F434053

General Info

Members Datasets Scaffolds Average Seq Length
398 234 796 145

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10007796|Ga0207699_100077962
Length 174
Sequence MEIGSVPSVPGFTFVLHHEQPVKWEIPVYMNVQEQIKEYIASQPEPKRSNMQELHRLTLQVLPGCKLWFHDGKDSKGHTVSNPNIGYGSHTIRYASGKTREFYQIGMSANTTGISVYILGLKDKTYLAKTYRKKLGKASVTGYCIKFKTLKDINIDVLEGAIRHGFEASSKTVS

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 0
Rhizoplane 1.51
Rhizosphere 90.7
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10007796 3300025906 Bacteria 5246
2 JGI25157J39369_1000870 3300002741 Bacteria 14626
3 JGI25406J46586_10003469 3300003203 Bacteria 7412
4 rootL2_10014031 3300003322 Bacteria 7760
5 JGI25405J52794_10022187 3300003911 Bacteria 1287
6 Ga0065714_10071504 3300005288 Bacteria 3556
7 Ga0065714_10092403 3300005288 Bacteria 1878
8 Ga0065704_10511686 3300005289 Bacteria 612
9 Ga0065712_10007470 3300005290 Bacteria 3089
10 Ga0065712_10145195 3300005290 Unclassified 1415
11 Ga0065712_10396412 3300005290 Bacteria 736
12 Ga0065715_10076199 3300005293 Bacteria 595
13 Ga0065715_10123969 3300005293 Bacteria 2154
14 Ga0070683_100284881 3300005329 Bacteria 1572
15 Ga0070683_100734894 3300005329 Bacteria 945
16 Ga0070690_100031003 3300005330 Bacteria 3327
17 Ga0070690_100142351 3300005330 Bacteria 1629
18 Ga0070690_100249006 3300005330 Bacteria 1256
19 Ga0070677_10195924 3300005333 Bacteria 972
20 Ga0068869_100609992 3300005334 Bacteria 923
21 Ga0070666_10053260 3300005335 Bacteria 2729
22 Ga0070680_100378126 3300005336 Bacteria 1206
23 Ga0070680_100988228 3300005336 Bacteria 727
24 Ga0070682_100475382 3300005337 Bacteria 963
25 Ga0068868_100412909 3300005338 Bacteria 1167
26 Ga0070660_100351470 3300005339 Bacteria 1214
27 Ga0070689_100202222 3300005340 Bacteria 1622
28 Ga0070689_100289176 3300005340 Bacteria 1361
29 Ga0070689_101710379 3300005340 Bacteria 572
30 Ga0070661_100001575 3300005344 Bacteria 15817
31 Ga0070668_100215886 3300005347 Bacteria 1580
32 Ga0070669_100278803 3300005353 Bacteria 1339
33 Ga0070675_100027986 3300005354 Bacteria 4532
34 Ga0070675_100185352 3300005354 Bacteria 1801
35 Ga0070675_100264364 3300005354 Bacteria 1508
36 Ga0070673_100079681 3300005364 Bacteria 2652
37 Ga0070673_100816646 3300005364 Bacteria 862
38 Ga0070673_101067731 3300005364 Bacteria 754
39 Ga0070673_101070441 3300005364 Bacteria 753
40 Ga0070688_100036385 3300005365 Bacteria 2994
41 Ga0070688_100138252 3300005365 Bacteria 1652
42 Ga0070688_100797098 3300005365 Bacteria 738
43 Ga0070659_101051070 3300005366 Bacteria 716
44 Ga0070667_100044210 3300005367 Bacteria 3739
45 Ga0070667_100117111 3300005367 Bacteria 2314
46 Ga0070667_100200409 3300005367 Bacteria 1771
47 Ga0070667_100204519 3300005367 Bacteria 1753
48 Ga0070667_100410363 3300005367 Bacteria 1234
49 Ga0070709_10013523 3300005434 Bacteria 4592
50 Ga0070709_10235279 3300005434 Bacteria 1313
51 Ga0070714_100448146 3300005435 Bacteria 1226
52 Ga0070701_10085013 3300005438 Bacteria 1722
53 Ga0070705_100877394 3300005440 Bacteria 720
54 Ga0070678_101330320 3300005456 Bacteria 669
55 Ga0070662_100001104 3300005457 Bacteria 16452
56 Ga0070662_100061435 3300005457 Bacteria 2743
57 Ga0070681_10247459 3300005458 Bacteria 1696
58 Ga0068867_100043892 3300005459 Bacteria 3273
59 Ga0068867_100231219 3300005459 Bacteria 1495
60 Ga0070685_10005193 3300005466 Bacteria 6601
61 Ga0070685_10033538 3300005466 Bacteria 2886
62 Ga0070685_10358074 3300005466 Bacteria 999
63 Ga0070685_10448084 3300005466 Bacteria 904
64 Ga0070685_10936539 3300005466 Bacteria 647
65 Ga0070706_101449445 3300005467 Bacteria 628
66 Ga0070698_100000061 3300005471 Bacteria 78637
67 Ga0070698_100003096 3300005471 Bacteria 18338
68 Ga0070684_100021664 3300005535 Bacteria 5353
69 Ga0068853_100001770 3300005539 Bacteria 15876
70 Ga0068853_100045747 3300005539 Bacteria 3750
71 Ga0068853_100488905 3300005539 Bacteria 1161
72 Ga0068853_100876221 3300005539 Bacteria 862
73 Ga0070672_100120680 3300005543 Bacteria 2145
74 Ga0070672_100223460 3300005543 Bacteria 1580
75 Ga0070672_100270464 3300005543 Bacteria 1435
76 Ga0070672_100405153 3300005543 Bacteria 1169
77 Ga0070686_100009483 3300005544 Bacteria 5473
78 Ga0070695_100514760 3300005545 Bacteria 927
79 Ga0070693_100094283 3300005547 Bacteria 1811
80 Ga0070693_100182343 3300005547 Bacteria 1352
81 Ga0070665_100489538 3300005548 Bacteria 1241
82 Ga0070704_100182066 3300005549 Bacteria 1681
83 Ga0070704_101185231 3300005549 Bacteria 696
84 Ga0068855_100110197 3300005563 Bacteria 3160
85 Ga0068855_100571388 3300005563 Bacteria 1222
86 Ga0070664_100204154 3300005564 Bacteria 1764
87 Ga0068857_100049348 3300005577 Bacteria 3734
88 Ga0068854_100097800 3300005578 Bacteria 2195
89 Ga0068854_101233593 3300005578 Bacteria 671
90 Ga0068856_100011656 3300005614 Bacteria 8528
91 Ga0068856_100083934 3300005614 Bacteria 3164
92 Ga0068856_100918966 3300005614 Bacteria 894
93 Ga0068852_100074222 3300005616 Bacteria 2995
94 Ga0068852_100171397 3300005616 Bacteria 2035
95 Ga0068852_100486698 3300005616 Bacteria 1227
96 Ga0068859_100103841 3300005617 Bacteria 2900
97 Ga0068859_100941143 3300005617 Bacteria 948
98 Ga0068864_100073460 3300005618 Unclassified 2982
99 Ga0068864_100096861 3300005618 Bacteria 2611
100 Ga0068864_100320150 3300005618 Bacteria 1456
101 Ga0068864_100614936 3300005618 Bacteria 1055
102 Ga0068866_10188136 3300005718 Bacteria 1225
103 Ga0068861_100964673 3300005719 Bacteria 812
104 Ga0068870_10178881 3300005840 Bacteria 1272
105 Ga0068863_100041998 3300005841 Unclassified 4346
106 Ga0068863_100102124 3300005841 Bacteria 2726
107 Ga0068863_100176002 3300005841 Bacteria 2054
108 Ga0068863_101429110 3300005841 Bacteria 700
109 Ga0068858_100688736 3300005842 Bacteria 994
110 Ga0068858_100747767 3300005842 Bacteria 953
111 Ga0068860_100009610 3300005843 Bacteria 9610
112 Ga0068860_101078359 3300005843 Bacteria 822
113 Ga0068860_101513815 3300005843 Bacteria 693
114 Ga0068862_100168486 3300005844 Bacteria 1959
115 Ga0068862_100236643 3300005844 Bacteria 1658
116 Ga0068862_100571400 3300005844 Bacteria 1082
117 Ga0068862_100778795 3300005844 Bacteria 933
118 Ga0081455_10090268 3300005937 Bacteria 2485
119 Ga0081540_1116297 3300005983 Bacteria 1119
120 Ga0081539_10000345 3300005985 Bacteria 102083
121 Ga0070717_11048258 3300006028 Bacteria 743
122 Ga0075365_10043076 3300006038 Bacteria 2954
123 Ga0075364_10005700 3300006051 Bacteria 7263
124 Ga0075366_10001232 3300006195 Bacteria 12699
125 Ga0075366_10099807 3300006195 Bacteria 1742
126 Ga0097621_100006899 3300006237 Bacteria 8081
127 Ga0097621_100141137 3300006237 Bacteria 2058
128 Ga0097621_100682396 3300006237 Bacteria 944
129 Ga0068871_100037551 3300006358 Bacteria 3864
130 Ga0068871_100136536 3300006358 Bacteria 2083
131 Ga0068871_100252427 3300006358 Bacteria 1536
132 Ga0068871_100347499 3300006358 Bacteria 1311
133 Ga0068871_100394385 3300006358 Bacteria 1232
134 Ga0075428_100090426 3300006844 Bacteria 3339
135 Ga0075428_100876751 3300006844 Bacteria 952
136 Ga0075430_100006345 3300006846 Bacteria 9974
137 Ga0075431_100105332 3300006847 Bacteria 2910
138 Ga0075431_100528399 3300006847 Bacteria 1168
139 Ga0075433_10068011 3300006852 Bacteria 3126
140 Ga0075434_100717691 3300006871 Bacteria 1017
141 Ga0075429_100010254 3300006880 Bacteria 8110
142 Ga0075429_100328773 3300006880 Bacteria 1338
143 Ga0068865_100016915 3300006881 Bacteria 4679
144 Ga0068865_100105410 3300006881 Bacteria 2071
145 Ga0068865_100164549 3300006881 Bacteria 1695
146 Ga0097620_100103839 3300006931 Bacteria 2900
147 Ga0097620_100941183 3300006931 Bacteria 948
148 Ga0105240_10006255 3300009093 Bacteria 17514
149 Ga0105240_10055504 3300009093 Unclassified 4959
150 Ga0105240_10772102 3300009093 Unclassified 1043
151 Ga0111539_10482628 3300009094 Bacteria 1444
152 Ga0105245_10679598 3300009098 Bacteria 1061
153 Ga0105247_10275285 3300009101 Bacteria 1159
154 Ga0105247_10980314 3300009101 Bacteria 659
155 Ga0105243_10463231 3300009148 Bacteria 1192
156 Ga0105241_11483066 3300009174 Bacteria 652
157 Ga0105242_10066940 3300009176 Bacteria 2968
158 Ga0105242_10232512 3300009176 Bacteria 1653
159 Ga0105242_11401046 3300009176 Bacteria 726
160 Ga0105237_10003970 3300009545 Bacteria 17302
161 Ga0105238_11703809 3300009551 Bacteria 661
162 Ga0105249_10024400 3300009553 Bacteria 5434
163 Ga0105249_10029039 3300009553 Bacteria 4994
164 Ga0105249_10089376 3300009553 Bacteria 2879
165 Ga0105249_10808876 3300009553 Bacteria 1001
166 Ga0105249_11544834 3300009553 Bacteria 736
167 Ga0105249_11877640 3300009553 Bacteria 672
168 Ga0105239_10000142 3300010375 Bacteria 101628
169 Ga0105239_10246983 3300010375 Bacteria 2004
170 Ga0105239_10286441 3300010375 Bacteria 1855
171 Ga0105246_10211885 3300011119 Bacteria 1513
172 Ga0157321_1005899 3300012487 Unclassified 818
173 Ga0157373_10079301 3300013100 Bacteria 2316
174 Ga0157373_10111261 3300013100 Bacteria 1925
175 Ga0157371_10633433 3300013102 Bacteria 797
176 Ga0157369_11296461 3300013105 Bacteria 742
177 Ga0157374_10112517 3300013296 Bacteria 2619
178 Ga0157374_10276895 3300013296 Bacteria 1656
179 Ga0157374_10505396 3300013296 Bacteria 1213
180 Ga0157374_10715696 3300013296 Bacteria 1015
181 Ga0157378_10005675 3300013297 Bacteria 10919
182 Ga0157378_10044490 3300013297 Bacteria 3943
183 Ga0157378_10327423 3300013297 Bacteria 1490
184 Ga0157378_10441024 3300013297 Bacteria 1291
185 Ga0157378_11400606 3300013297 Bacteria 742
186 Ga0163162_10057844 3300013306 Bacteria 3905
187 Ga0163162_10102589 3300013306 Bacteria 2954
188 Ga0163162_10137676 3300013306 Bacteria 2553
189 Ga0163162_10603117 3300013306 Bacteria 1224
190 Ga0157372_10020339 3300013307 Bacteria 7160
191 Ga0157372_10298717 3300013307 Bacteria 1873
192 Ga0157372_10372072 3300013307 Bacteria 1665
193 Ga0157372_11539273 3300013307 Bacteria 766
194 Ga0157375_10001560 3300013308 Bacteria 19726
195 Ga0157375_10002645 3300013308 Bacteria 15517
196 Ga0157375_10005935 3300013308 Bacteria 10644
197 Ga0157375_10112012 3300013308 Bacteria 2828
198 Ga0157375_10157998 3300013308 Bacteria 2407
199 Ga0157375_10661456 3300013308 Bacteria 1200
200 Ga0157375_11410810 3300013308 Bacteria 821
201 Ga0157375_11520796 3300013308 Bacteria 790
202 Ga0157375_12215856 3300013308 Bacteria 655
203 Ga0157375_12543315 3300013308 Bacteria 611
204 Ga0163163_11303986 3300014325 Bacteria 788
205 Ga0163163_11488025 3300014325 Bacteria 738
206 Ga0157380_10094623 3300014326 Bacteria 2473
207 Ga0157380_10199833 3300014326 Bacteria 1773
208 Ga0157380_10451825 3300014326 Bacteria 1234
209 Ga0157377_10086610 3300014745 Bacteria 1841
210 Ga0157379_10080137 3300014968 Bacteria 2925
211 Ga0157376_10421317 3300014969 Bacteria 1296
212 Ga0157376_10451864 3300014969 Bacteria 1253
213 Ga0157376_10538146 3300014969 Bacteria 1154
214 Ga0163161_10040981 3300017792 Bacteria 3327
215 Ga0163161_10266362 3300017792 Bacteria 1339
216 Ga0163161_11625343 3300017792 Bacteria 570
217 Ga0213876_10002163 3300021384 Bacteria 11619
218 Ga0207672_1007189 3300025223 Bacteria 647
219 Ga0209674_100457 3300025226 Bacteria 18594
220 Ga0209258_117488 3300025242 Bacteria 786
221 Ga0209026_1000090 3300025250 Bacteria 172829
222 Ga0209759_1013062 3300025256 Bacteria 2266
223 Ga0207682_10384630 3300025893 Bacteria 663
224 Ga0207688_10674730 3300025901 Bacteria 653
225 Ga0207643_10036046 3300025908 Bacteria 2774
226 Ga0207707_10048146 3300025912 Bacteria 3713
227 Ga0207695_10012635 3300025913 Bacteria 10115
228 Ga0207695_10039899 3300025913 Bacteria 5042
229 Ga0207695_10593039 3300025913 Unclassified 989
230 Ga0207693_10926572 3300025915 Bacteria 668
231 Ga0207657_10332079 3300025919 Bacteria 1201
232 Ga0207649_10006218 3300025920 Bacteria 6484
233 Ga0207681_10752613 3300025923 Bacteria 812
234 Ga0207650_11056724 3300025925 Bacteria 691
235 Ga0207659_10093884 3300025926 Bacteria 2247
236 Ga0207659_10292481 3300025926 Bacteria 1335
237 Ga0207659_10625071 3300025926 Bacteria 919
238 Ga0207659_10977709 3300025926 Bacteria 728
239 Ga0207644_10108948 3300025931 Bacteria 2092
240 Ga0207644_10372718 3300025931 Bacteria 1163
241 Ga0207690_10209033 3300025932 Bacteria 1487
242 Ga0207706_10001112 3300025933 Bacteria 27374
243 Ga0207706_10096937 3300025933 Bacteria 2593
244 Ga0207686_10000793 3300025934 Bacteria 19399
245 Ga0207686_10431727 3300025934 Bacteria 1010
246 Ga0207686_11233629 3300025934 Bacteria 613
247 Ga0207670_10082266 3300025936 Bacteria 2256
248 Ga0207670_10481435 3300025936 Bacteria 1005
249 Ga0207670_10543863 3300025936 Bacteria 948
250 Ga0207669_10059912 3300025937 Bacteria 2331
251 Ga0207704_10044522 3300025938 Bacteria 2630
252 Ga0207704_10125611 3300025938 Bacteria 1766
253 Ga0207691_10041540 3300025940 Bacteria 4245
254 Ga0207691_10047317 3300025940 Bacteria 3947
255 Ga0207711_10023809 3300025941 Bacteria 5126
256 Ga0207711_10201266 3300025941 Bacteria 1817
257 Ga0207689_10653725 3300025942 Bacteria 886
258 Ga0207679_10044094 3300025945 Bacteria 3216
259 Ga0207679_10265907 3300025945 Bacteria 1465
260 Ga0207667_10576266 3300025949 Bacteria 1136
261 Ga0207651_10230684 3300025960 Bacteria 1503
262 Ga0207651_10576228 3300025960 Bacteria 981
263 Ga0207712_10038242 3300025961 Bacteria 3280
264 Ga0207712_10051779 3300025961 Bacteria 2873
265 Ga0207712_10259975 3300025961 Bacteria 1407
266 Ga0207712_11840778 3300025961 Bacteria 542
267 Ga0207668_10287604 3300025972 Bacteria 1351
268 Ga0207640_10405862 3300025981 Bacteria 1111
269 Ga0207658_10147678 3300025986 Bacteria 1911
270 Ga0207658_10264586 3300025986 Unclassified 1467
271 Ga0207703_10029684 3300026035 Bacteria 4316
272 Ga0207703_10309572 3300026035 Bacteria 1443
273 Ga0207703_11017360 3300026035 Bacteria 795
274 Ga0207639_10020930 3300026041 Bacteria 4692
275 Ga0207639_10055215 3300026041 Bacteria 3039
276 Ga0207639_10141435 3300026041 Bacteria 2005
277 Ga0207639_10428411 3300026041 Bacteria 1197
278 Ga0207708_10419945 3300026075 Bacteria 1109
279 Ga0207708_10919164 3300026075 Bacteria 758
280 Ga0207708_11620143 3300026075 Bacteria 569
281 Ga0207702_10172335 3300026078 Bacteria 1985
282 Ga0207702_11548735 3300026078 Bacteria 656
283 Ga0207641_10018275 3300026088 Bacteria 5746
284 Ga0207641_10099023 3300026088 Unclassified 2564
285 Ga0207641_10227265 3300026088 Bacteria 1733
286 Ga0207641_11714827 3300026088 Bacteria 630
287 Ga0207648_10336410 3300026089 Bacteria 1359
288 Ga0207676_10072759 3300026095 Bacteria 2764
289 Ga0207676_10080641 3300026095 Bacteria 2642
290 Ga0207674_10034538 3300026116 Bacteria 5284
291 Ga0207674_10193260 3300026116 Bacteria 1985
292 Ga0207698_10544916 3300026142 Bacteria 1136
293 Ga0207698_12022064 3300026142 Bacteria 590
294 Ga0209969_1037992 3300027360 Bacteria 745
295 Ga0209967_1051670 3300027364 Bacteria 632
296 Ga0209995_1022652 3300027471 Bacteria 1043
297 Ga0209968_1000820 3300027526 Bacteria 4821
298 Ga0210002_1002403 3300027617 Bacteria 2699
299 Ga0209974_10006839 3300027876 Bacteria 3957
300 Ga0268264_10034334 3300028381 Bacteria 4172
301 Ga0268264_11030417 3300028381 Bacteria 830
302 Ga0307515_10000684 3300028794 Bacteria 78055
303 Ga0307515_10000790 3300028794 Bacteria 72891
304 Ga0307515_10578776 3300028794 Bacteria 733
305 Ga0265338_10005369 3300028800 Bacteria 16754
306 Ga0265338_10044535 3300028800 Bacteria 4096
307 Ga0265325_10000050 3300031241 Bacteria 80443
308 Ga0265339_10007701 3300031249 Bacteria 6928
309 Ga0265314_10000027 3300031711 Bacteria 278331
310 Ga0265314_10139707 3300031711 Bacteria 1499
311 Ga0265342_10026033 3300031712 Bacteria 3670
312 Ga0307411_11096825 3300032005 Bacteria 717
313 Ga0307510_10005458 3300033180 Bacteria 15148
314 Ga0373927_0059974 3300035695 Bacteria 2461
315 Ga0373947_0160622 3300035725 Bacteria 1453
316 Ga0373937_0350451 3300036401 Bacteria 1398
317 Ga0395900_0033220 3300037418 Bacteria 5311
318 Ga0395898_1216698 3300037466 Bacteria 684
319 Ga0395901_0014803 3300038443 Bacteria 7926
320 Ga0436365_0589010 3300039437 Bacteria 11619
321 Ga0436360_0628197 3300039438 Bacteria 646
322 Ga0436361_1023825 3300039447 Bacteria 8591
323 Ga0436362_1211113 3300039453 Bacteria 898
324 Ga0451804_0236151 3300041463 Bacteria 518
325 Ga0451841_0850043 3300041498 Bacteria 838
326 Ga0439441_156068 3300042001 Bacteria 540
327 Ga0453684_0382179 3300044712 Bacteria 1581
328 Ga0453684_0406135 3300044712 Bacteria 1524
329 Ga0451576_1501511 3300045051 Bacteria 700
330 Ga0495582_0530416 3300046473 Bacteria 681
331 Ga0495606_0008859 3300046507 Bacteria 8624
332 Ga0495628_0017613 3300046516 Bacteria 5942
333 Ga0495630_0100432 3300046517 Bacteria 2189
334 Ga0495648_0131573 3300046524 Bacteria 1330
335 Ga0495642_0085183 3300046528 Bacteria 1334
336 Ga0495652_0321529 3300046529 Bacteria 1118
337 Ga0495640_0374012 3300046533 Bacteria 877
338 Ga0495586_0043647 3300046535 Bacteria 2415
339 Ga0495598_0031328 3300046537 Bacteria 1496
340 Ga0495598_0184727 3300046537 Bacteria 746
341 Ga0495621_0032789 3300046539 Bacteria 1788
342 Ga0495667_0183794 3300046559 Bacteria 1341
343 Ga0495668_0008040 3300046616 Bacteria 6641
344 Ga0495634_0672147 3300046642 Bacteria 597
345 Ga0495611_0032199 3300046648 Bacteria 2311
346 Ga0495625_0000628 3300046660 Bacteria 51089
347 Ga0495625_0029028 3300046660 Bacteria 4141
348 Ga0495625_0046915 3300046660 Bacteria 3116
349 Ga0495661_0228712 3300046665 Bacteria 960
350 Ga0495623_0202732 3300046679 Bacteria 1140
351 Ga0495670_0085635 3300046691 Bacteria 1609
352 Ga0495604_0482034 3300047317 Bacteria 807
353 Ga0495636_0000005 3300047318 Bacteria 108853
354 Ga0495676_0269361 3300047321 Bacteria 1156
355 Ga0495687_016963 3300047443 Bacteria 3647
356 Ga0495684_0162720 3300047471 Bacteria 1664
357 Ga0496105_0896048 3300048908 Bacteria 669
358 Ga0496111_0665921 3300048914 Bacteria 759
359 Ga0496112_0841940 3300048915 Bacteria 841
360 Ga0496113_0320777 3300048916 Bacteria 1242
361 Ga0496114_0477050 3300048917 Unclassified 1104
362 Ga0501034_0820308 3300049571 Bacteria 822
363 Ga0501047_0778223 3300049581 Bacteria 772
364 Ga0501048_0735453 3300049582 Bacteria 709
365 Ga0501072_0038927 3300049588 Bacteria 3733
366 Ga0501221_056501 3300049704 Bacteria 897
367 Ga0501079_0517046 3300049741 Unclassified 939
368 Ga0501044_0440502 3300049823 Bacteria 1211
369 nmdc:mga0k408_424_c1 3300050493 Bacteria 23079
370 nmdc:mga0k408_95302_c1 3300050493 Bacteria 1751
371 nmdc:mga05p37_110003_c1 3300050507 Bacteria 3390
372 nmdc:mga09592_8533_c1 3300050508 Bacteria 8335
373 nmdc:mga09592_921548_c1 3300050508 Bacteria 734
374 nmdc:mga09592_937564_c1 3300050508 Bacteria 726
375 nmdc:mga0qj67_77243_c1 3300050509 Bacteria 2664
376 nmdc:mga0qj67_922131_c1 3300050509 Bacteria 688
377 nmdc:mga0qj67_986563_c1 3300050509 Bacteria 661
378 nmdc:mga06r32_103035_c1 3300050510 Bacteria 2802
379 nmdc:mga06r32_264991_c1 3300050510 Bacteria 1706
380 nmdc:mga06r32_484813_c1 3300050510 Bacteria 1214
381 nmdc:mga08y16_49845_c1 3300050511 Bacteria 4381
382 nmdc:mga08y16_953991_c1 3300050511 Bacteria 841
383 nmdc:mga0n895_263339_c1 3300050512 Bacteria 1749
384 nmdc:mga0a205_107379_c1 3300050515 Bacteria 2689
385 Ga0500643_140032 3300053087 Bacteria 650
386 Ga0500651_0631458 3300053093 Bacteria 578
387 Ga0500641_0007357 3300053096 Bacteria 3924
388 Ga0500559_0093957 3300053136 Bacteria 1376
389 Ga0500559_0268393 3300053136 Bacteria 803
390 Ga0500589_193591 3300053147 Bacteria 787
391 Ga0500616_0000378 3300053153 Bacteria 62462
392 Ga0500616_0002964 3300053153 Bacteria 13469
393 Ga0500622_0004583 3300053156 Bacteria 8607
394 Ga0500639_098162 3300053163 Bacteria 1447
395 Ga0500636_0003330 3300053177 Bacteria 9025
396 Ga0500661_001774 3300055283 Bacteria 4068
397 Ga0501082_0541671 3300060353 Bacteria 1018
398 2513233270 2513020052 Bacteria 5120511
399 Ga0207699_10007796
400 JGI25157J39369_1000870
401 JGI25406J46586_10003469
402 rootL2_10014031
403 JGI25405J52794_10022187
404 Ga0065714_10071504
405 Ga0065714_10092403
406 Ga0065704_10511686
407 Ga0065712_10007470
408 Ga0065712_10145195
409 Ga0065712_10396412
410 Ga0065715_10076199
411 Ga0065715_10123969
412 Ga0070683_100284881
413 Ga0070683_100734894
414 Ga0070690_100031003
415 Ga0070690_100142351
416 Ga0070690_100249006
417 Ga0070677_10195924
418 Ga0068869_100609992
419 Ga0070666_10053260
420 Ga0070680_100378126
421 Ga0070680_100988228
422 Ga0070682_100475382
423 Ga0068868_100412909
424 Ga0070660_100351470
425 Ga0070689_100202222
426 Ga0070689_100289176
427 Ga0070689_101710379
428 Ga0070661_100001575
429 Ga0070668_100215886
430 Ga0070669_100278803
431 Ga0070675_100027986
432 Ga0070675_100185352
433 Ga0070675_100264364
434 Ga0070673_100079681
435 Ga0070673_100816646
436 Ga0070673_101067731
437 Ga0070673_101070441
438 Ga0070688_100036385
439 Ga0070688_100138252
440 Ga0070688_100797098
441 Ga0070659_101051070
442 Ga0070667_100044210
443 Ga0070667_100117111
444 Ga0070667_100200409
445 Ga0070667_100204519
446 Ga0070667_100410363
447 Ga0070709_10013523
448 Ga0070709_10235279
449 Ga0070714_100448146
450 Ga0070701_10085013
451 Ga0070705_100877394
452 Ga0070678_101330320
453 Ga0070662_100001104
454 Ga0070662_100061435
455 Ga0070681_10247459
456 Ga0068867_100043892
457 Ga0068867_100231219
458 Ga0070685_10005193
459 Ga0070685_10033538
460 Ga0070685_10358074
461 Ga0070685_10448084
462 Ga0070685_10936539
463 Ga0070706_101449445
464 Ga0070698_100000061
465 Ga0070698_100003096
466 Ga0070684_100021664
467 Ga0068853_100001770
468 Ga0068853_100045747
469 Ga0068853_100488905
470 Ga0068853_100876221
471 Ga0070672_100120680
472 Ga0070672_100223460
473 Ga0070672_100270464
474 Ga0070672_100405153
475 Ga0070686_100009483
476 Ga0070695_100514760
477 Ga0070693_100094283
478 Ga0070693_100182343
479 Ga0070665_100489538
480 Ga0070704_100182066
481 Ga0070704_101185231
482 Ga0068855_100110197
483 Ga0068855_100571388
484 Ga0070664_100204154
485 Ga0068857_100049348
486 Ga0068854_100097800
487 Ga0068854_101233593
488 Ga0068856_100011656
489 Ga0068856_100083934
490 Ga0068856_100918966
491 Ga0068852_100074222
492 Ga0068852_100171397
493 Ga0068852_100486698
494 Ga0068859_100103841
495 Ga0068859_100941143
496 Ga0068864_100073460
497 Ga0068864_100096861
498 Ga0068864_100320150
499 Ga0068864_100614936
500 Ga0068866_10188136
501 Ga0068861_100964673
502 Ga0068870_10178881
503 Ga0068863_100041998
504 Ga0068863_100102124
505 Ga0068863_100176002
506 Ga0068863_101429110
507 Ga0068858_100688736
508 Ga0068858_100747767
509 Ga0068860_100009610
510 Ga0068860_101078359
511 Ga0068860_101513815
512 Ga0068862_100168486
513 Ga0068862_100236643
514 Ga0068862_100571400
515 Ga0068862_100778795
516 Ga0081455_10090268
517 Ga0081540_1116297
518 Ga0081539_10000345
519 Ga0070717_11048258
520 Ga0075365_10043076
521 Ga0075364_10005700
522 Ga0075366_10001232
523 Ga0075366_10099807
524 Ga0097621_100006899
525 Ga0097621_100141137
526 Ga0097621_100682396
527 Ga0068871_100037551
528 Ga0068871_100136536
529 Ga0068871_100252427
530 Ga0068871_100347499
531 Ga0068871_100394385
532 Ga0075428_100090426
533 Ga0075428_100876751
534 Ga0075430_100006345
535 Ga0075431_100105332
536 Ga0075431_100528399
537 Ga0075433_10068011
538 Ga0075434_100717691
539 Ga0075429_100010254
540 Ga0075429_100328773
541 Ga0068865_100016915
542 Ga0068865_100105410
543 Ga0068865_100164549
544 Ga0097620_100103839
545 Ga0097620_100941183
546 Ga0105240_10006255
547 Ga0105240_10055504
548 Ga0105240_10772102
549 Ga0111539_10482628
550 Ga0105245_10679598
551 Ga0105247_10275285
552 Ga0105247_10980314
553 Ga0105243_10463231
554 Ga0105241_11483066
555 Ga0105242_10066940
556 Ga0105242_10232512
557 Ga0105242_11401046
558 Ga0105237_10003970
559 Ga0105238_11703809
560 Ga0105249_10024400
561 Ga0105249_10029039
562 Ga0105249_10089376
563 Ga0105249_10808876
564 Ga0105249_11544834
565 Ga0105249_11877640
566 Ga0105239_10000142
567 Ga0105239_10246983
568 Ga0105239_10286441
569 Ga0105246_10211885
570 Ga0157321_1005899
571 Ga0157373_10079301
572 Ga0157373_10111261
573 Ga0157371_10633433
574 Ga0157369_11296461
575 Ga0157374_10112517
576 Ga0157374_10276895
577 Ga0157374_10505396
578 Ga0157374_10715696
579 Ga0157378_10005675
580 Ga0157378_10044490
581 Ga0157378_10327423
582 Ga0157378_10441024
583 Ga0157378_11400606
584 Ga0163162_10057844
585 Ga0163162_10102589
586 Ga0163162_10137676
587 Ga0163162_10603117
588 Ga0157372_10020339
589 Ga0157372_10298717
590 Ga0157372_10372072
591 Ga0157372_11539273
592 Ga0157375_10001560
593 Ga0157375_10002645
594 Ga0157375_10005935
595 Ga0157375_10112012
596 Ga0157375_10157998
597 Ga0157375_10661456
598 Ga0157375_11410810
599 Ga0157375_11520796
600 Ga0157375_12215856
601 Ga0157375_12543315
602 Ga0163163_11303986
603 Ga0163163_11488025
604 Ga0157380_10094623
605 Ga0157380_10199833
606 Ga0157380_10451825
607 Ga0157377_10086610
608 Ga0157379_10080137
609 Ga0157376_10421317
610 Ga0157376_10451864
611 Ga0157376_10538146
612 Ga0163161_10040981
613 Ga0163161_10266362
614 Ga0163161_11625343
615 Ga0213876_10002163
616 Ga0207672_1007189
617 Ga0209674_100457
618 Ga0209258_117488
619 Ga0209026_1000090
620 Ga0209759_1013062
621 Ga0207682_10384630
622 Ga0207688_10674730
623 Ga0207643_10036046
624 Ga0207707_10048146
625 Ga0207695_10012635
626 Ga0207695_10039899
627 Ga0207695_10593039
628 Ga0207693_10926572
629 Ga0207657_10332079
630 Ga0207649_10006218
631 Ga0207681_10752613
632 Ga0207650_11056724
633 Ga0207659_10093884
634 Ga0207659_10292481
635 Ga0207659_10625071
636 Ga0207659_10977709
637 Ga0207644_10108948
638 Ga0207644_10372718
639 Ga0207690_10209033
640 Ga0207706_10001112
641 Ga0207706_10096937
642 Ga0207686_10000793
643 Ga0207686_10431727
644 Ga0207686_11233629
645 Ga0207670_10082266
646 Ga0207670_10481435
647 Ga0207670_10543863
648 Ga0207669_10059912
649 Ga0207704_10044522
650 Ga0207704_10125611
651 Ga0207691_10041540
652 Ga0207691_10047317
653 Ga0207711_10023809
654 Ga0207711_10201266
655 Ga0207689_10653725
656 Ga0207679_10044094
657 Ga0207679_10265907
658 Ga0207667_10576266
659 Ga0207651_10230684
660 Ga0207651_10576228
661 Ga0207712_10038242
662 Ga0207712_10051779
663 Ga0207712_10259975
664 Ga0207712_11840778
665 Ga0207668_10287604
666 Ga0207640_10405862
667 Ga0207658_10147678
668 Ga0207658_10264586
669 Ga0207703_10029684
670 Ga0207703_10309572
671 Ga0207703_11017360
672 Ga0207639_10020930
673 Ga0207639_10055215
674 Ga0207639_10141435
675 Ga0207639_10428411
676 Ga0207708_10419945
677 Ga0207708_10919164
678 Ga0207708_11620143
679 Ga0207702_10172335
680 Ga0207702_11548735
681 Ga0207641_10018275
682 Ga0207641_10099023
683 Ga0207641_10227265
684 Ga0207641_11714827
685 Ga0207648_10336410
686 Ga0207676_10072759
687 Ga0207676_10080641
688 Ga0207674_10034538
689 Ga0207674_10193260
690 Ga0207698_10544916
691 Ga0207698_12022064
692 Ga0209969_1037992
693 Ga0209967_1051670
694 Ga0209995_1022652
695 Ga0209968_1000820
696 Ga0210002_1002403
697 Ga0209974_10006839
698 Ga0268264_10034334
699 Ga0268264_11030417
700 Ga0307515_10000684
701 Ga0307515_10000790
702 Ga0307515_10578776
703 Ga0265338_10005369
704 Ga0265338_10044535
705 Ga0265325_10000050
706 Ga0265339_10007701
707 Ga0265314_10000027
708 Ga0265314_10139707
709 Ga0265342_10026033
710 Ga0307411_11096825
711 Ga0307510_10005458
712 Ga0373927_0059974
713 Ga0373947_0160622
714 Ga0373937_0350451
715 Ga0395900_0033220
716 Ga0395898_1216698
717 Ga0395901_0014803
718 Ga0436365_0589010
719 Ga0436360_0628197
720 Ga0436361_1023825
721 Ga0436362_1211113
722 Ga0451804_0236151
723 Ga0451841_0850043
724 Ga0439441_156068
725 Ga0453684_0382179
726 Ga0453684_0406135
727 Ga0451576_1501511
728 Ga0495582_0530416
729 Ga0495606_0008859
730 Ga0495628_0017613
731 Ga0495630_0100432
732 Ga0495648_0131573
733 Ga0495642_0085183
734 Ga0495652_0321529
735 Ga0495640_0374012
736 Ga0495586_0043647
737 Ga0495598_0031328
738 Ga0495598_0184727
739 Ga0495621_0032789
740 Ga0495667_0183794
741 Ga0495668_0008040
742 Ga0495634_0672147
743 Ga0495611_0032199
744 Ga0495625_0000628
745 Ga0495625_0029028
746 Ga0495625_0046915
747 Ga0495661_0228712
748 Ga0495623_0202732
749 Ga0495670_0085635
750 Ga0495604_0482034
751 Ga0495636_0000005
752 Ga0495676_0269361
753 Ga0495687_016963
754 Ga0495684_0162720
755 Ga0496105_0896048
756 Ga0496111_0665921
757 Ga0496112_0841940
758 Ga0496113_0320777
759 Ga0496114_0477050
760 Ga0501034_0820308
761 Ga0501047_0778223
762 Ga0501048_0735453
763 Ga0501072_0038927
764 Ga0501221_056501
765 Ga0501079_0517046
766 Ga0501044_0440502
767 nmdc:mga0k408_424_c1
768 nmdc:mga0k408_95302_c1
769 nmdc:mga05p37_110003_c1
770 nmdc:mga09592_8533_c1
771 nmdc:mga09592_921548_c1
772 nmdc:mga09592_937564_c1
773 nmdc:mga0qj67_77243_c1
774 nmdc:mga0qj67_922131_c1
775 nmdc:mga0qj67_986563_c1
776 nmdc:mga06r32_103035_c1
777 nmdc:mga06r32_264991_c1
778 nmdc:mga06r32_484813_c1
779 nmdc:mga08y16_49845_c1
780 nmdc:mga08y16_953991_c1
781 nmdc:mga0n895_263339_c1
782 nmdc:mga0a205_107379_c1
783 Ga0500643_140032
784 Ga0500651_0631458
785 Ga0500641_0007357
786 Ga0500559_0093957
787 Ga0500559_0268393
788 Ga0500589_193591
789 Ga0500616_0000378
790 Ga0500616_0002964
791 Ga0500622_0004583
792 Ga0500639_098162
793 Ga0500636_0003330
794 Ga0500661_001774
795 Ga0501082_0541671
796 2513233270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i5t-assembly1.cif.gz_A crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131 0.6059 75 141
2vgz-assembly1.cif.gz_A crystal structure of human kynurenine aminotransferase ii 0.5807 85 135
4grx-assembly1.cif.gz_B structure of an omega-aminotransferase from paracoccus denitrificans 0.5779 85 141
1dj3-assembly1.cif.gz_B structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana 0.5457 59 77
8a5p-assembly1.cif.gz_X structure of arp4-ies4-n-actin-arp8-ino80hsa subcomplex (a-module) of chaetomium thermophilum ino80 on curved dna 0.5301 45 74
ID Description Score Start End Superfamily
af_P9WKE3_10_163_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6392 59 74 3.40.50.2020
3gqhC02 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;succinate dehydrogenase protein domain 0.5992 44 74 4.10.80.40
2ogjF01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.596 59 89 2.30.40.10
af_A0A0P0V657_185_381_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5933 60 89 3.30.420.10
af_O53674_644_806_3.30.413.10 Alpha Beta;2-Layer Sandwich;Sulfite Reductase Hemoprotein; domain 1;Sulfite Reductase Hemoprotein, domain 1 0.5833 74 91 3.30.413.10
ID Description Score Start End GO Terms
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9531 1 141
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9509 1 138
AF-A0A6B8RMY4-F1-model_v4 DUF1801 domain-containing protein 0.9501 1 139
AF-A0A7W5Q1R6-F1-model_v4 YdhG-like domain-containing protein 0.9418 1 137
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9401 1 141

Map