F434106

General Info

Members Datasets Scaffolds Average Seq Length
398 234 372 269

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0459645|Ga0436361_0459645_257_1105
Length 282
Sequence MSDLLEFTILGCGSSGGVPRADGNWGVCDPADPRNRRTRCSLLVRRVSEPPEAPATTLVVDTSPEFSLQMAASGAGRLDAALFTHDHADQSHGIDDLRVFWATMRRRIPCHFSRDCRASLTRRFDYVFDGGLGYPAICEAHEIPPHGTPWAVDGPSGAIPIVTFDQEHGPIRSVGYRFGDVAYSPDVSDLPPEALPALSGLKLWIVDALRWTPHPTHFTVEKALAWIAELKPERAILTNLHVDLDYRTLAAQLPDHVEPAYDGMRVAVTLYAHMSSGEIACA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
15 2818991435 Caulobacter henricii 536 Isolate Unclassified
16 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
17 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
22 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
23 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
24 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
25 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
26 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
225 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
229 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
230 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
233 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.47
Metatranscriptomes 0
Isolates 6.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.88
Nodule 0
Rhizoplane 1.76
Rhizosphere 61.81
Stem 0
Stem Tuber 0
Unclassified 10.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1008886 3300003773 Bacteria 2268
2 Ga0055524_1005410 3300003775 Bacteria 5708
3 Ga0055524_1019988 3300003775 Bacteria 2271
4 Ga0055536_1000156 3300003781 Bacteria 59021
5 Ga0055536_1000492 3300003781 Bacteria 27396
6 Ga0055528_1003284 3300003790 Bacteria 8223
7 Ga0055530_10002874 3300003791 Bacteria 10487
8 Ga0055530_10006224 3300003791 Bacteria 5388
9 Ga0055531_10000121 3300003794 Bacteria 87524
10 Ga0055531_10001432 3300003794 Bacteria 17623
11 Ga0055531_10001503 3300003794 Bacteria 17129
12 Ga0065165_1000615 3300005262 Bacteria 51725
13 Ga0070658_10059398 3300005327 Bacteria 3114
14 Ga0070658_10244499 3300005327 Bacteria 1521
15 Ga0070670_100000037 3300005331 Bacteria 156070
16 Ga0070670_100289937 3300005331 Bacteria 1430
17 Ga0070680_100206384 3300005336 Bacteria 1657
18 Ga0070661_100289688 3300005344 Bacteria 1272
19 Ga0070668_100000666 3300005347 Bacteria 23266
20 Ga0070669_100046833 3300005353 Bacteria 3153
21 Ga0070671_100405153 3300005355 Bacteria 1167
22 Ga0070659_100000206 3300005366 Bacteria 45867
23 Ga0070659_100021838 3300005366 Bacteria 4881
24 Ga0070667_100000083 3300005367 Bacteria 118261
25 Ga0070667_100222861 3300005367 Bacteria 1679
26 Ga0068853_100059360 3300005539 Bacteria 3305
27 Ga0068853_100102013 3300005539 Bacteria 2539
28 Ga0068853_100156192 3300005539 Bacteria 2056
29 Ga0068853_100213921 3300005539 Bacteria 1758
30 Ga0070665_100080917 3300005548 Bacteria 3254
31 Ga0068855_100151224 3300005563 Bacteria 2639
32 Ga0068855_100389489 3300005563 Bacteria 1529
33 Ga0070664_100158653 3300005564 Bacteria 2000
34 Ga0068852_100083671 3300005616 Bacteria 2838
35 Ga0068859_100120458 3300005617 Bacteria 2691
36 Ga0068859_100291464 3300005617 Bacteria 1725
37 Ga0068864_100000146 3300005618 Bacteria 67219
38 Ga0068861_100169373 3300005719 Bacteria 1809
39 Ga0068863_100000153 3300005841 Bacteria 72674
40 Ga0068863_100000392 3300005841 Bacteria 44421
41 Ga0068863_100140612 3300005841 Bacteria 2307
42 Ga0068858_100000025 3300005842 Bacteria 160546
43 Ga0068860_100000128 3300005843 Bacteria 122731
44 Ga0068860_100000145 3300005843 Bacteria 115830
45 Ga0068860_100077940 3300005843 Bacteria 3152
46 Ga0068862_100000121 3300005844 Bacteria 91849
47 Ga0068862_100190884 3300005844 Bacteria 1843
48 Ga0068862_100431414 3300005844 Bacteria 1239
49 Ga0075363_100195098 3300006048 Bacteria 1156
50 Ga0070712_100374138 3300006175 Bacteria 1171
51 Ga0075362_10107107 3300006177 Bacteria 1312
52 Ga0075369_10004932 3300006186 Bacteria 4961
53 Ga0075370_10202326 3300006353 Bacteria 1172
54 Ga0075370_10282439 3300006353 Bacteria 986
55 Ga0068865_100000984 3300006881 Bacteria 16311
56 Ga0097620_100120459 3300006931 Bacteria 2691
57 Ga0097620_100291482 3300006931 Bacteria 1725
58 Ga0105240_10002344 3300009093 Bacteria 30572
59 Ga0105240_10219814 3300009093 Bacteria 2214
60 Ga0105240_10525961 3300009093 Bacteria 1312
61 Ga0105247_10077300 3300009101 Bacteria 2091
62 Ga0105241_10348172 3300009174 Bacteria 1286
63 Ga0105248_10000154 3300009177 Bacteria 80081
64 Ga0105248_10021453 3300009177 Bacteria 7154
65 Ga0105248_10061002 3300009177 Bacteria 4233
66 Ga0105248_10107973 3300009177 Bacteria 3138
67 Ga0105248_10198297 3300009177 Bacteria 2262
68 Ga0105238_10002686 3300009551 Bacteria 17688
69 Ga0105238_10164415 3300009551 Bacteria 2195
70 Ga0105238_10524112 3300009551 Bacteria 1188
71 Ga0105249_10000410 3300009553 Bacteria 41122
72 Ga0105239_10766116 3300010375 Bacteria 1105
73 Ga0157373_10000340 3300013100 Bacteria 37871
74 Ga0157373_10000955 3300013100 Bacteria 22427
75 Ga0157369_10113350 3300013105 Bacteria 2880
76 Ga0163163_10347870 3300014325 Bacteria 1538
77 Ga0157380_10441313 3300014326 Bacteria 1247
78 Ga0157380_10624737 3300014326 Bacteria 1070
79 Ga0182008_10068552 3300014497 Bacteria 1745
80 Ga0157379_10060979 3300014968 Bacteria 3373
81 Ga0157379_10087887 3300014968 Bacteria 2787
82 Ga0213872_10063268 3300021361 Bacteria 1672
83 Ga0213876_10000108 3300021384 Bacteria 91222
84 Ga0213876_10015570 3300021384 Bacteria 4024
85 Ga0213876_10125862 3300021384 Bacteria 1361
86 Ga0209026_1001314 3300025250 Bacteria 11193
87 Ga0209148_1013239 3300025254 Bacteria 1488
88 Ga0209565_1002647 3300025263 Bacteria 6302
89 Ga0209673_1000941 3300025273 Bacteria 36504
90 Ga0209675_1019891 3300025291 Bacteria 1834
91 Ga0209676_1000031 3300025292 Bacteria 478976
92 Ga0209676_1000057 3300025292 Bacteria 361061
93 Ga0209564_1005214 3300025295 Bacteria 7519
94 Ga0209564_1008755 3300025295 Bacteria 4935
95 Ga0209564_1027314 3300025295 Bacteria 1857
96 Ga0209758_1070314 3300025297 Bacteria 1105
97 Ga0209050_1000135 3300025298 Bacteria 184020
98 Ga0209050_1000522 3300025298 Bacteria 63985
99 Ga0209050_1013857 3300025298 Bacteria 3536
100 Ga0209256_1000641 3300025299 Bacteria 47608
101 Ga0209256_1009265 3300025299 Bacteria 4348
102 Ga0209051_1000720 3300025303 Bacteria 36140
103 Ga0209257_1000050 3300025304 Bacteria 439325
104 Ga0209257_1000350 3300025304 Bacteria 95008
105 Ga0209257_1004062 3300025304 Bacteria 11744
106 Ga0209257_1005080 3300025304 Bacteria 9554
107 Ga0207710_10124550 3300025900 Bacteria 1234
108 Ga0207705_10035219 3300025909 Bacteria 3581
109 Ga0207654_10065154 3300025911 Bacteria 2144
110 Ga0207695_10023574 3300025913 Bacteria 6948
111 Ga0207695_10382314 3300025913 Bacteria 1293
112 Ga0207660_10002823 3300025917 Bacteria 11402
113 Ga0207649_10217523 3300025920 Bacteria 1359
114 Ga0207650_10000099 3300025925 Bacteria 113522
115 Ga0207650_10174582 3300025925 Bacteria 1710
116 Ga0207690_10000129 3300025932 Bacteria 62350
117 Ga0207690_10013420 3300025932 Bacteria 4923
118 Ga0207690_10300716 3300025932 Bacteria 1255
119 Ga0207704_10010423 3300025938 Bacteria 4535
120 Ga0207711_10000574 3300025941 Bacteria 37451
121 Ga0207711_10101971 3300025941 Bacteria 2540
122 Ga0207711_10229090 3300025941 Bacteria 1701
123 Ga0207711_10455646 3300025941 Bacteria 1191
124 Ga0207679_10108641 3300025945 Bacteria 2185
125 Ga0207667_10051052 3300025949 Bacteria 4361
126 Ga0207667_10216000 3300025949 Bacteria 1965
127 Ga0207667_10370371 3300025949 Bacteria 1460
128 Ga0207712_10001846 3300025961 Bacteria 13975
129 Ga0207668_10227837 3300025972 Bacteria 1500
130 Ga0207658_10000209 3300025986 Bacteria 61041
131 Ga0207658_10208590 3300025986 Bacteria 1636
132 Ga0207703_10000637 3300026035 Bacteria 35229
133 Ga0207703_10001876 3300026035 Bacteria 18678
134 Ga0207639_10041223 3300026041 Bacteria 3453
135 Ga0207639_10170024 3300026041 Bacteria 1845
136 Ga0207702_10260865 3300026078 Bacteria 1631
137 Ga0207641_10000224 3300026088 Bacteria 72770
138 Ga0207641_10091547 3300026088 Bacteria 2661
139 Ga0207676_10000482 3300026095 Bacteria 33559
140 Ga0207676_10000637 3300026095 Bacteria 28167
141 Ga0207698_10353823 3300026142 Bacteria 1388
142 Ga0268266_10057470 3300028379 Bacteria 3348
143 Ga0268265_10008298 3300028380 Bacteria 7016
144 Ga0268265_10081058 3300028380 Bacteria 2561
145 Ga0268265_10114587 3300028380 Bacteria 2208
146 Ga0268264_10000046 3300028381 Bacteria 364597
147 Ga0268264_10000059 3300028381 Bacteria 306927
148 Ga0268264_10049669 3300028381 Bacteria 3491
149 Ga0265326_10017716 3300028558 Bacteria 2053
150 Ga0265334_10004492 3300028573 Bacteria 6187
151 Ga0307515_10047675 3300028794 Bacteria 6504
152 Ga0307515_10058255 3300028794 Bacteria 5567
153 Ga0307515_10176961 3300028794 Bacteria 2100
154 Ga0265338_10010984 3300028800 Bacteria 10522
155 Ga0265338_10044522 3300028800 Bacteria 4097
156 Ga0265338_10055177 3300028800 Bacteria 3537
157 Ga0265338_10081885 3300028800 Bacteria 2704
158 Ga0265338_10085536 3300028800 Bacteria 2628
159 Ga0307511_10098475 3300030521 Bacteria 1935
160 Ga0265340_10102754 3300031247 Bacteria 1327
161 Ga0265327_10000166 3300031251 Bacteria 141539
162 Ga0265327_10001531 3300031251 Bacteria 28533
163 Ga0265327_10002712 3300031251 Bacteria 18137
164 Ga0265327_10038562 3300031251 Bacteria 2606
165 Ga0307513_10005321 3300031456 Bacteria 17020
166 Ga0307513_10054275 3300031456 Bacteria 4298
167 Ga0265314_10118431 3300031711 Bacteria 1671
168 Ga0265314_10135421 3300031711 Bacteria 1530
169 Ga0307516_10000004 3300031730 Bacteria 367451
170 Ga0307410_10084755 3300031852 Bacteria 2235
171 Ga0307414_10042495 3300032004 Bacteria 3089
172 Ga0307414_10244887 3300032004 Bacteria 1486
173 Ga0307411_10060487 3300032005 Bacteria 2516
174 Ga0395899_0000013 3300037312 Bacteria 510397
175 Ga0395899_0000407 3300037312 Bacteria 50216
176 Ga0395899_0032262 3300037312 Bacteria 3935
177 Ga0395899_0052378 3300037312 Bacteria 3025
178 Ga0395899_0065149 3300037312 Bacteria 2678
179 Ga0395900_0000009 3300037418 Bacteria 476249
180 Ga0395900_0131369 3300037418 Bacteria 2566
181 Ga0395898_0002452 3300037466 Bacteria 21910
182 Ga0395898_0032357 3300037466 Bacteria 5220
183 Ga0395898_0240323 3300037466 Bacteria 1727
184 Ga0395905_0004384 3300037471 Bacteria 14687
185 Ga0395905_0029024 3300037471 Bacteria 5214
186 Ga0395905_0098913 3300037471 Bacteria 2740
187 Ga0395905_0109901 3300037471 Bacteria 2588
188 Ga0436364_0001022 3300037853 Bacteria 2435
189 Ga0436364_0916324 3300037853 Bacteria 2890
190 Ga0395901_0000014 3300038443 Bacteria 375100
191 Ga0395901_0112817 3300038443 Bacteria 2855
192 Ga0395901_0164407 3300038443 Bacteria 2330
193 Ga0436365_0191069 3300039437 Bacteria 4024
194 Ga0436365_1544656 3300039437 Bacteria 122419
195 Ga0436360_1359774 3300039438 Bacteria 4670
196 Ga0436361_0118740 3300039447 Bacteria 13719
197 Ga0436361_0459645 3300039447 Bacteria 1242
198 Ga0436363_0980093 3300039450 Bacteria 2308
199 Ga0436362_0116886 3300039453 Bacteria 694
200 Ga0439465_0103165 3300041413 Bacteria 986
201 Ga0451853_1175203 3300041512 Bacteria 1376
202 Ga0439449_0148170 3300042007 Bacteria 875
203 Ga0439446_0008352 3300042156 Bacteria 2745
204 Ga0439435_0010091 3300042436 Bacteria 2232
205 Ga0495627_000218 3300046453 Bacteria 62342
206 Ga0495629_0184181 3300046459 Bacteria 1446
207 Ga0495638_0000371 3300046460 Bacteria 55687
208 Ga0495638_0000419 3300046460 Bacteria 51336
209 Ga0495638_0003152 3300046460 Bacteria 13051
210 Ga0495650_0000007 3300046471 Bacteria 718072
211 Ga0495585_0108335 3300046492 Bacteria 1480
212 Ga0495607_0057116 3300046501 Bacteria 2238
213 Ga0495583_0000037 3300046506 Bacteria 244437
214 Ga0495606_0001606 3300046507 Bacteria 29482
215 Ga0495606_0105217 3300046507 Bacteria 1711
216 Ga0495610_0000040 3300046512 Bacteria 165165
217 Ga0495610_0005336 3300046512 Bacteria 9172
218 Ga0495610_0007388 3300046512 Bacteria 7327
219 Ga0495616_0000026 3300046513 Bacteria 141705
220 Ga0495620_0057708 3300046515 Bacteria 1628
221 Ga0495620_0058505 3300046515 Bacteria 1613
222 Ga0495628_0120186 3300046516 Bacteria 2016
223 Ga0495631_0004765 3300046518 Bacteria 7163
224 Ga0495632_0004056 3300046519 Bacteria 10111
225 Ga0495637_0007469 3300046520 Bacteria 5414
226 Ga0495637_0020710 3300046520 Bacteria 3020
227 Ga0495643_0010986 3300046522 Bacteria 5540
228 Ga0495643_0052183 3300046522 Bacteria 2197
229 Ga0495643_0073477 3300046522 Bacteria 1792
230 Ga0495643_0185111 3300046522 Bacteria 1009
231 Ga0495648_0000029 3300046524 Bacteria 223499
232 Ga0495648_0028336 3300046524 Bacteria 3733
233 Ga0495654_0000095 3300046530 Bacteria 100179
234 Ga0495609_0036382 3300046538 Bacteria 2223
235 Ga0495597_0001923 3300046542 Bacteria 14047
236 Ga0495597_0033114 3300046542 Bacteria 2342
237 Ga0495622_0036894 3300046557 Bacteria 2278
238 Ga0495633_0001309 3300046558 Bacteria 19641
239 Ga0495668_0000019 3300046616 Bacteria 416042
240 Ga0495668_0005736 3300046616 Bacteria 8300
241 Ga0495668_0146163 3300046616 Bacteria 1294
242 Ga0495668_0234657 3300046616 Bacteria 1005
243 Ga0495625_0000080 3300046660 Bacteria 156895
244 Ga0495625_0000793 3300046660 Bacteria 43797
245 Ga0495625_0013830 3300046660 Bacteria 6465
246 Ga0495625_0047709 3300046660 Bacteria 3087
247 Ga0495625_0053920 3300046660 Bacteria 2874
248 Ga0495625_0055709 3300046660 Bacteria 2818
249 Ga0495625_0118615 3300046660 Bacteria 1803
250 Ga0495588_0081735 3300046674 Bacteria 1687
251 Ga0495669_0000024 3300046684 Bacteria 113943
252 Ga0495669_0001148 3300046684 Bacteria 10983
253 Ga0495613_0000872 3300046689 Bacteria 23141
254 Ga0495589_0002410 3300046794 Bacteria 10505
255 Ga0495660_0032824 3300046810 Bacteria 2914
256 Ga0495672_0002465 3300047320 Bacteria 17011
257 Ga0495683_0061416 3300047323 Bacteria 1861
258 Ga0495673_0000132 3300047469 Bacteria 138001
259 Ga0495673_0001163 3300047469 Bacteria 22269
260 Ga0495673_0002250 3300047469 Bacteria 13854
261 Ga0495681_0138142 3300047470 Bacteria 1031
262 Ga0495686_0000259 3300047472 Bacteria 94672
263 Ga0495686_0003298 3300047472 Bacteria 14094
264 Ga0495686_0012381 3300047472 Bacteria 5968
265 Ga0495686_0014819 3300047472 Bacteria 5356
266 Ga0495686_0036090 3300047472 Bacteria 3173
267 Ga0495686_0175757 3300047472 Bacteria 1243
268 Ga0496101_0589044 3300048904 Bacteria 879
269 Ga0496102_0039400 3300048905 Bacteria 4270
270 Ga0496107_0000023 3300048910 Bacteria 125918
271 Ga0496115_0020713 3300048918 Bacteria 5074
272 Ga0496115_0080268 3300048918 Bacteria 2656
273 Ga0496115_0103200 3300048918 Bacteria 2339
274 Ga0496115_0347486 3300048918 Bacteria 1210
275 Ga0496117_0054273 3300048920 Bacteria 2808
276 Ga0496118_0008339 3300048921 Bacteria 10729
277 Ga0496119_0031818 3300048922 Bacteria 3528
278 Ga0496121_0000009 3300048924 Bacteria 836971
279 Ga0496121_0017322 3300048924 Bacteria 7370
280 Ga0496121_0204761 3300048924 Bacteria 1403
281 Ga0496124_0012555 3300048927 Bacteria 8348
282 Ga0496124_0260147 3300048927 Bacteria 1278
283 Ga0496125_0021799 3300048928 Bacteria 5961
284 Ga0496126_0019699 3300048929 Bacteria 6639
285 Ga0495678_004163 3300049459 Bacteria 8539
286 Ga0501033_0006136 3300049570 Bacteria 9428
287 Ga0501033_0019334 3300049570 Bacteria 5150
288 Ga0501034_0002163 3300049571 Bacteria 24368
289 Ga0501034_0272034 3300049571 Bacteria 1635
290 Ga0501038_0169616 3300049574 Bacteria 1768
291 Ga0501043_0359923 3300049579 Bacteria 1104
292 Ga0501046_0243966 3300049580 Bacteria 1324
293 Ga0501047_0000915 3300049581 Bacteria 30168
294 Ga0501047_0006451 3300049581 Bacteria 11036
295 Ga0501047_0042268 3300049581 Bacteria 4405
296 Ga0501070_0334182 3300049586 Bacteria 1231
297 Ga0501238_012940 3300049671 Bacteria 1132
298 Ga0501257_010639 3300049686 Bacteria 2092
299 Ga0501080_0003368 3300049742 Bacteria 14108
300 Ga0501035_0187991 3300049822 Bacteria 1777
301 Ga0501044_0001452 3300049823 Bacteria 27850
302 Ga0501044_0011656 3300049823 Bacteria 9526
303 Ga0501044_0185849 3300049823 Bacteria 2043
304 Ga0501044_0529934 3300049823 Bacteria 1077
305 Ga0501044_0583567 3300049823 Bacteria 1012
306 nmdc:mga07m45_148473_c1 3300050496 Bacteria 1359
307 nmdc:mga07m45_1631_c1 3300050496 Bacteria 10333
308 Ga0500635_0000967 3300053080 Bacteria 6915
309 Ga0500635_0084270 3300053080 Bacteria 1147
310 Ga0500578_0000008 3300053086 Bacteria 223557
311 Ga0500643_000376 3300053087 Bacteria 34859
312 Ga0500643_000636 3300053087 Bacteria 23637
313 Ga0500643_020094 3300053087 Bacteria 2189
314 Ga0500643_022187 3300053087 Bacteria 2047
315 Ga0500644_0000043 3300053088 Bacteria 76139
316 Ga0500581_169268 3300053089 Bacteria 1005
317 Ga0500651_0004787 3300053093 Bacteria 7634
318 Ga0500651_0158413 3300053093 Bacteria 1355
319 Ga0500641_0000264 3300053096 Bacteria 19552
320 Ga0500641_0007581 3300053096 Bacteria 3871
321 Ga0500641_0121989 3300053096 Bacteria 1124
322 Ga0500554_001029 3300053102 Bacteria 5414
323 Ga0500555_039233 3300053103 Bacteria 1323
324 Ga0500556_0000178 3300053104 Bacteria 52397
325 Ga0500556_0001842 3300053104 Bacteria 7691
326 Ga0500562_000350 3300053108 Bacteria 11107
327 Ga0500562_001177 3300053108 Bacteria 6452
328 Ga0500562_010234 3300053108 Bacteria 2375
329 Ga0500562_010910 3300053108 Bacteria 2305
330 Ga0500569_001284 3300053109 Bacteria 4683
331 Ga0500572_000946 3300053111 Bacteria 8808
332 Ga0500594_0000215 3300053118 Bacteria 14168
333 Ga0500595_003330 3300053119 Bacteria 7553
334 Ga0500595_029069 3300053119 Bacteria 1878
335 Ga0500608_000154 3300053122 Bacteria 28470
336 Ga0500608_006541 3300053122 Bacteria 4753
337 Ga0500608_037435 3300053122 Bacteria 2318
338 Ga0500614_006214 3300053123 Bacteria 2508
339 Ga0500614_009228 3300053123 Bacteria 2102
340 Ga0500614_075186 3300053123 Bacteria 935
341 Ga0500618_000034 3300053125 Bacteria 120560
342 Ga0500658_0001264 3300053134 Bacteria 10250
343 Ga0500559_0000005 3300053136 Bacteria 230231
344 Ga0500559_0000040 3300053136 Bacteria 106740
345 Ga0500559_0003836 3300053136 Bacteria 7275
346 Ga0500559_0013487 3300053136 Bacteria 3461
347 Ga0500559_0022009 3300053136 Bacteria 2704
348 Ga0500564_000055 3300053138 Bacteria 29873
349 Ga0500577_0000255 3300053142 Bacteria 13916
350 Ga0500616_0018369 3300053153 Bacteria 3955
351 Ga0500616_0059684 3300053153 Bacteria 1980
352 Ga0500616_0085403 3300053153 Bacteria 1576
353 Ga0500619_005915 3300053154 Bacteria 2775
354 Ga0500620_083768 3300053155 Bacteria 1107
355 Ga0500622_0000437 3300053156 Bacteria 39563
356 Ga0500622_0005444 3300053156 Bacteria 7649
357 Ga0500622_0008946 3300053156 Bacteria 5567
358 Ga0500622_0010319 3300053156 Bacteria 5132
359 Ga0500622_0015745 3300053156 Bacteria 4047
360 Ga0500636_0036778 3300053177 Bacteria 2897
361 Ga0500637_0003971 3300053178 Bacteria 6926
362 Ga0500576_026660 3300053725 Bacteria 2636
363 Ga0500625_135624 3300053729 Bacteria 958
364 Ga0500645_001571 3300053730 Bacteria 11367
365 Ga0500645_003267 3300053730 Bacteria 6691
366 Ga0500645_005799 3300053730 Bacteria 4491
367 Ga0500645_012428 3300053730 Bacteria 2750
368 Ga0500645_015092 3300053730 Bacteria 2452
369 Ga0500645_050598 3300053730 Bacteria 1212
370 Ga0500609_000621 3300053731 Bacteria 5401
371 Ga0500601_011052 3300053737 Bacteria 1014
372 Ga0501082_0027584 3300060353 Bacteria 4888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0116886 Ga0436362_0116886_23_676 209
2 3300053089 Ga0500581_169268 Ga0500581_169268_315_989 220
3 3300046538 Ga0495609_0036382 Ga0495609_0036382_1492_2199 223
4 3300053119 Ga0500595_029069 Ga0500595_029069_1157_1864 223
5 3300053729 Ga0500625_135624 Ga0500625_135624_196_903 223
6 3300053093 Ga0500651_0158413 Ga0500651_0158413_44_727 225
7 3300041413 Ga0439465_0103165 Ga0439465_0103165_267_947 226
8 3300048904 Ga0496101_0589044 Ga0496101_0589044_31_714 226
9 3300025304 Ga0209257_1004062 Ga0209257_10040624 238
10 3300049570 Ga0501033_0019334 Ga0501033_0019334_903_1727 240
11 3300049822 Ga0501035_0187991 Ga0501035_0187991_911_1735 240
12 3300049823 Ga0501044_0001452 Ga0501044_0001452_368_1192 240
13 3300049580 Ga0501046_0243966 Ga0501046_0243966_339_1124 241
14 3300031730 Ga0307516_10000004 Ga0307516_10000004302 245
15 3300053080 Ga0500635_0084270 Ga0500635_0084270_356_1120 247
16 3300049579 Ga0501043_0359923 Ga0501043_0359923_147_962 248
17 3300049581 Ga0501047_0042268 Ga0501047_0042268_2927_3742 248
18 3300049823 Ga0501044_0185849 Ga0501044_0185849_730_1545 248
19 3300031251 Ga0265327_10000166 Ga0265327_10000166128 251
20 3300047472 Ga0495686_0012381 Ga0495686_0012381_881_1684 253
21 3300039438 Ga0436360_1359774 Ga0436360_1359774_2023_2853 255
22 iso_pu_bacteria 2977240413 2977242140 256
23 3300021384 Ga0213876_10125862 Ga0213876_101258622 258
24 3300037853 Ga0436364_0001022 Ga0436364_0001022_385_1200 258
25 3300038443 Ga0395901_0112817 Ga0395901_0112817_1924_2718 258
26 3300049571 Ga0501034_0272034 Ga0501034_0272034_259_1056 258
27 3300049574 Ga0501038_0169616 Ga0501038_0169616_375_1172 258
28 3300053096 Ga0500641_0121989 Ga0500641_0121989_57_857 258
29 3300005539 Ga0068853_100059360 Ga0068853_1000593602 260
30 3300009551 Ga0105238_10524112 Ga0105238_105241123 260
31 3300013105 Ga0157369_10113350 Ga0157369_101133502 260
32 3300025986 Ga0207658_10208590 Ga0207658_102085902 260
33 3300031852 Ga0307410_10084755 Ga0307410_100847552 260
34 3300032004 Ga0307414_10042495 Ga0307414_100424952 260
35 3300039437 Ga0436365_1544656 Ga0436365_1544656_66088_66894 260
36 3300039450 Ga0436363_0980093 Ga0436363_0980093_1332_2138 260
37 3300041512 Ga0451853_1175203 Ga0451853_1175203_91_882 260
38 3300046558 Ga0495633_0001309 Ga0495633_0001309_6369_7163 260
39 3300053087 Ga0500643_022187 Ga0500643_022187_952_1752 260
40 3300053104 Ga0500556_0001842 Ga0500556_0001842_4237_5037 260
41 3300053108 Ga0500562_001177 Ga0500562_001177_2118_2918 260
42 3300053108 Ga0500562_010910 Ga0500562_010910_1457_2257 260
43 3300053153 Ga0500616_0085403 Ga0500616_0085403_679_1479 260
44 3300053156 Ga0500622_0008946 Ga0500622_0008946_2311_3111 260
45 3300053730 Ga0500645_005799 Ga0500645_005799_2167_2967 260
46 3300053730 Ga0500645_050598 Ga0500645_050598_180_980 260
47 iso_pu_bacteria 2643221598 2644000143 260
48 iso_pu_bacteria 2941485952 2941487414 260
49 3300014326 Ga0157380_10441313 Ga0157380_104413132 261
50 3300037471 Ga0395905_0029024 Ga0395905_0029024_4311_5126 261
51 3300046616 Ga0495668_0234657 Ga0495668_0234657_190_987 261
52 3300053087 Ga0500643_000376 Ga0500643_000376_9732_10529 261
53 3300053096 Ga0500641_0000264 Ga0500641_0000264_17681_18478 261
54 3300053096 Ga0500641_0007581 Ga0500641_0007581_2810_3625 261
55 3300053108 Ga0500562_010234 Ga0500562_010234_471_1286 261
56 3300053153 Ga0500616_0018369 Ga0500616_0018369_602_1399 261
57 3300053156 Ga0500622_0010319 Ga0500622_0010319_3272_4069 261
58 3300053730 Ga0500645_012428 Ga0500645_012428_1414_2211 261
59 iso_pu_bacteria 2643221640 2644226080 261
60 iso_pu_bacteria 2643221642 2644235568 261
61 iso_pu_bacteria 2857504554 2857509095 261
62 3300009177 Ga0105248_10198297 Ga0105248_101982973 262
63 3300025250 Ga0209026_1001314 Ga0209026_100131410 262
64 3300025941 Ga0207711_10229090 Ga0207711_102290902 262
65 3300037471 Ga0395905_0098913 Ga0395905_0098913_1759_2577 262
66 3300042007 Ga0439449_0148170 Ga0439449_0148170_42_845 262
67 3300046660 Ga0495625_0118615 Ga0495625_0118615_919_1737 262
68 3300047472 Ga0495686_0003298 Ga0495686_0003298_6934_7752 262
69 3300049823 Ga0501044_0583567 Ga0501044_0583567_102_905 262
70 3300053730 Ga0500645_003267 Ga0500645_003267_5815_6633 262
71 iso_pu_bacteria 2582581279 2585148562 262
72 iso_pu_bacteria 2585428106 2587916414 262
73 iso_pu_bacteria 2884960567 2884964935 262
74 iso_pu_bacteria 2928531327 2928535140 262
75 3300028800 Ga0265338_10081885 Ga0265338_100818853 263
76 3300032005 Ga0307411_10060487 Ga0307411_100604872 263
77 3300037312 Ga0395899_0000407 Ga0395899_0000407_25346_26167 263
78 3300037418 Ga0395900_0000009 Ga0395900_0000009_253794_254615 263
79 3300037466 Ga0395898_0002452 Ga0395898_0002452_20100_20921 263
80 3300037471 Ga0395905_0004384 Ga0395905_0004384_9264_10085 263
81 3300038443 Ga0395901_0000014 Ga0395901_0000014_204993_205814 263
82 3300039447 Ga0436361_0118740 Ga0436361_0118740_4236_5057 263
83 3300046516 Ga0495628_0120186 Ga0495628_0120186_408_1229 263
84 3300049581 Ga0501047_0000915 Ga0501047_0000915_29233_30048 263
85 3300049742 Ga0501080_0003368 Ga0501080_0003368_7908_8723 263
86 3300053103 Ga0500555_039233 Ga0500555_039233_343_1161 263
87 3300053136 Ga0500559_0000040 Ga0500559_0000040_51778_52581 263
88 3300053136 Ga0500559_0022009 Ga0500559_0022009_1132_1935 263
89 3300060353 Ga0501082_0027584 Ga0501082_0027584_3230_4045 263
90 iso_pu_bacteria 2510917020 2511122420 263
91 iso_pu_bacteria 2582581280 2585153827 263
92 iso_pu_bacteria 2582581293 2585198040 263
93 iso_pu_bacteria 2643221545 2643747852 263
94 iso_pu_bacteria 2643221552 2643778480 263
95 iso_pu_bacteria 2643221583 2643924892 263
96 iso_pu_bacteria 2643221584 2643931366 263
97 iso_pu_bacteria 2643221691 2644511466 263
98 iso_pu_bacteria 2791355048 2792463792 263
99 iso_pu_bacteria 2818991435 2819537992 263
100 iso_pu_bacteria 2818991454 2819648447 263
101 iso_pu_bacteria 2843744320 2843747890 263
102 iso_pu_bacteria 2849560528 2849560577 263
103 iso_pu_bacteria 2849573788 2849577055 263
104 iso_pu_bacteria 2851153111 2851153692 263
105 iso_pu_bacteria 2898329390 2898329633 263
106 3300005327 Ga0070658_10059398 Ga0070658_100593983 264
107 3300005327 Ga0070658_10244499 Ga0070658_102444992 264
108 3300005331 Ga0070670_100000037 Ga0070670_100000037118 264
109 3300005331 Ga0070670_100289937 Ga0070670_1002899372 264
110 3300005336 Ga0070680_100206384 Ga0070680_1002063842 264
111 3300005344 Ga0070661_100289688 Ga0070661_1002896882 264
112 3300005347 Ga0070668_100000666 Ga0070668_10000066612 264
113 3300005353 Ga0070669_100046833 Ga0070669_1000468333 264
114 3300005355 Ga0070671_100405153 Ga0070671_1004051531 264
115 3300005366 Ga0070659_100000206 Ga0070659_1000002069 264
116 3300005366 Ga0070659_100021838 Ga0070659_1000218387 264
117 3300005367 Ga0070667_100000083 Ga0070667_100000083118 264
118 3300005367 Ga0070667_100222861 Ga0070667_1002228612 264
119 3300005539 Ga0068853_100102013 Ga0068853_1001020131 264
120 3300005539 Ga0068853_100156192 Ga0068853_1001561922 264
121 3300005539 Ga0068853_100213921 Ga0068853_1002139212 264
122 3300005548 Ga0070665_100080917 Ga0070665_1000809174 264
123 3300005563 Ga0068855_100151224 Ga0068855_1001512243 264
124 3300005563 Ga0068855_100389489 Ga0068855_1003894892 264
125 3300005564 Ga0070664_100158653 Ga0070664_1001586533 264
126 3300005616 Ga0068852_100083671 Ga0068852_1000836712 264
127 3300005617 Ga0068859_100120458 Ga0068859_1001204582 264
128 3300005617 Ga0068859_100291464 Ga0068859_1002914642 264
129 3300005618 Ga0068864_100000146 Ga0068864_1000001467 264
130 3300005719 Ga0068861_100169373 Ga0068861_1001693732 264
131 3300005841 Ga0068863_100000153 Ga0068863_10000015361 264
132 3300005841 Ga0068863_100000392 Ga0068863_10000039246 264
133 3300005842 Ga0068858_100000025 Ga0068858_100000025150 264
134 3300005843 Ga0068860_100000128 Ga0068860_10000012860 264
135 3300005843 Ga0068860_100000145 Ga0068860_10000014550 264
136 3300005844 Ga0068862_100000121 Ga0068862_10000012134 264
137 3300005844 Ga0068862_100190884 Ga0068862_1001908842 264
138 3300006048 Ga0075363_100195098 Ga0075363_1001950982 264
139 3300006175 Ga0070712_100374138 Ga0070712_1003741382 264
140 3300006177 Ga0075362_10107107 Ga0075362_101071072 264
141 3300006881 Ga0068865_100000984 Ga0068865_10000098417 264
142 3300006931 Ga0097620_100120459 Ga0097620_1001204592 264
143 3300006931 Ga0097620_100291482 Ga0097620_1002914822 264
144 3300009093 Ga0105240_10002344 Ga0105240_100023446 264
145 3300009093 Ga0105240_10219814 Ga0105240_102198142 264
146 3300009093 Ga0105240_10525961 Ga0105240_105259612 264
147 3300009101 Ga0105247_10077300 Ga0105247_100773002 264
148 3300009174 Ga0105241_10348172 Ga0105241_103481721 264
149 3300009177 Ga0105248_10000154 Ga0105248_1000015431 264
150 3300009177 Ga0105248_10021453 Ga0105248_100214539 264
151 3300009177 Ga0105248_10061002 Ga0105248_100610027 264
152 3300009177 Ga0105248_10107973 Ga0105248_101079733 264
153 3300009551 Ga0105238_10002686 Ga0105238_100026869 264
154 3300009551 Ga0105238_10164415 Ga0105238_101644152 264
155 3300009553 Ga0105249_10000410 Ga0105249_100004105 264
156 3300010375 Ga0105239_10766116 Ga0105239_107661162 264
157 3300013100 Ga0157373_10000340 Ga0157373_1000034037 264
158 3300013100 Ga0157373_10000955 Ga0157373_1000095513 264
159 3300014325 Ga0163163_10347870 Ga0163163_103478702 264
160 3300014968 Ga0157379_10060979 Ga0157379_100609794 264
161 3300014968 Ga0157379_10087887 Ga0157379_100878872 264
162 3300021384 Ga0213876_10000108 Ga0213876_1000010841 264
163 3300021384 Ga0213876_10015570 Ga0213876_100155702 264
164 3300025254 Ga0209148_1013239 Ga0209148_10132392 264
165 3300025900 Ga0207710_10124550 Ga0207710_101245501 264
166 3300025909 Ga0207705_10035219 Ga0207705_100352194 264
167 3300025911 Ga0207654_10065154 Ga0207654_100651542 264
168 3300025913 Ga0207695_10023574 Ga0207695_100235742 264
169 3300025913 Ga0207695_10382314 Ga0207695_103823142 264
170 3300025917 Ga0207660_10002823 Ga0207660_100028232 264
171 3300025920 Ga0207649_10217523 Ga0207649_102175232 264
172 3300025925 Ga0207650_10000099 Ga0207650_10000099104 264
173 3300025925 Ga0207650_10174582 Ga0207650_101745822 264
174 3300025932 Ga0207690_10000129 Ga0207690_1000012957 264
175 3300025932 Ga0207690_10013420 Ga0207690_100134202 264
176 3300025932 Ga0207690_10300716 Ga0207690_103007162 264
177 3300025938 Ga0207704_10010423 Ga0207704_100104234 264
178 3300025941 Ga0207711_10000574 Ga0207711_1000057410 264
179 3300025941 Ga0207711_10101971 Ga0207711_101019712 264
180 3300025941 Ga0207711_10455646 Ga0207711_104556462 264
181 3300025945 Ga0207679_10108641 Ga0207679_101086413 264
182 3300025949 Ga0207667_10051052 Ga0207667_100510524 264
183 3300025949 Ga0207667_10216000 Ga0207667_102160002 264
184 3300025949 Ga0207667_10370371 Ga0207667_103703712 264
185 3300025961 Ga0207712_10001846 Ga0207712_1000184614 264
186 3300025972 Ga0207668_10227837 Ga0207668_102278372 264
187 3300025986 Ga0207658_10000209 Ga0207658_100002093 264
188 3300026035 Ga0207703_10000637 Ga0207703_1000063732 264
189 3300026035 Ga0207703_10001876 Ga0207703_1000187616 264
190 3300026041 Ga0207639_10041223 Ga0207639_100412234 264
191 3300026041 Ga0207639_10170024 Ga0207639_101700242 264
192 3300026078 Ga0207702_10260865 Ga0207702_102608652 264
193 3300026088 Ga0207641_10000224 Ga0207641_1000022460 264
194 3300026088 Ga0207641_10091547 Ga0207641_100915473 264
195 3300026095 Ga0207676_10000482 Ga0207676_1000048228 264
196 3300026095 Ga0207676_10000637 Ga0207676_1000063726 264
197 3300026142 Ga0207698_10353823 Ga0207698_103538232 264
198 3300028379 Ga0268266_10057470 Ga0268266_100574702 264
199 3300028380 Ga0268265_10008298 Ga0268265_100082984 264
200 3300028380 Ga0268265_10081058 Ga0268265_100810583 264
201 3300028381 Ga0268264_10000046 Ga0268264_1000004698 264
202 3300028381 Ga0268264_10000059 Ga0268264_10000059192 264
203 3300028558 Ga0265326_10017716 Ga0265326_100177163 264
204 3300028573 Ga0265334_10004492 Ga0265334_100044927 264
205 3300028800 Ga0265338_10010984 Ga0265338_100109846 264
206 3300028800 Ga0265338_10044522 Ga0265338_100445225 264
207 3300028800 Ga0265338_10085536 Ga0265338_100855362 264
208 3300030521 Ga0307511_10098475 Ga0307511_100984753 264
209 3300031247 Ga0265340_10102754 Ga0265340_101027542 264
210 3300031251 Ga0265327_10001531 Ga0265327_1000153125 264
211 3300031251 Ga0265327_10002712 Ga0265327_1000271216 264
212 3300031251 Ga0265327_10038562 Ga0265327_100385622 264
213 3300031456 Ga0307513_10054275 Ga0307513_100542754 264
214 3300031711 Ga0265314_10118431 Ga0265314_101184312 264
215 3300031711 Ga0265314_10135421 Ga0265314_101354212 264
216 3300032004 Ga0307414_10244887 Ga0307414_102448871 264
217 3300037312 Ga0395899_0032262 Ga0395899_0032262_2148_2975 264
218 3300037312 Ga0395899_0052378 Ga0395899_0052378_1378_2202 264
219 3300037312 Ga0395899_0065149 Ga0395899_0065149_1524_2336 264
220 3300037418 Ga0395900_0131369 Ga0395900_0131369_1185_1997 264
221 3300037466 Ga0395898_0032357 Ga0395898_0032357_3315_4139 264
222 3300037466 Ga0395898_0240323 Ga0395898_0240323_280_1107 264
223 3300037471 Ga0395905_0109901 Ga0395905_0109901_145_957 264
224 3300038443 Ga0395901_0164407 Ga0395901_0164407_144_956 264
225 3300039437 Ga0436365_0191069 Ga0436365_0191069_678_1505 264
226 3300046459 Ga0495629_0184181 Ga0495629_0184181_263_1093 264
227 3300046507 Ga0495606_0105217 Ga0495606_0105217_385_1215 264
228 3300046515 Ga0495620_0058505 Ga0495620_0058505_50_880 264
229 3300046522 Ga0495643_0010986 Ga0495643_0010986_1541_2371 264
230 3300046542 Ga0495597_0001923 Ga0495597_0001923_4784_5614 264
231 3300046557 Ga0495622_0036894 Ga0495622_0036894_1153_1983 264
232 3300046616 Ga0495668_0146163 Ga0495668_0146163_41_871 264
233 3300046660 Ga0495625_0053920 Ga0495625_0053920_751_1581 264
234 3300046674 Ga0495588_0081735 Ga0495588_0081735_600_1424 264
235 3300046684 Ga0495669_0000024 Ga0495669_0000024_29699_30523 264
236 3300046684 Ga0495669_0001148 Ga0495669_0001148_1716_2540 264
237 3300046689 Ga0495613_0000872 Ga0495613_0000872_6321_7133 264
238 3300048905 Ga0496102_0039400 Ga0496102_0039400_3419_4246 264
239 3300048918 Ga0496115_0080268 Ga0496115_0080268_1793_2605 264
240 3300048918 Ga0496115_0103200 Ga0496115_0103200_930_1754 264
241 3300048920 Ga0496117_0054273 Ga0496117_0054273_1218_2054 264
242 3300048921 Ga0496118_0008339 Ga0496118_0008339_6273_7109 264
243 3300048922 Ga0496119_0031818 Ga0496119_0031818_1322_2158 264
244 3300048924 Ga0496121_0000009 Ga0496121_0000009_278688_279524 264
245 3300049581 Ga0501047_0006451 Ga0501047_0006451_9644_10468 264
246 3300049586 Ga0501070_0334182 Ga0501070_0334182_46_855 264
247 3300049686 Ga0501257_010639 Ga0501257_010639_742_1566 264
248 3300049823 Ga0501044_0529934 Ga0501044_0529934_225_1037 264
249 3300050496 nmdc:mga07m45_1631_c1 nmdc:mga07m45_1631_c1_8555_9376 264
250 3300053080 Ga0500635_0000967 Ga0500635_0000967_2785_3612 264
251 3300053087 Ga0500643_000636 Ga0500643_000636_2462_3271 264
252 3300053087 Ga0500643_020094 Ga0500643_020094_1265_2077 264
253 3300053093 Ga0500651_0004787 Ga0500651_0004787_5332_6162 264
254 3300053109 Ga0500569_001284 Ga0500569_001284_1082_1912 264
255 3300053111 Ga0500572_000946 Ga0500572_000946_6930_7742 264
256 3300053119 Ga0500595_003330 Ga0500595_003330_5493_6311 264
257 3300053122 Ga0500608_006541 Ga0500608_006541_54_884 264
258 3300053123 Ga0500614_006214 Ga0500614_006214_1336_2166 264
259 3300053123 Ga0500614_075186 Ga0500614_075186_89_901 264
260 3300053154 Ga0500619_005915 Ga0500619_005915_308_1138 264
261 3300053155 Ga0500620_083768 Ga0500620_083768_134_964 264
262 3300053177 Ga0500636_0036778 Ga0500636_0036778_630_1457 264
263 3300053178 Ga0500637_0003971 Ga0500637_0003971_4173_5000 264
264 3300053725 Ga0500576_026660 Ga0500576_026660_1045_1875 264
265 3300053737 Ga0500601_011052 Ga0500601_011052_169_996 264
266 3300003781 Ga0055536_1000156 Ga0055536_100015658 265
267 3300003791 Ga0055530_10002874 Ga0055530_100028742 265
268 3300003794 Ga0055531_10000121 Ga0055531_100001216 265
269 3300005841 Ga0068863_100140612 Ga0068863_1001406123 265
270 3300005843 Ga0068860_100077940 Ga0068860_1000779402 265
271 3300005844 Ga0068862_100431414 Ga0068862_1004314141 265
272 3300021361 Ga0213872_10063268 Ga0213872_100632682 265
273 3300025292 Ga0209676_1000031 Ga0209676_1000031305 265
274 3300025298 Ga0209050_1000135 Ga0209050_1000135141 265
275 3300025304 Ga0209257_1000050 Ga0209257_1000050125 265
276 3300028380 Ga0268265_10114587 Ga0268265_101145871 265
277 3300028381 Ga0268264_10049669 Ga0268264_100496692 265
278 3300028800 Ga0265338_10055177 Ga0265338_100551772 265
279 3300031456 Ga0307513_10005321 Ga0307513_1000532116 265
280 3300037312 Ga0395899_0000013 Ga0395899_0000013_141140_141952 265
281 3300039447 Ga0436361_0459645 Ga0436361_0459645_257_1105 265
282 3300046522 Ga0495643_0185111 Ga0495643_0185111_91_924 265
283 3300046616 Ga0495668_0000019 Ga0495668_0000019_52461_53264 265
284 3300049570 Ga0501033_0006136 Ga0501033_0006136_3902_4714 265
285 3300049571 Ga0501034_0002163 Ga0501034_0002163_2446_3258 265
286 3300049823 Ga0501044_0011656 Ga0501044_0011656_3315_4127 265
287 3300053122 Ga0500608_000154 Ga0500608_000154_15044_15847 265
288 3300053136 Ga0500559_0003836 Ga0500559_0003836_2842_3645 265
289 3300053153 Ga0500616_0059684 Ga0500616_0059684_133_942 265
290 3300053156 Ga0500622_0005444 Ga0500622_0005444_3948_4751 265
291 3300053156 Ga0500622_0015745 Ga0500622_0015745_1875_2690 265
292 3300003781 Ga0055536_1000492 Ga0055536_100049220 266
293 3300003791 Ga0055530_10006224 Ga0055530_100062244 266
294 3300006186 Ga0075369_10004932 Ga0075369_100049322 266
295 3300006353 Ga0075370_10282439 Ga0075370_102824391 266
296 3300025292 Ga0209676_1000057 Ga0209676_100005769 266
297 3300025295 Ga0209564_1027314 Ga0209564_10273143 266
298 3300025298 Ga0209050_1000522 Ga0209050_100052225 266
299 3300025303 Ga0209051_1000720 Ga0209051_10007208 266
300 3300025304 Ga0209257_1005080 Ga0209257_10050805 266
301 3300028794 Ga0307515_10047675 Ga0307515_100476755 266
302 3300028794 Ga0307515_10058255 Ga0307515_100582554 266
303 3300046460 Ga0495638_0003152 Ga0495638_0003152_4284_5090 266
304 3300046512 Ga0495610_0007388 Ga0495610_0007388_5211_6017 266
305 3300046518 Ga0495631_0004765 Ga0495631_0004765_2178_2984 266
306 3300046524 Ga0495648_0000029 Ga0495648_0000029_8332_9138 266
307 3300046542 Ga0495597_0033114 Ga0495597_0033114_833_1654 266
308 3300046616 Ga0495668_0005736 Ga0495668_0005736_5649_6455 266
309 3300047469 Ga0495673_0001163 Ga0495673_0001163_14169_14975 266
310 3300047472 Ga0495686_0000259 Ga0495686_0000259_68425_69231 266
311 3300047472 Ga0495686_0014819 Ga0495686_0014819_1119_1952 266
312 3300048918 Ga0496115_0347486 Ga0496115_0347486_139_945 266
313 3300048927 Ga0496124_0012555 Ga0496124_0012555_6114_6920 266
314 3300048928 Ga0496125_0021799 Ga0496125_0021799_1249_2055 266
315 3300048929 Ga0496126_0019699 Ga0496126_0019699_69_875 266
316 3300049459 Ga0495678_004163 Ga0495678_004163_4350_5156 266
317 3300053086 Ga0500578_0000008 Ga0500578_0000008_205565_206371 266
318 3300053088 Ga0500644_0000043 Ga0500644_0000043_67123_67929 266
319 3300053108 Ga0500562_000350 Ga0500562_000350_2912_3718 266
320 3300053118 Ga0500594_0000215 Ga0500594_0000215_5403_6209 266
321 3300053138 Ga0500564_000055 Ga0500564_000055_20744_21550 266
322 3300053156 Ga0500622_0000437 Ga0500622_0000437_18844_19650 266
323 3300003773 Ga0055537_1008886 Ga0055537_10088862 267
324 3300003775 Ga0055524_1005410 Ga0055524_10054103 267
325 3300003775 Ga0055524_1019988 Ga0055524_10199882 267
326 3300003790 Ga0055528_1003284 Ga0055528_10032846 267
327 3300003794 Ga0055531_10001432 Ga0055531_100014323 267
328 3300003794 Ga0055531_10001503 Ga0055531_1000150315 267
329 3300005262 Ga0065165_1000615 Ga0065165_100061514 267
330 3300006353 Ga0075370_10202326 Ga0075370_102023262 267
331 3300014326 Ga0157380_10624737 Ga0157380_106247372 267
332 3300014497 Ga0182008_10068552 Ga0182008_100685522 267
333 3300025263 Ga0209565_1002647 Ga0209565_10026474 267
334 3300025273 Ga0209673_1000941 Ga0209673_100094129 267
335 3300025291 Ga0209675_1019891 Ga0209675_10198912 267
336 3300025295 Ga0209564_1005214 Ga0209564_10052145 267
337 3300025295 Ga0209564_1008755 Ga0209564_10087554 267
338 3300025297 Ga0209758_1070314 Ga0209758_10703141 267
339 3300025298 Ga0209050_1013857 Ga0209050_10138574 267
340 3300025299 Ga0209256_1000641 Ga0209256_100064116 267
341 3300025299 Ga0209256_1009265 Ga0209256_10092652 267
342 3300025304 Ga0209257_1000350 Ga0209257_100035049 267
343 3300028794 Ga0307515_10176961 Ga0307515_101769613 267
344 3300037853 Ga0436364_0916324 Ga0436364_0916324_27_851 267
345 3300042156 Ga0439446_0008352 Ga0439446_0008352_1825_2631 267
346 3300042436 Ga0439435_0010091 Ga0439435_0010091_1178_1981 267
347 3300046453 Ga0495627_000218 Ga0495627_000218_39303_40112 267
348 3300046460 Ga0495638_0000371 Ga0495638_0000371_21607_22413 267
349 3300046460 Ga0495638_0000419 Ga0495638_0000419_5898_6701 267
350 3300046471 Ga0495650_0000007 Ga0495650_0000007_115407_116210 267
351 3300046492 Ga0495585_0108335 Ga0495585_0108335_661_1464 267
352 3300046501 Ga0495607_0057116 Ga0495607_0057116_718_1521 267
353 3300046506 Ga0495583_0000037 Ga0495583_0000037_22295_23101 267
354 3300046507 Ga0495606_0001606 Ga0495606_0001606_4090_4893 267
355 3300046512 Ga0495610_0000040 Ga0495610_0000040_153361_154164 267
356 3300046512 Ga0495610_0005336 Ga0495610_0005336_4721_5530 267
357 3300046513 Ga0495616_0000026 Ga0495616_0000026_17373_18176 267
358 3300046515 Ga0495620_0057708 Ga0495620_0057708_294_1097 267
359 3300046519 Ga0495632_0004056 Ga0495632_0004056_1944_2747 267
360 3300046520 Ga0495637_0007469 Ga0495637_0007469_3832_4635 267
361 3300046520 Ga0495637_0020710 Ga0495637_0020710_727_1545 267
362 3300046522 Ga0495643_0052183 Ga0495643_0052183_824_1627 267
363 3300046522 Ga0495643_0073477 Ga0495643_0073477_691_1494 267
364 3300046524 Ga0495648_0028336 Ga0495648_0028336_2431_3234 267
365 3300046530 Ga0495654_0000095 Ga0495654_0000095_88185_88988 267
366 3300046660 Ga0495625_0000080 Ga0495625_0000080_68960_69763 267
367 3300046660 Ga0495625_0000793 Ga0495625_0000793_39508_40311 267
368 3300046660 Ga0495625_0013830 Ga0495625_0013830_3733_4536 267
369 3300046660 Ga0495625_0047709 Ga0495625_0047709_1460_2263 267
370 3300046660 Ga0495625_0055709 Ga0495625_0055709_1651_2457 267
371 3300046794 Ga0495589_0002410 Ga0495589_0002410_6915_7721 267
372 3300046810 Ga0495660_0032824 Ga0495660_0032824_1435_2238 267
373 3300047320 Ga0495672_0002465 Ga0495672_0002465_4751_5554 267
374 3300047323 Ga0495683_0061416 Ga0495683_0061416_102_905 267
375 3300047469 Ga0495673_0000132 Ga0495673_0000132_82135_82941 267
376 3300047469 Ga0495673_0002250 Ga0495673_0002250_5860_6663 267
377 3300047470 Ga0495681_0138142 Ga0495681_0138142_37_840 267
378 3300047472 Ga0495686_0036090 Ga0495686_0036090_865_1671 267
379 3300047472 Ga0495686_0175757 Ga0495686_0175757_111_917 267
380 3300048910 Ga0496107_0000023 Ga0496107_0000023_31285_32091 267
381 3300048918 Ga0496115_0020713 Ga0496115_0020713_2397_3200 267
382 3300048924 Ga0496121_0017322 Ga0496121_0017322_5740_6546 267
383 3300048924 Ga0496121_0204761 Ga0496121_0204761_127_930 267
384 3300048927 Ga0496124_0260147 Ga0496124_0260147_342_1157 267
385 3300049671 Ga0501238_012940 Ga0501238_012940_165_971 267
386 3300050496 nmdc:mga07m45_148473_c1 nmdc:mga07m45_148473_c1_479_1282 267
387 3300053102 Ga0500554_001029 Ga0500554_001029_2414_3220 267
388 3300053104 Ga0500556_0000178 Ga0500556_0000178_11363_12166 267
389 3300053122 Ga0500608_037435 Ga0500608_037435_793_1599 267
390 3300053123 Ga0500614_009228 Ga0500614_009228_874_1677 267
391 3300053125 Ga0500618_000034 Ga0500618_000034_63242_64048 267
392 3300053134 Ga0500658_0001264 Ga0500658_0001264_423_1226 267
393 3300053136 Ga0500559_0000005 Ga0500559_0000005_62042_62848 267
394 3300053136 Ga0500559_0013487 Ga0500559_0013487_2631_3434 267
395 3300053142 Ga0500577_0000255 Ga0500577_0000255_9200_10009 267
396 3300053730 Ga0500645_001571 Ga0500645_001571_2349_3152 267
397 3300053730 Ga0500645_015092 Ga0500645_015092_1487_2290 267
398 3300053731 Ga0500609_000621 Ga0500609_000621_998_1801 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

56

239

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9566 1 267
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9531 1 267
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9223 5 265
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9195 4 267
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.8915 4 267
ID Description Score Start End Superfamily
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.968 4 267 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9538 4 267 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8925 3 267 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.883 3 267 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8757 4 267 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A3M1PQR0-F1-model_v4 MBL fold metallo-hydrolase 1.003 203 263 GO:0016787
AF-A0A6J4KXZ5-F1-model_v4 Metal-dependent hydrolases of the beta-lactamase superfamily I PhnP protein 0.9977 200 265 GO:0016787
AF-A0A257X0D1-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphodiesterase 0.9974 38 265
AF-A0A527Y641-F1-model_v4 MBL fold metallo-hydrolase 0.9973 197 263 GO:0016787
AF-A0A2V8NGP6-F1-model_v4 MBL fold metallo-hydrolase 0.9968 198 263 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map