596 Ga0207702_10125986
597 Ga0207641_10014907
598 Ga0207641_10029311
599 Ga0207648_10003243
600 Ga0207676_10989593
601 Ga0207674_10028014
602 Ga0207674_10108718
603 Ga0207674_10515429
604 Ga0207674_10602347
605 Ga0207675_100018900
606 Ga0207683_10030084
607 Ga0207683_10451053
608 Ga0207683_10594192
609 Ga0268266_10000001
610 Ga0268266_10018664
611 Ga0268266_10041904
612 Ga0268266_10229609
613 Ga0268266_10485761
614 Ga0268265_10000775
615 Ga0268265_10040173
616 Ga0268265_10057969
617 Ga0268265_10131782
618 Ga0268264_10025215
619 Ga0307511_10105078
620 Ga0307512_10068133
621 Ga0265329_10148104
622 Ga0265327_10000388
623 Ga0265316_10000487
624 Ga0307513_10310057
625 Ga0307509_10092245
626 Ga0307508_10038551
627 Ga0316575_10037514
628 Ga0316575_10064571
629 Ga0316579_10028392
630 Ga0316576_10007292
631 Ga0316576_10360285
632 Ga0316578_10000520
633 Ga0316577_10000145
634 Ga0307413_10069375
635 Ga0307406_10788729
636 Ga0316583_10035161
637 Ga0316585_10001236
638 Ga0316580_10026206
639 Ga0316574_0009166
640 Ga0316574_0041828
641 Ga0316574_0401205
642 Ga0316582_0003462
643 Ga0316582_0010954
644 Ga0316582_0143532
645 Ga0316584_0066979
646 Ga0400490_13527
647 Ga0400488_21977
648 Ga0400489_64343
649 Ga0436365_0220588
650 Ga0451787_213551
651 Ga0451791_0530729
652 Ga0451791_1241968
653 Ga0451797_0038299
654 Ga0451798_0115836
655 Ga0451802_0464216
656 Ga0451804_0616028
657 Ga0451833_0955805
658 Ga0451837_1268864
659 Ga0451847_0262956
660 Ga0451855_0153956
661 Ga0451853_3452631
662 Ga0451853_4051180
663 Ga0451577_0160659
664 Ga0451577_0234667
665 Ga0453684_0004279
666 Ga0453684_0395403
667 Ga0451576_0000030
668 Ga0451576_0249037
669 Ga0495638_0135774
670 Ga0495598_0152202
671 Ga0495621_0092634
672 Ga0495597_0000342
673 Ga0495625_0346709
674 Ga0495588_0008261
675 Ga0495679_064930
676 Ga0495686_0001504
677 Ga0496102_0387638
678 Ga0496109_0142947
679 Ga0496110_0306811
680 Ga0496113_0097115
681 Ga0496115_0226258
682 Ga0496117_0007264
683 Ga0496118_0000166
684 Ga0496118_0009603
685 Ga0496118_0026629
686 Ga0496118_0045215
687 Ga0496121_0454694
688 Ga0496122_0000734
689 Ga0496123_0002732
690 Ga0496125_0000009
691 Ga0501031_0021475
692 Ga0501031_0102293
693 Ga0501032_0069024
694 Ga0501032_0076139
695 Ga0501032_0092566
696 Ga0501033_0000413
697 Ga0501033_0070866
698 Ga0501033_0155915
699 Ga0501033_0285882
700 Ga0501034_0002423
701 Ga0501034_0050054
702 Ga0501034_0484784
703 Ga0501036_0252631
704 Ga0501036_0383146
705 Ga0501037_0039759
706 Ga0501037_0111018
707 Ga0501037_0155453
708 Ga0501038_0042297
709 Ga0501038_0083506
710 Ga0501038_0118102
711 Ga0501038_0131788
712 Ga0501038_0494076
713 Ga0501038_0706482
714 Ga0501039_0082649
715 Ga0501043_0009886
716 Ga0501043_0071476
717 Ga0501043_0220476
718 Ga0501046_0019786
719 Ga0501046_0039906
720 Ga0501046_0400243
721 Ga0501047_0002796
722 Ga0501047_0028836
723 Ga0501047_0055776
724 Ga0501047_0289944
725 Ga0501048_0003086
726 Ga0501067_0118194
727 Ga0501068_0015702
728 Ga0501068_0050952
729 Ga0501068_0191636
730 Ga0501069_0072162
731 Ga0501070_0015538
732 Ga0501070_0031985
733 Ga0501070_0103870
734 Ga0501070_0142386
735 Ga0501070_0160497
736 Ga0501070_0354685
737 Ga0501071_0060348
738 Ga0501071_0151104
739 Ga0501072_0084334
740 Ga0501073_0470835
741 Ga0501074_0004474
742 Ga0501074_0041890
743 Ga0501076_0214858
744 Ga0501076_0581233
745 Ga0501076_0603393
746 Ga0501079_0065113
747 Ga0501079_0076160
748 Ga0501080_0011938
749 Ga0501080_0037045
750 Ga0501080_0048181
751 Ga0501080_0226269
752 Ga0501080_0326435
753 Ga0501081_0281762
754 Ga0501083_0049283
755 Ga0501035_0006354
756 Ga0501035_0008363
757 Ga0501035_0147661
758 Ga0501035_0526841
759 Ga0501044_0047326
760 Ga0501044_0062930
761 Ga0501044_0093673
762 Ga0501044_0109976
763 Ga0501044_0357006
764 Ga0501044_0417877
765 Ga0501044_0620795
766 Ga0501044_0759410
767 nmdc:mga09592_19239_c1
768 nmdc:mga06r32_7183_c1
769 nmdc:mga08y16_1223816_c1
770 Ga0500610_0000098
771 Ga0500578_0157941
772 Ga0500643_055212
773 Ga0500644_0053609
774 Ga0500644_0083689
775 Ga0500651_0008801
776 Ga0500651_0020696
777 Ga0500651_0045398
778 Ga0500566_0177596
779 Ga0500555_021652
780 Ga0500594_0034119
781 Ga0500595_001358
782 Ga0500597_000155
783 Ga0500614_040826
784 Ga0500642_0001556
785 Ga0500655_047561
786 Ga0500561_0060483
787 Ga0500568_0000145
788 Ga0500568_0004583
789 Ga0500577_0105811
790 Ga0500588_0004889
791 Ga0500604_0122252
792 Ga0500609_004762
793 Ga0501084_0100401
794 Ga0501084_0182070
795 Ga0501082_0005028
796 Ga0501082_0022588
797 Ga0501082_0443574
798 8001525568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

54

188

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7656 21 212
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6615 21 203
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6592 21 212
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.589 33 212
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.5509 25 210
ID Description Score Start End Superfamily
af_Q5JK26_123_351_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.766 13 206 3.40.1130.10
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7638 22 154 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7581 26 156 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7476 22 154 3.40.50.2000
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.7467 17 205 3.40.1130.10
ID Description Score Start End GO Terms
AF-A0A6S6TB26-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC) (EC 2.3.1.51) 0.95 3 120 GO:0003841
GO:0016020
AF-A0A5C5YEY1-F1-model_v4 2-acyl-glycerophospho-ethanolamine acyltransferase 0.9462 1 212 GO:0003841
GO:0006654
GO:0016020
AF-A0A5C5YEY1-F1-model_v4 2-acyl-glycerophospho-ethanolamine acyltransferase 0.9419 1 212 GO:0003841
GO:0006654
GO:0016020
AF-A0A6N3TD31-F1-model_v4 deleted 0.9278 2 98
AF-A0A7C3D8K5-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9206 2 212 GO:0003841
GO:0006654
GO:0016020

Map