F434084

General Info

Members Datasets Scaffolds Average Seq Length
398 248 796 143

Family's Representative Sequence

Representative Sequence 3300035114|Ga0373939_0082969|Ga0373939_0082969_219_725
Length 168
Sequence LRDVYENAGTIRGLRGLSGRGEITMSTFMASQKNAPQSAWHVIDAENQVLGRIATKAALLLQGKHKPTYTPFIDTGDHVVVVNAAKVKLTGRKEDQKIYRQHSGFEGGLREERARLVRARRPEKLVEDAVHGMLPKTKMGEAMYRKLKVYAGPDHPHAAQKPSKLEVA

Samples

Sample ID Description Type Environment
1 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
222 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.23
Metatranscriptomes 4.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 3.52
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 8.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373939_0082969 3300035114 Bacteria 1068
2 Ga0006770J48903_1058479 3300003305 Bacteria 504
3 Ga0058859_11501102 3300004798 Bacteria 579
4 Ga0065704_10199315 3300005289 Unclassified 1153
5 Ga0065715_10042441 3300005293 Bacteria 1294
6 Ga0065707_10296786 3300005295 Bacteria 1013
7 Ga0070658_10095678 3300005327 Bacteria 2452
8 Ga0070676_10127180 3300005328 Bacteria 1607
9 Ga0070690_100164461 3300005330 Bacteria 1523
10 Ga0070670_100132059 3300005331 Bacteria 2157
11 Ga0070670_101338094 3300005331 Bacteria 656
12 Ga0068868_100082346 3300005338 Bacteria 2581
13 Ga0068868_100572588 3300005338 Bacteria 998
14 Ga0068868_102151679 3300005338 Bacteria 531
15 Ga0070687_100208433 3300005343 Bacteria 1189
16 Ga0070668_101308957 3300005347 Bacteria 659
17 Ga0070669_100144105 3300005353 Bacteria 1839
18 Ga0070669_100285283 3300005353 Bacteria 1324
19 Ga0070675_100077322 3300005354 Bacteria 2770
20 Ga0070671_100005643 3300005355 Bacteria 9957
21 Ga0070671_100053795 3300005355 Bacteria 3347
22 Ga0070674_100186256 3300005356 Bacteria 1593
23 Ga0070688_100017737 3300005365 Bacteria 4091
24 Ga0070688_100517213 3300005365 Unclassified 903
25 Ga0070659_100235772 3300005366 Bacteria 1513
26 Ga0070667_100085035 3300005367 Bacteria 2712
27 Ga0070667_100422071 3300005367 Bacteria 1216
28 Ga0070701_10021735 3300005438 Unclassified 3067
29 Ga0070701_10117466 3300005438 Unclassified 1494
30 Ga0070711_100372225 3300005439 Bacteria 1153
31 Ga0070700_100423331 3300005441 Bacteria 1007
32 Ga0070663_101618190 3300005455 Bacteria 578
33 Ga0070678_100271319 3300005456 Bacteria 1431
34 Ga0070678_102136101 3300005456 Unclassified 531
35 Ga0070678_102167488 3300005456 Bacteria 527
36 Ga0070662_100337778 3300005457 Bacteria 1232
37 Ga0068867_100098058 3300005459 Bacteria 2234
38 Ga0068867_100267247 3300005459 Bacteria 1397
39 Ga0070707_100450876 3300005468 Bacteria 1247
40 Ga0070698_100575736 3300005471 Unclassified 1066
41 Ga0070699_100120188 3300005518 Bacteria 2310
42 Ga0068853_100218656 3300005539 Bacteria 1739
43 Ga0070672_100085240 3300005543 Bacteria 2539
44 Ga0070672_100218907 3300005543 Bacteria 1596
45 Ga0070686_100187016 3300005544 Bacteria 1476
46 Ga0070665_100028561 3300005548 Bacteria 5617
47 Ga0070665_100674456 3300005548 Bacteria 1047
48 Ga0070704_100196815 3300005549 Bacteria 1624
49 Ga0070664_100111144 3300005564 Bacteria 2392
50 Ga0070664_101568005 3300005564 Bacteria 623
51 Ga0068854_100392288 3300005578 Unclassified 1146
52 Ga0068859_100131770 3300005617 Bacteria 2572
53 Ga0068859_100613317 3300005617 Bacteria 1181
54 Ga0068859_100953963 3300005617 Bacteria 941
55 Ga0068859_101061439 3300005617 Bacteria 890
56 Ga0068864_100795492 3300005618 Bacteria 929
57 Ga0068866_10195500 3300005718 Bacteria 1205
58 Ga0068863_100083120 3300005841 Bacteria 3034
59 Ga0068863_100208678 3300005841 Bacteria 1880
60 Ga0068863_101417443 3300005841 Bacteria 703
61 Ga0068863_101457494 3300005841 Bacteria 693
62 Ga0068858_100013804 3300005842 Bacteria 7625
63 Ga0068858_100038174 3300005842 Bacteria 4454
64 Ga0068858_100421380 3300005842 Bacteria 1284
65 Ga0068860_100134422 3300005843 Bacteria 2375
66 Ga0068860_100450603 3300005843 Bacteria 1279
67 Ga0068862_100023648 3300005844 Bacteria 5150
68 Ga0081539_10097667 3300005985 Bacteria 1504
69 Ga0081539_10193939 3300005985 Bacteria 943
70 Ga0075367_10265755 3300006178 Bacteria 1077
71 Ga0097621_100017472 3300006237 Bacteria 5447
72 Ga0097621_100471067 3300006237 Unclassified 1134
73 Ga0097621_100567023 3300006237 Bacteria 1035
74 Ga0075370_10374188 3300006353 Unclassified 853
75 Ga0068871_100118008 3300006358 Bacteria 2238
76 Ga0075428_100621011 3300006844 Bacteria 1154
77 Ga0075430_100020604 3300006846 Bacteria 5609
78 Ga0075430_100367712 3300006846 Unclassified 1187
79 Ga0075431_100132597 3300006847 Bacteria 2569
80 Ga0075433_10150848 3300006852 Bacteria 2068
81 Ga0068865_100908541 3300006881 Bacteria 766
82 Ga0075436_101377434 3300006914 Unclassified 534
83 Ga0097620_100131768 3300006931 Bacteria 2572
84 Ga0097620_100613302 3300006931 Bacteria 1181
85 Ga0097620_100953996 3300006931 Bacteria 941
86 Ga0097620_101061447 3300006931 Bacteria 890
87 Ga0111539_10012638 3300009094 Bacteria 10577
88 Ga0111539_10045723 3300009094 Bacteria 5240
89 Ga0111539_10741441 3300009094 Bacteria 1143
90 Ga0105245_10007999 3300009098 Bacteria 9247
91 Ga0105245_10078936 3300009098 Bacteria 3004
92 Ga0105247_10057283 3300009101 Bacteria 2409
93 Ga0114129_10967708 3300009147 Bacteria 1074
94 Ga0105243_10361990 3300009148 Bacteria 1335
95 Ga0105243_11667245 3300009148 Bacteria 666
96 Ga0105242_11295954 3300009176 Bacteria 752
97 Ga0105248_10103124 3300009177 Bacteria 3215
98 Ga0105248_10125137 3300009177 Bacteria 2900
99 Ga0105248_10211421 3300009177 Bacteria 2186
100 Ga0105248_10507421 3300009177 Bacteria 1360
101 Ga0105248_11000014 3300009177 Bacteria 945
102 Ga0105248_11092115 3300009177 Bacteria 902
103 Ga0105248_11377335 3300009177 Bacteria 798
104 Ga0105248_11894881 3300009177 Bacteria 677
105 Ga0105248_12877478 3300009177 Bacteria 549
106 Ga0105238_10245512 3300009551 Bacteria 1768
107 Ga0105238_10682109 3300009551 Bacteria 1039
108 Ga0157369_10037405 3300013105 Bacteria 5313
109 Ga0157369_10224556 3300013105 Bacteria 1965
110 Ga0157374_10639166 3300013296 Unclassified 1075
111 Ga0157374_10891602 3300013296 Bacteria 907
112 Ga0157374_11144778 3300013296 Bacteria 799
113 Ga0157378_10219204 3300013297 Bacteria 1808
114 Ga0157378_10408439 3300013297 Bacteria 1340
115 Ga0163162_10305327 3300013306 Bacteria 1724
116 Ga0163162_10370669 3300013306 Bacteria 1565
117 Ga0163162_10547383 3300013306 Bacteria 1286
118 Ga0163162_10949920 3300013306 Unclassified 971
119 Ga0157372_10435928 3300013307 Bacteria 1527
120 Ga0157372_11157644 3300013307 Unclassified 894
121 Ga0157375_11554769 3300013308 Bacteria 781
122 Ga0157375_11897110 3300013308 Bacteria 707
123 Ga0157375_13463716 3300013308 Unclassified 525
124 Ga0163163_10023102 3300014325 Bacteria 5898
125 Ga0163163_10591674 3300014325 Bacteria 1173
126 Ga0163163_11262341 3300014325 Bacteria 801
127 Ga0163163_11750867 3300014325 Bacteria 682
128 Ga0157380_10130577 3300014326 Unclassified 2142
129 Ga0157380_10193698 3300014326 Bacteria 1797
130 Ga0157379_10067884 3300014968 Bacteria 3188
131 Ga0157379_10127388 3300014968 Bacteria 2291
132 Ga0157376_10170479 3300014969 Bacteria 1982
133 Ga0163161_10084815 3300017792 Bacteria 2336
134 Ga0163161_10282446 3300017792 Unclassified 1302
135 Ga0197907_10872147 3300020069 Bacteria 572
136 Ga0206356_11280206 3300020070 Bacteria 1107
137 Ga0206352_10615995 3300020078 Bacteria 1074
138 Ga0206353_10409752 3300020082 Bacteria 683
139 Ga0207653_10175745 3300025885 Bacteria 799
140 Ga0207682_10022373 3300025893 Bacteria 2490
141 Ga0207642_10288090 3300025899 Bacteria 947
142 Ga0207642_10600679 3300025899 Unclassified 685
143 Ga0207710_10359001 3300025900 Bacteria 743
144 Ga0207680_10081290 3300025903 Bacteria 2037
145 Ga0207680_10237928 3300025903 Bacteria 1254
146 Ga0207647_10143886 3300025904 Bacteria 1396
147 Ga0207699_10028895 3300025906 Bacteria 3087
148 Ga0207699_10284582 3300025906 Unclassified 1150
149 Ga0207643_10251684 3300025908 Unclassified 1088
150 Ga0207705_10224303 3300025909 Bacteria 1428
151 Ga0207684_10198065 3300025910 Bacteria 1732
152 Ga0207663_10159286 3300025916 Bacteria 1591
153 Ga0207662_10001548 3300025918 Bacteria 11228
154 Ga0207662_10315005 3300025918 Unclassified 1043
155 Ga0207662_10321291 3300025918 Bacteria 1033
156 Ga0207646_11091012 3300025922 Bacteria 703
157 Ga0207681_10016170 3300025923 Bacteria 4661
158 Ga0207681_10027115 3300025923 Bacteria 3701
159 Ga0207681_10807180 3300025923 Bacteria 784
160 Ga0207650_10185286 3300025925 Bacteria 1660
161 Ga0207687_10011164 3300025927 Bacteria 5868
162 Ga0207687_10050530 3300025927 Bacteria 2894
163 Ga0207644_10071258 3300025931 Bacteria 2542
164 Ga0207706_10212043 3300025933 Bacteria 1697
165 Ga0207706_10222577 3300025933 Bacteria 1652
166 Ga0207686_10013730 3300025934 Bacteria 4490
167 Ga0207686_10642932 3300025934 Bacteria 839
168 Ga0207670_10107367 3300025936 Bacteria 2004
169 Ga0207670_10597990 3300025936 Bacteria 905
170 Ga0207670_10615941 3300025936 Bacteria 892
171 Ga0207669_10102358 3300025937 Bacteria 1897
172 Ga0207704_10007854 3300025938 Bacteria 5063
173 Ga0207704_10009507 3300025938 Bacteria 4693
174 Ga0207704_10306757 3300025938 Bacteria 1218
175 Ga0207691_10001775 3300025940 Bacteria 21233
176 Ga0207691_10016837 3300025940 Bacteria 6936
177 Ga0207691_10109652 3300025940 Bacteria 2456
178 Ga0207711_10024013 3300025941 Bacteria 5103
179 Ga0207711_10242885 3300025941 Bacteria 1651
180 Ga0207711_10477592 3300025941 Bacteria 1161
181 Ga0207711_10617767 3300025941 Bacteria 1011
182 Ga0207711_11046757 3300025941 Bacteria 756
183 Ga0207689_10353082 3300025942 Bacteria 1222
184 Ga0207679_10204503 3300025945 Bacteria 1652
185 Ga0207679_10359124 3300025945 Bacteria 1272
186 Ga0207651_10071178 3300025960 Bacteria 2464
187 Ga0207651_10320164 3300025960 Bacteria 1296
188 Ga0207712_10021850 3300025961 Bacteria 4206
189 Ga0207668_10029456 3300025972 Bacteria 3598
190 Ga0207658_10042421 3300025986 Bacteria 3300
191 Ga0207658_10643432 3300025986 Unclassified 955
192 Ga0207677_10305053 3300026023 Bacteria 1317
193 Ga0207703_10098028 3300026035 Bacteria 2478
194 Ga0207703_10393730 3300026035 Bacteria 1284
195 Ga0207703_11059870 3300026035 Unclassified 778
196 Ga0207678_10109435 3300026067 Bacteria 2357
197 Ga0207708_10012845 3300026075 Bacteria 6247
198 Ga0207641_10297494 3300026088 Bacteria 1523
199 Ga0207641_10307958 3300026088 Bacteria 1498
200 Ga0207641_10723744 3300026088 Bacteria 981
201 Ga0207641_10893890 3300026088 Bacteria 882
202 Ga0207648_10046317 3300026089 Bacteria 3813
203 Ga0207648_10089214 3300026089 Bacteria 2693
204 Ga0207648_10149334 3300026089 Bacteria 2062
205 Ga0207676_10136694 3300026095 Bacteria 2092
206 Ga0207676_10176922 3300026095 Bacteria 1865
207 Ga0207674_10332818 3300026116 Bacteria 1468
208 Ga0207675_100262427 3300026118 Bacteria 1674
209 Ga0207675_100901932 3300026118 Bacteria 900
210 Ga0207683_10032921 3300026121 Bacteria 4503
211 Ga0207683_10497481 3300026121 Bacteria 1126
212 Ga0207683_11409616 3300026121 Bacteria 644
213 Ga0209967_1022664 3300027364 Bacteria 922
214 Ga0209971_1020327 3300027682 Bacteria 1579
215 Ga0209974_10088291 3300027876 Bacteria 1073
216 Ga0207428_10023208 3300027907 Bacteria 5220
217 Ga0207428_10055767 3300027907 Bacteria 3140
218 Ga0207428_10091908 3300027907 Bacteria 2355
219 Ga0268266_10220064 3300028379 Bacteria 1745
220 Ga0268265_10007329 3300028380 Bacteria 7447
221 Ga0268265_10021740 3300028380 Bacteria 4498
222 Ga0268264_10029034 3300028381 Bacteria 4529
223 Ga0268264_10283445 3300028381 Bacteria 1553
224 Ga0265775_104378 3300030762 Bacteria 793
225 Ga0307408_100396214 3300031548 Bacteria 1184
226 Ga0307408_102052885 3300031548 Bacteria 550
227 Ga0307413_10197071 3300031824 Bacteria 1451
228 Ga0307413_10300446 3300031824 Bacteria 1217
229 Ga0307413_11123802 3300031824 Bacteria 680
230 Ga0307410_10041939 3300031852 Bacteria 3021
231 Ga0307407_10970559 3300031903 Bacteria 655
232 Ga0307412_10430712 3300031911 Bacteria 1081
233 Ga0307412_10718563 3300031911 Bacteria 859
234 Ga0307409_100782247 3300031995 Bacteria 960
235 Ga0307409_102052152 3300031995 Bacteria 601
236 Ga0307416_102192950 3300032002 Bacteria 654
237 Ga0307411_10045582 3300032005 Bacteria 2821
238 Ga0307411_10077721 3300032005 Bacteria 2273
239 Ga0307411_10149203 3300032005 Bacteria 1735
240 Ga0307411_10243967 3300032005 Bacteria 1408
241 Ga0307415_100977302 3300032126 Bacteria 785
242 Ga0373958_0044019 3300034819 Bacteria 922
243 Ga0373958_0086308 3300034819 Bacteria 718
244 Ga0373959_0193891 3300034820 Bacteria 534
245 Ga0373951_0167289 3300035091 Bacteria 625
246 Ga0373923_0183094 3300035111 Bacteria 963
247 Ga0373932_0024254 3300035112 Bacteria 1631
248 Ga0373939_0239444 3300035114 Bacteria 702
249 Ga0373941_0085753 3300035115 Bacteria 1071
250 Ga0373953_0098822 3300035117 Bacteria 1227
251 Ga0373953_0394693 3300035117 Bacteria 609
252 Ga0373956_0085816 3300035119 Bacteria 1448
253 Ga0373956_0298908 3300035119 Bacteria 767
254 Ga0373960_0171810 3300035121 Bacteria 752
255 Ga0373942_0105487 3300035207 Bacteria 866
256 Ga0373961_0014437 3300035241 Bacteria 2006
257 Ga0373962_0032279 3300035242 Bacteria 1440
258 Ga0373931_0191459 3300035691 Bacteria 1217
259 Ga0373935_0429157 3300035692 Bacteria 952
260 Ga0373933_0192627 3300035724 Bacteria 1303
261 Ga0373937_0080785 3300036401 Bacteria 3007
262 Ga0373937_0254888 3300036401 Bacteria 1654
263 Ga0373937_0295728 3300036401 Bacteria 1530
264 Ga0373937_1215674 3300036401 Bacteria 702
265 Ga0395900_0984304 3300037418 Bacteria 764
266 Ga0395905_0651824 3300037471 Bacteria 955
267 Ga0395901_0259495 3300038443 Bacteria 1809
268 Ga0439450_031276 3300042008 Bacteria 1198
269 Ga0439446_0151971 3300042156 Bacteria 762
270 Ga0439444_0007465 3300042437 Bacteria 1680
271 Ga0439464_0018869 3300042439 Bacteria 1879
272 Ga0439460_0170181 3300042461 Bacteria 733
273 Ga0450918_038909 3300042531 Bacteria 851
274 Ga0451577_0013678 3300042876 Bacteria 7585
275 Ga0451577_0189976 3300042876 Bacteria 1853
276 Ga0451577_0325959 3300042876 Bacteria 1393
277 Ga0439440_0231588 3300042993 Bacteria 557
278 Ga0453684_0132153 3300044712 Bacteria 2994
279 Ga0453684_0337097 3300044712 Bacteria 1704
280 Ga0453684_0622736 3300044712 Bacteria 1180
281 Ga0451576_1786825 3300045051 Bacteria 636
282 Ga0466967_1508877 3300045976 Bacteria 669
283 Ga0495592_0033470 3300046454 Bacteria 3876
284 Ga0495629_0449621 3300046459 Bacteria 872
285 Ga0495651_0073290 3300046462 Bacteria 2600
286 Ga0495653_0323443 3300046463 Bacteria 999
287 Ga0495580_0058232 3300046472 Bacteria 2718
288 Ga0495582_0409939 3300046473 Bacteria 782
289 Ga0495608_0004917 3300046511 Bacteria 9573
290 Ga0495608_0191837 3300046511 Bacteria 1290
291 Ga0495618_0126406 3300046514 Bacteria 1637
292 Ga0495628_0029181 3300046516 Bacteria 4475
293 Ga0495630_0036176 3300046517 Bacteria 3691
294 Ga0495630_0214579 3300046517 Bacteria 1469
295 Ga0495630_1110918 3300046517 Bacteria 599
296 Ga0495642_0199287 3300046528 Bacteria 873
297 Ga0495652_0429376 3300046529 Bacteria 929
298 Ga0495652_0467598 3300046529 Bacteria 880
299 Ga0495665_0026207 3300046531 Bacteria 3132
300 Ga0495586_0084433 3300046535 Bacteria 1748
301 Ga0495587_0011763 3300046536 Bacteria 5534
302 Ga0495621_0128222 3300046539 Bacteria 985
303 Ga0495645_0088172 3300046543 Bacteria 2219
304 Ga0495645_0883253 3300046543 Bacteria 532
305 Ga0495633_0191689 3300046558 Bacteria 940
306 Ga0495667_0099155 3300046559 Bacteria 1886
307 Ga0495667_0762521 3300046559 Bacteria 598
308 Ga0495656_0320853 3300046615 Bacteria 798
309 Ga0495634_0067792 3300046642 Bacteria 2359
310 Ga0495634_0285680 3300046642 Bacteria 1001
311 Ga0495659_0060053 3300046664 Bacteria 1402
312 Ga0495657_0036170 3300046675 Bacteria 3415
313 Ga0495658_0014928 3300046683 Bacteria 3979
314 Ga0495658_0373839 3300046683 Bacteria 907
315 Ga0495613_0004775 3300046689 Bacteria 10170
316 Ga0495613_0012840 3300046689 Bacteria 6227
317 Ga0495600_0304292 3300046809 Bacteria 1005
318 Ga0495604_0045142 3300047317 Bacteria 3440
319 Ga0495674_0166038 3300047319 Bacteria 1844
320 Ga0495674_0227072 3300047319 Bacteria 1542
321 Ga0495675_0280104 3300047444 Unclassified 994
322 Ga0495675_0502296 3300047444 Bacteria 696
323 Ga0495684_0000698 3300047471 Bacteria 26972
324 Ga0495684_0007325 3300047471 Bacteria 8547
325 Ga0495684_0081065 3300047471 Bacteria 2463
326 Ga0495686_0184531 3300047472 Bacteria 1207
327 Ga0495602_0693432 3300048088 Unclassified 692
328 Ga0496104_0410085 3300048907 Unclassified 1267
329 Ga0496104_0673133 3300048907 Bacteria 943
330 Ga0496105_0156522 3300048908 Bacteria 1871
331 Ga0496105_0797790 3300048908 Bacteria 718
332 Ga0496106_0372863 3300048909 Bacteria 1147
333 Ga0496106_1120024 3300048909 Unclassified 616
334 Ga0496106_1510232 3300048909 Bacteria 517
335 Ga0496109_1087542 3300048912 Bacteria 737
336 Ga0496112_1322591 3300048915 Bacteria 636
337 Ga0496114_0767231 3300048917 Bacteria 842
338 Ga0496114_0833475 3300048917 Bacteria 802
339 Ga0496114_1040021 3300048917 Bacteria 703
340 Ga0496115_0382606 3300048918 Bacteria 1144
341 Ga0496115_1207371 3300048918 Unclassified 568
342 Ga0501305_008421 3300049161 Bacteria 1334
343 Ga0501305_081973 3300049161 Bacteria 581
344 Ga0501307_053790 3300049162 Bacteria 611
345 Ga0501317_007670 3300049533 Bacteria 1224
346 Ga0501318_036729 3300049534 Bacteria 687
347 Ga0501325_026414 3300049541 Bacteria 642
348 Ga0501032_0152827 3300049569 Bacteria 1517
349 Ga0501034_0012364 3300049571 Bacteria 8819
350 Ga0501040_0046558 3300049576 Bacteria 2961
351 Ga0501047_0016644 3300049581 Bacteria 7021
352 Ga0501070_0053907 3300049586 Bacteria 3335
353 Ga0501072_0304115 3300049588 Bacteria 1268
354 Ga0501074_0224366 3300049590 Bacteria 1338
355 Ga0501075_0372382 3300049591 Bacteria 1089
356 Ga0501076_0752777 3300049592 Bacteria 804
357 Ga0501077_0719441 3300049593 Bacteria 642
358 Ga0501249_081524 3300049679 Bacteria 762
359 Ga0501261_079343 3300049690 Bacteria 591
360 Ga0501080_0008450 3300049742 Bacteria 9328
361 Ga0501083_0234392 3300049744 Bacteria 1195
362 Ga0501044_0002813 3300049823 Bacteria 19828
363 Ga0501044_0153565 3300049823 Bacteria 2283
364 Ga0501212_068606 3300049851 Bacteria 624
365 nmdc:mga06z11_185961_c1 3300050494 Unclassified 1200
366 nmdc:mga06z11_775872_c1 3300050494 Bacteria 584
367 nmdc:mga07m45_108910_c2 3300050496 Unclassified 1265
368 nmdc:mga05p37_1251329_c1 3300050507 Bacteria 761
369 nmdc:mga09592_64885_c1 3300050508 Bacteria 3092
370 nmdc:mga0qj67_537207_c1 3300050509 Unclassified 938
371 nmdc:mga0qj67_722201_c1 3300050509 Bacteria 792
372 nmdc:mga08y16_151114_c1 3300050511 Bacteria 2414
373 nmdc:mga08y16_1541751_c1 3300050511 Bacteria 624
374 nmdc:mga08y16_2638_c1 3300050511 Bacteria 18432
375 nmdc:mga08y16_373436_c1 3300050511 Bacteria 1463
376 nmdc:mga08y16_9481_c1 3300050511 Bacteria 10218
377 nmdc:mga0n895_11531_c1 3300050512 Bacteria 7892
378 nmdc:mga0n895_472635_c1 3300050512 Bacteria 1265
379 nmdc:mga0rr50_77904_c1 3300050513 Bacteria 2549
380 nmdc:mga08x19_724086_c1 3300050514 Unclassified 706
381 nmdc:mga0a205_27385_c1 3300050515 Bacteria 4968
382 nmdc:mga0a205_3512_c1 3300050515 Bacteria 14003
383 nmdc:mga0a205_98442_c1 3300050515 Bacteria 2823
384 Ga0495601_0017272 3300053077 Bacteria 4378
385 Ga0495601_0044413 3300053077 Bacteria 2793
386 Ga0495595_0132469 3300053084 Bacteria 1219
387 Ga0495595_0222725 3300053084 Unclassified 941
388 Ga0495619_0053335 3300053085 Bacteria 2675
389 Ga0495619_0093220 3300053085 Bacteria 2041
390 Ga0501084_0682364 3300054114 Bacteria 867
391 Ga0587070_213923 3300059491 Bacteria 519
392 Ga0587106_131069 3300059605 Bacteria 541
393 Ga0587128_031562 3300059630 Bacteria 881
394 Ga0587075_125024 3300059644 Bacteria 536
395 Ga0587071_096692 3300060344 Bacteria 678
396 Ga0587111_0240705 3300060346 Unclassified 531
397 Ga0501082_0179687 3300060353 Bacteria 1840
398 Ga0530510_0616230 3300061734 Bacteria 826
399 Ga0373939_0082969
400 Ga0006770J48903_1058479
401 Ga0058859_11501102
402 Ga0065704_10199315
403 Ga0065715_10042441
404 Ga0065707_10296786
405 Ga0070658_10095678
406 Ga0070676_10127180
407 Ga0070690_100164461
408 Ga0070670_100132059
409 Ga0070670_101338094
410 Ga0068868_100082346
411 Ga0068868_100572588
412 Ga0068868_102151679
413 Ga0070687_100208433
414 Ga0070668_101308957
415 Ga0070669_100144105
416 Ga0070669_100285283
417 Ga0070675_100077322
418 Ga0070671_100005643
419 Ga0070671_100053795
420 Ga0070674_100186256
421 Ga0070688_100017737
422 Ga0070688_100517213
423 Ga0070659_100235772
424 Ga0070667_100085035
425 Ga0070667_100422071
426 Ga0070701_10021735
427 Ga0070701_10117466
428 Ga0070711_100372225
429 Ga0070700_100423331
430 Ga0070663_101618190
431 Ga0070678_100271319
432 Ga0070678_102136101
433 Ga0070678_102167488
434 Ga0070662_100337778
435 Ga0068867_100098058
436 Ga0068867_100267247
437 Ga0070707_100450876
438 Ga0070698_100575736
439 Ga0070699_100120188
440 Ga0068853_100218656
441 Ga0070672_100085240
442 Ga0070672_100218907
443 Ga0070686_100187016
444 Ga0070665_100028561
445 Ga0070665_100674456
446 Ga0070704_100196815
447 Ga0070664_100111144
448 Ga0070664_101568005
449 Ga0068854_100392288
450 Ga0068859_100131770
451 Ga0068859_100613317
452 Ga0068859_100953963
453 Ga0068859_101061439
454 Ga0068864_100795492
455 Ga0068866_10195500
456 Ga0068863_100083120
457 Ga0068863_100208678
458 Ga0068863_101417443
459 Ga0068863_101457494
460 Ga0068858_100013804
461 Ga0068858_100038174
462 Ga0068858_100421380
463 Ga0068860_100134422
464 Ga0068860_100450603
465 Ga0068862_100023648
466 Ga0081539_10097667
467 Ga0081539_10193939
468 Ga0075367_10265755
469 Ga0097621_100017472
470 Ga0097621_100471067
471 Ga0097621_100567023
472 Ga0075370_10374188
473 Ga0068871_100118008
474 Ga0075428_100621011
475 Ga0075430_100020604
476 Ga0075430_100367712
477 Ga0075431_100132597
478 Ga0075433_10150848
479 Ga0068865_100908541
480 Ga0075436_101377434
481 Ga0097620_100131768
482 Ga0097620_100613302
483 Ga0097620_100953996
484 Ga0097620_101061447
485 Ga0111539_10012638
486 Ga0111539_10045723
487 Ga0111539_10741441
488 Ga0105245_10007999
489 Ga0105245_10078936
490 Ga0105247_10057283
491 Ga0114129_10967708
492 Ga0105243_10361990
493 Ga0105243_11667245
494 Ga0105242_11295954
495 Ga0105248_10103124
496 Ga0105248_10125137
497 Ga0105248_10211421
498 Ga0105248_10507421
499 Ga0105248_11000014
500 Ga0105248_11092115
501 Ga0105248_11377335
502 Ga0105248_11894881
503 Ga0105248_12877478
504 Ga0105238_10245512
505 Ga0105238_10682109
506 Ga0157369_10037405
507 Ga0157369_10224556
508 Ga0157374_10639166
509 Ga0157374_10891602
510 Ga0157374_11144778
511 Ga0157378_10219204
512 Ga0157378_10408439
513 Ga0163162_10305327
514 Ga0163162_10370669
515 Ga0163162_10547383
516 Ga0163162_10949920
517 Ga0157372_10435928
518 Ga0157372_11157644
519 Ga0157375_11554769
520 Ga0157375_11897110
521 Ga0157375_13463716
522 Ga0163163_10023102
523 Ga0163163_10591674
524 Ga0163163_11262341
525 Ga0163163_11750867
526 Ga0157380_10130577
527 Ga0157380_10193698
528 Ga0157379_10067884
529 Ga0157379_10127388
530 Ga0157376_10170479
531 Ga0163161_10084815
532 Ga0163161_10282446
533 Ga0197907_10872147
534 Ga0206356_11280206
535 Ga0206352_10615995
536 Ga0206353_10409752
537 Ga0207653_10175745
538 Ga0207682_10022373
539 Ga0207642_10288090
540 Ga0207642_10600679
541 Ga0207710_10359001
542 Ga0207680_10081290
543 Ga0207680_10237928
544 Ga0207647_10143886
545 Ga0207699_10028895
546 Ga0207699_10284582
547 Ga0207643_10251684
548 Ga0207705_10224303
549 Ga0207684_10198065
550 Ga0207663_10159286
551 Ga0207662_10001548
552 Ga0207662_10315005
553 Ga0207662_10321291
554 Ga0207646_11091012
555 Ga0207681_10016170
556 Ga0207681_10027115
557 Ga0207681_10807180
558 Ga0207650_10185286
559 Ga0207687_10011164
560 Ga0207687_10050530
561 Ga0207644_10071258
562 Ga0207706_10212043
563 Ga0207706_10222577
564 Ga0207686_10013730
565 Ga0207686_10642932
566 Ga0207670_10107367
567 Ga0207670_10597990
568 Ga0207670_10615941
569 Ga0207669_10102358
570 Ga0207704_10007854
571 Ga0207704_10009507
572 Ga0207704_10306757
573 Ga0207691_10001775
574 Ga0207691_10016837
575 Ga0207691_10109652
576 Ga0207711_10024013
577 Ga0207711_10242885
578 Ga0207711_10477592
579 Ga0207711_10617767
580 Ga0207711_11046757
581 Ga0207689_10353082
582 Ga0207679_10204503
583 Ga0207679_10359124
584 Ga0207651_10071178
585 Ga0207651_10320164
586 Ga0207712_10021850
587 Ga0207668_10029456
588 Ga0207658_10042421
589 Ga0207658_10643432
590 Ga0207677_10305053
591 Ga0207703_10098028
592 Ga0207703_10393730
593 Ga0207703_11059870
594 Ga0207678_10109435
595 Ga0207708_10012845
596 Ga0207641_10297494
597 Ga0207641_10307958
598 Ga0207641_10723744
599 Ga0207641_10893890
600 Ga0207648_10046317
601 Ga0207648_10089214
602 Ga0207648_10149334
603 Ga0207676_10136694
604 Ga0207676_10176922
605 Ga0207674_10332818
606 Ga0207675_100262427
607 Ga0207675_100901932
608 Ga0207683_10032921
609 Ga0207683_10497481
610 Ga0207683_11409616
611 Ga0209967_1022664
612 Ga0209971_1020327
613 Ga0209974_10088291
614 Ga0207428_10023208
615 Ga0207428_10055767
616 Ga0207428_10091908
617 Ga0268266_10220064
618 Ga0268265_10007329
619 Ga0268265_10021740
620 Ga0268264_10029034
621 Ga0268264_10283445
622 Ga0265775_104378
623 Ga0307408_100396214
624 Ga0307408_102052885
625 Ga0307413_10197071
626 Ga0307413_10300446
627 Ga0307413_11123802
628 Ga0307410_10041939
629 Ga0307407_10970559
630 Ga0307412_10430712
631 Ga0307412_10718563
632 Ga0307409_100782247
633 Ga0307409_102052152
634 Ga0307416_102192950
635 Ga0307411_10045582
636 Ga0307411_10077721
637 Ga0307411_10149203
638 Ga0307411_10243967
639 Ga0307415_100977302
640 Ga0373958_0044019
641 Ga0373958_0086308
642 Ga0373959_0193891
643 Ga0373951_0167289
644 Ga0373923_0183094
645 Ga0373932_0024254
646 Ga0373939_0239444
647 Ga0373941_0085753
648 Ga0373953_0098822
649 Ga0373953_0394693
650 Ga0373956_0085816
651 Ga0373956_0298908
652 Ga0373960_0171810
653 Ga0373942_0105487
654 Ga0373961_0014437
655 Ga0373962_0032279
656 Ga0373931_0191459
657 Ga0373935_0429157
658 Ga0373933_0192627
659 Ga0373937_0080785
660 Ga0373937_0254888
661 Ga0373937_0295728
662 Ga0373937_1215674
663 Ga0395900_0984304
664 Ga0395905_0651824
665 Ga0395901_0259495
666 Ga0439450_031276
667 Ga0439446_0151971
668 Ga0439444_0007465
669 Ga0439464_0018869
670 Ga0439460_0170181
671 Ga0450918_038909
672 Ga0451577_0013678
673 Ga0451577_0189976
674 Ga0451577_0325959
675 Ga0439440_0231588
676 Ga0453684_0132153
677 Ga0453684_0337097
678 Ga0453684_0622736
679 Ga0451576_1786825
680 Ga0466967_1508877
681 Ga0495592_0033470
682 Ga0495629_0449621
683 Ga0495651_0073290
684 Ga0495653_0323443
685 Ga0495580_0058232
686 Ga0495582_0409939
687 Ga0495608_0004917
688 Ga0495608_0191837
689 Ga0495618_0126406
690 Ga0495628_0029181
691 Ga0495630_0036176
692 Ga0495630_0214579
693 Ga0495630_1110918
694 Ga0495642_0199287
695 Ga0495652_0429376
696 Ga0495652_0467598
697 Ga0495665_0026207
698 Ga0495586_0084433
699 Ga0495587_0011763
700 Ga0495621_0128222
701 Ga0495645_0088172
702 Ga0495645_0883253
703 Ga0495633_0191689
704 Ga0495667_0099155
705 Ga0495667_0762521
706 Ga0495656_0320853
707 Ga0495634_0067792
708 Ga0495634_0285680
709 Ga0495659_0060053
710 Ga0495657_0036170
711 Ga0495658_0014928
712 Ga0495658_0373839
713 Ga0495613_0004775
714 Ga0495613_0012840
715 Ga0495600_0304292
716 Ga0495604_0045142
717 Ga0495674_0166038
718 Ga0495674_0227072
719 Ga0495675_0280104
720 Ga0495675_0502296
721 Ga0495684_0000698
722 Ga0495684_0007325
723 Ga0495684_0081065
724 Ga0495686_0184531
725 Ga0495602_0693432
726 Ga0496104_0410085
727 Ga0496104_0673133
728 Ga0496105_0156522
729 Ga0496105_0797790
730 Ga0496106_0372863
731 Ga0496106_1120024
732 Ga0496106_1510232
733 Ga0496109_1087542
734 Ga0496112_1322591
735 Ga0496114_0767231
736 Ga0496114_0833475
737 Ga0496114_1040021
738 Ga0496115_0382606
739 Ga0496115_1207371
740 Ga0501305_008421
741 Ga0501305_081973
742 Ga0501307_053790
743 Ga0501317_007670
744 Ga0501318_036729
745 Ga0501325_026414
746 Ga0501032_0152827
747 Ga0501034_0012364
748 Ga0501040_0046558
749 Ga0501047_0016644
750 Ga0501070_0053907
751 Ga0501072_0304115
752 Ga0501074_0224366
753 Ga0501075_0372382
754 Ga0501076_0752777
755 Ga0501077_0719441
756 Ga0501249_081524
757 Ga0501261_079343
758 Ga0501080_0008450
759 Ga0501083_0234392
760 Ga0501044_0002813
761 Ga0501044_0153565
762 Ga0501212_068606
763 nmdc:mga06z11_185961_c1
764 nmdc:mga06z11_775872_c1
765 nmdc:mga07m45_108910_c2
766 nmdc:mga05p37_1251329_c1
767 nmdc:mga09592_64885_c1
768 nmdc:mga0qj67_537207_c1
769 nmdc:mga0qj67_722201_c1
770 nmdc:mga08y16_151114_c1
771 nmdc:mga08y16_1541751_c1
772 nmdc:mga08y16_2638_c1
773 nmdc:mga08y16_373436_c1
774 nmdc:mga08y16_9481_c1
775 nmdc:mga0n895_11531_c1
776 nmdc:mga0n895_472635_c1
777 nmdc:mga0rr50_77904_c1
778 nmdc:mga08x19_724086_c1
779 nmdc:mga0a205_27385_c1
780 nmdc:mga0a205_3512_c1
781 nmdc:mga0a205_98442_c1
782 Ga0495601_0017272
783 Ga0495601_0044413
784 Ga0495595_0132469
785 Ga0495595_0222725
786 Ga0495619_0053335
787 Ga0495619_0093220
788 Ga0501084_0682364
789 Ga0587070_213923
790 Ga0587106_131069
791 Ga0587128_031562
792 Ga0587075_125024
793 Ga0587071_096692
794 Ga0587111_0240705
795 Ga0501082_0179687
796 Ga0530510_0616230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

38

156

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9397 13 142
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9241 1 142
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9179 1 142
8cvm-assembly1.cif.gz_i cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9152 3 142
8fn2-assembly1.cif.gz_L the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9147 3 140
ID Description Score Start End Superfamily
af_Q554U7_3_170_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9379 6 135 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9247 5 140 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9213 1 142 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.915 1 142 3.90.1180.10
af_Q4CZX3_36_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.914 12 140 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A7J6ZN07-F1-model_v4 deleted 0.9676 13 140
AF-A0A7C2MTF9-F1-model_v4 50S ribosomal protein L13 0.9621 13 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A3B4X4E0-F1-model_v4 50S ribosomal protein L13 0.9603 11 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1F6LAI9-F1-model_v4 Large ribosomal subunit protein uL13 0.96 13 141 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-Q83GU7-F1-model_v4 Large ribosomal subunit protein uL13 0.9578 11 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Map