F433984

General Info

Members Datasets Scaffolds Average Seq Length
398 184 796 182

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100022393|Ga0070694_1000223933
Length 187
Sequence MKTAAILVEDLYQEMEVWYPAYRLREEGIKTVFVGTGKPEYKSKLGYPVTADANAKDVSASQFDAIVIPGGYAPDILRRHEAVNRLVADMFKAGKVVSSICHGLWVCASAGILKGRTVTCCFAVKDDVINAGAKYVDQEVVVDGRLITSRKPDDLPAFMRETLKAIISGPGNGHDSPRRRRSKVEAS

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
111 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.55
Rhizosphere 88.69
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100022393 3300005444 Bacteria 4048
2 CNAas_1002969 3300000532 Bacteria 1155
3 Ga0065715_10177787 3300005293 Bacteria 1498
4 Ga0070680_100108877 3300005336 Bacteria 2305
5 Ga0070682_100398799 3300005337 Bacteria 1040
6 Ga0070689_100093990 3300005340 Bacteria 2367
7 Ga0070691_10294196 3300005341 Unclassified 885
8 Ga0070692_10023016 3300005345 Bacteria 3049
9 Ga0070692_10114628 3300005345 Unclassified 1495
10 Ga0070692_10146037 3300005345 Bacteria 1343
11 Ga0070674_100356922 3300005356 Bacteria 1182
12 Ga0070659_100059461 3300005366 Unclassified 3018
13 Ga0070703_10000055 3300005406 Bacteria 56450
14 Ga0070703_10167190 3300005406 Bacteria 839
15 Ga0070701_10058138 3300005438 Bacteria 2028
16 Ga0070705_100004114 3300005440 Bacteria 7105
17 Ga0070705_100016153 3300005440 Bacteria 3875
18 Ga0070705_100067801 3300005440 Bacteria 2145
19 Ga0070705_100072052 3300005440 Bacteria 2092
20 Ga0070705_100115650 3300005440 Bacteria 1722
21 Ga0070705_100236705 3300005440 Bacteria 1273
22 Ga0070705_100351055 3300005440 Bacteria 1075
23 Ga0070694_100000197 3300005444 Bacteria 31983
24 Ga0070694_100003789 3300005444 Bacteria 9021
25 Ga0070694_100009221 3300005444 Bacteria 6052
26 Ga0070694_100034547 3300005444 Bacteria 3335
27 Ga0070694_100057140 3300005444 Bacteria 2652
28 Ga0070694_100091625 3300005444 Bacteria 2134
29 Ga0070694_100124572 3300005444 Bacteria 1853
30 Ga0070694_100141622 3300005444 Bacteria 1747
31 Ga0070694_100889358 3300005444 Bacteria 735
32 Ga0070708_100002078 3300005445 Bacteria 15447
33 Ga0070708_100170319 3300005445 Bacteria 2033
34 Ga0070708_100247935 3300005445 Unclassified 1673
35 Ga0070708_100700762 3300005445 Bacteria 953
36 Ga0070708_100739855 3300005445 Unclassified 925
37 Ga0070708_101276017 3300005445 Bacteria 686
38 Ga0070663_101207004 3300005455 Bacteria 665
39 Ga0070681_10053916 3300005458 Unclassified 4007
40 Ga0070681_10675351 3300005458 Bacteria 948
41 Ga0070706_100002345 3300005467 Bacteria 19109
42 Ga0070706_100006669 3300005467 Bacteria 10893
43 Ga0070706_100031428 3300005467 Bacteria 4896
44 Ga0070706_100039095 3300005467 Bacteria 4380
45 Ga0070706_100054032 3300005467 Bacteria 3708
46 Ga0070707_100001626 3300005468 Bacteria 21789
47 Ga0070707_100003919 3300005468 Bacteria 14002
48 Ga0070707_100012636 3300005468 Bacteria 7885
49 Ga0070707_100024993 3300005468 Bacteria 5664
50 Ga0070707_100053064 3300005468 Bacteria 3886
51 Ga0070707_100078889 3300005468 Unclassified 3177
52 Ga0070707_100526538 3300005468 Bacteria 1144
53 Ga0070707_101287513 3300005468 Unclassified 697
54 Ga0070698_100006039 3300005471 Bacteria 13191
55 Ga0070698_100014022 3300005471 Bacteria 8475
56 Ga0070699_100027797 3300005518 Bacteria 4878
57 Ga0070699_100050499 3300005518 Bacteria 3601
58 Ga0070699_100110681 3300005518 Bacteria 2411
59 Ga0070679_100071369 3300005530 Bacteria 3464
60 Ga0070684_100328846 3300005535 Bacteria 1405
61 Ga0070697_100002340 3300005536 Bacteria 14574
62 Ga0070697_100019747 3300005536 Bacteria 5323
63 Ga0070697_100025145 3300005536 Bacteria 4747
64 Ga0070697_100027549 3300005536 Bacteria 4547
65 Ga0070697_100037430 3300005536 Bacteria 3920
66 Ga0070697_100120173 3300005536 Bacteria 2197
67 Ga0070686_101188464 3300005544 Bacteria 633
68 Ga0070695_100000433 3300005545 Bacteria 21709
69 Ga0070695_100001730 3300005545 Bacteria 12275
70 Ga0070695_100045620 3300005545 Bacteria 2794
71 Ga0070695_100046713 3300005545 Bacteria 2763
72 Ga0070695_100160265 3300005545 Bacteria 1578
73 Ga0070695_100399753 3300005545 Bacteria 1041
74 Ga0070695_100748716 3300005545 Bacteria 779
75 Ga0070696_100000171 3300005546 Bacteria 37111
76 Ga0070696_100002334 3300005546 Bacteria 12519
77 Ga0070696_100002844 3300005546 Bacteria 11512
78 Ga0070696_100126914 3300005546 Bacteria 1852
79 Ga0070696_100128023 3300005546 Bacteria 1844
80 Ga0070696_100141369 3300005546 Bacteria 1759
81 Ga0070696_100196410 3300005546 Bacteria 1504
82 Ga0070693_100168449 3300005547 Bacteria 1401
83 Ga0070693_100202787 3300005547 Bacteria 1289
84 Ga0070665_100266276 3300005548 Unclassified 1715
85 Ga0070704_100002396 3300005549 Bacteria 10528
86 Ga0070704_100002633 3300005549 Bacteria 10126
87 Ga0070704_100017794 3300005549 Bacteria 4530
88 Ga0070704_100197321 3300005549 Bacteria 1622
89 Ga0070704_100517634 3300005549 Unclassified 1038
90 Ga0068855_100792290 3300005563 Bacteria 1008
91 Ga0070664_100517285 3300005564 Bacteria 1101
92 Ga0068857_100179614 3300005577 Bacteria 1926
93 Ga0068854_100311543 3300005578 Bacteria 1277
94 Ga0070702_100267756 3300005615 Bacteria 1167
95 Ga0068863_100646192 3300005841 Bacteria 1049
96 Ga0068860_100344432 3300005843 Bacteria 1466
97 Ga0081455_10016303 3300005937 Bacteria 7179
98 Ga0070715_10176051 3300006163 Bacteria 1069
99 Ga0075428_100029991 3300006844 Bacteria 6017
100 Ga0075428_100249922 3300006844 Bacteria 1911
101 Ga0075428_100271810 3300006844 Unclassified 1823
102 Ga0075428_101628479 3300006844 Bacteria 674
103 Ga0075428_101662213 3300006844 Unclassified 667
104 Ga0075430_100470582 3300006846 Unclassified 1037
105 Ga0075430_100480804 3300006846 Unclassified 1025
106 Ga0075431_100031696 3300006847 Bacteria 5445
107 Ga0075431_100039589 3300006847 Bacteria 4856
108 Ga0075433_10000831 3300006852 Bacteria 21602
109 Ga0075433_10091271 3300006852 Bacteria 2692
110 Ga0075433_10108398 3300006852 Bacteria 2463
111 Ga0075433_10206690 3300006852 Unclassified 1745
112 Ga0075434_100030641 3300006871 Bacteria 5298
113 Ga0075434_100078500 3300006871 Bacteria 3297
114 Ga0075434_100107571 3300006871 Bacteria 2799
115 Ga0075434_100289587 3300006871 Bacteria 1658
116 Ga0075434_101397539 3300006871 Bacteria 710
117 Ga0075429_100062906 3300006880 Bacteria 3233
118 Ga0075429_100731170 3300006880 Bacteria 867
119 Ga0068865_100169733 3300006881 Bacteria 1671
120 Ga0075436_100003796 3300006914 Bacteria 10364
121 Ga0075436_100094709 3300006914 Bacteria 2076
122 Ga0075436_100157254 3300006914 Unclassified 1601
123 Ga0075436_100336410 3300006914 Bacteria 1086
124 Ga0075436_100530664 3300006914 Bacteria 863
125 Ga0075435_100003940 3300007076 Bacteria 10146
126 Ga0075435_100343035 3300007076 Bacteria 1280
127 Ga0099794_10000007 3300007265 Bacteria 128667
128 Ga0099794_10004079 3300007265 Bacteria 5685
129 Ga0099794_10044802 3300007265 Bacteria 2115
130 Ga0099794_10343437 3300007265 Bacteria 776
131 Ga0099795_10122226 3300007788 Unclassified 1042
132 Ga0111539_10023650 3300009094 Bacteria 7549
133 Ga0111539_10074837 3300009094 Bacteria 3991
134 Ga0111539_10600817 3300009094 Unclassified 1281
135 Ga0111539_11366126 3300009094 Bacteria 822
136 Ga0114129_10002529 3300009147 Bacteria 25398
137 Ga0114129_10068394 3300009147 Bacteria 4952
138 Ga0114129_10211224 3300009147 Bacteria 2623
139 Ga0114129_10342194 3300009147 Unclassified 1983
140 Ga0114129_10560967 3300009147 Unclassified 1484
141 Ga0114129_11195035 3300009147 Unclassified 947
142 Ga0114129_11990162 3300009147 Unclassified 703
143 Ga0105241_11087823 3300009174 Bacteria 752
144 Ga0105242_11810427 3300009176 Bacteria 649
145 Ga0105249_10083236 3300009553 Bacteria 2978
146 Ga0105249_10645918 3300009553 Bacteria 1115
147 Ga0105239_10055575 3300010375 Unclassified 4342
148 Ga0105246_10173060 3300011119 Unclassified 1655
149 Ga0105246_11553543 3300011119 Unclassified 623
150 Ga0157378_10059520 3300013297 Bacteria 3408
151 Ga0163162_10335389 3300013306 Bacteria 1645
152 Ga0157377_10415426 3300014745 Bacteria 920
153 Ga0163161_10332128 3300017792 Bacteria 1204
154 Ga0213876_10032001 3300021384 Bacteria 2775
155 Ga0207653_10000005 3300025885 Bacteria 257928
156 Ga0207642_10284856 3300025899 Bacteria 952
157 Ga0207699_10506391 3300025906 Bacteria 872
158 Ga0207684_10019395 3300025910 Bacteria 5819
159 Ga0207684_10027129 3300025910 Bacteria 4884
160 Ga0207684_10031181 3300025910 Bacteria 4537
161 Ga0207684_10109130 3300025910 Unclassified 2368
162 Ga0207684_10172360 3300025910 Bacteria 1865
163 Ga0207707_10041640 3300025912 Unclassified 4011
164 Ga0207663_10042392 3300025916 Bacteria 2780
165 Ga0207660_10033061 3300025917 Bacteria 3574
166 Ga0207660_10934921 3300025917 Bacteria 707
167 Ga0207662_10022780 3300025918 Bacteria 3595
168 Ga0207652_10034338 3300025921 Unclassified 4274
169 Ga0207646_10004793 3300025922 Bacteria 14515
170 Ga0207646_10007308 3300025922 Bacteria 11258
171 Ga0207646_10058799 3300025922 Bacteria 3433
172 Ga0207646_10073480 3300025922 Bacteria 3054
173 Ga0207646_10390645 3300025922 Bacteria 1257
174 Ga0207690_10042414 3300025932 Unclassified 2988
175 Ga0207669_10321179 3300025937 Bacteria 1185
176 Ga0207679_10927400 3300025945 Unclassified 797
177 Ga0207640_10565051 3300025981 Bacteria 958
178 Ga0207708_10024793 3300026075 Bacteria 4539
179 Ga0207708_10384141 3300026075 Bacteria 1158
180 Ga0207676_10576036 3300026095 Unclassified 1078
181 Ga0207674_10492287 3300026116 Unclassified 1185
182 Ga0209588_1006058 3300027671 Unclassified 3492
183 Ga0209588_1053880 3300027671 Bacteria 1301
184 Ga0209971_1018826 3300027682 Unclassified 1640
185 Ga0268266_10227637 3300028379 Unclassified 1716
186 Ga0268265_10533244 3300028380 Bacteria 1112
187 Ga0268265_11371552 3300028380 Unclassified 708
188 Ga0265337_1159056 3300028556 Unclassified 612
189 Ga0265334_10002550 3300028573 Bacteria 8503
190 Ga0265338_10049406 3300028800 Unclassified 3813
191 Ga0265338_10086695 3300028800 Unclassified 2604
192 Ga0265316_10113428 3300031344 Bacteria 2051
193 Ga0265316_10134691 3300031344 Unclassified 1859
194 Ga0307408_100057812 3300031548 Unclassified 2817
195 Ga0307408_100085644 3300031548 Bacteria 2367
196 Ga0307408_100088652 3300031548 Bacteria 2331
197 Ga0307408_101434810 3300031548 Bacteria 651
198 Ga0307405_10165509 3300031731 Bacteria 1571
199 Ga0307405_10351688 3300031731 Bacteria 1137
200 Ga0307405_10882169 3300031731 Bacteria 755
201 Ga0307413_10000311 3300031824 Bacteria 15132
202 Ga0307413_10146804 3300031824 Unclassified 1638
203 Ga0307413_10301001 3300031824 Bacteria 1216
204 Ga0307413_10413542 3300031824 Bacteria 1060
205 Ga0307410_10000890 3300031852 Bacteria 12765
206 Ga0307410_10191593 3300031852 Unclassified 1555
207 Ga0307410_10635185 3300031852 Unclassified 894
208 Ga0307406_10034794 3300031901 Bacteria 3093
209 Ga0307406_10236569 3300031901 Bacteria 1367
210 Ga0307406_10239842 3300031901 Bacteria 1359
211 Ga0307406_10322895 3300031901 Bacteria 1195
212 Ga0307406_10426374 3300031901 Unclassified 1058
213 Ga0307407_10015931 3300031903 Bacteria 3730
214 Ga0307407_10218509 3300031903 Unclassified 1287
215 Ga0307412_10363459 3300031911 Bacteria 1166
216 Ga0307412_10931874 3300031911 Bacteria 763
217 Ga0307409_100001397 3300031995 Bacteria 11798
218 Ga0307409_100037653 3300031995 Bacteria 3568
219 Ga0307409_101293833 3300031995 Bacteria 754
220 Ga0307416_100005105 3300032002 Bacteria 8012
221 Ga0307416_100008198 3300032002 Bacteria 6716
222 Ga0307416_100016878 3300032002 Bacteria 5089
223 Ga0307416_100034879 3300032002 Bacteria 3835
224 Ga0307416_100041292 3300032002 Bacteria 3591
225 Ga0307414_10009799 3300032004 Bacteria 5522
226 Ga0307414_10041645 3300032004 Unclassified 3114
227 Ga0307414_10072443 3300032004 Unclassified 2489
228 Ga0307414_10506625 3300032004 Bacteria 1069
229 Ga0307411_10030020 3300032005 Bacteria 3328
230 Ga0307411_10039604 3300032005 Bacteria 2983
231 Ga0307411_10312449 3300032005 Bacteria 1265
232 Ga0307411_10480471 3300032005 Bacteria 1046
233 Ga0307415_100005866 3300032126 Bacteria 6568
234 Ga0307415_100062083 3300032126 Unclassified 2590
235 Ga0307415_100068420 3300032126 Bacteria 2485
236 Ga0307415_100102772 3300032126 Bacteria 2101
237 Ga0373952_0022027 3300035092 Bacteria 1350
238 Ga0373954_0144403 3300035118 Bacteria 1162
239 Ga0373943_0151905 3300035170 Bacteria 1255
240 Ga0373946_0158397 3300035171 Bacteria 1061
241 Ga0373955_0048949 3300035172 Bacteria 2293
242 Ga0373942_0169592 3300035207 Bacteria 710
243 Ga0373931_0038558 3300035691 Bacteria 2500
244 Ga0373931_0156194 3300035691 Bacteria 1333
245 Ga0373931_0206583 3300035691 Bacteria 1176
246 Ga0373937_0582205 3300036401 Bacteria 1063
247 Ga0373925_0309234 3300037068 Bacteria 1277
248 Ga0400488_07021 3300038741 Bacteria 3960
249 Ga0436365_0108994 3300039437 Bacteria 8726
250 Ga0451787_250532 3300041441 Bacteria 753
251 Ga0439433_0041977 3300041999 Bacteria 1066
252 Ga0439434_0136408 3300042435 Bacteria 807
253 Ga0439434_0145035 3300042435 Bacteria 784
254 Ga0439435_0040270 3300042436 Unclassified 1304
255 Ga0439444_0044045 3300042437 Bacteria 886
256 Ga0451577_1179121 3300042876 Unclassified 684
257 Ga0453683_0036684 3300044673 Unclassified 3085
258 Ga0453683_0177301 3300044673 Bacteria 1351
259 Ga0453684_0000132 3300044712 Bacteria 331157
260 Ga0451576_0002086 3300045051 Bacteria 31200
261 Ga0451576_0002904 3300045051 Bacteria 24465
262 Ga0451576_0059153 3300045051 Bacteria 4001
263 Ga0451576_0231823 3300045051 Unclassified 1928
264 Ga0495592_0421724 3300046454 Bacteria 841
265 Ga0495639_0094305 3300046475 Bacteria 1407
266 Ga0495618_0080219 3300046514 Bacteria 2082
267 Ga0495628_0035724 3300046516 Bacteria 3992
268 Ga0495630_0011455 3300046517 Bacteria 6421
269 Ga0495621_0043767 3300046539 Bacteria 1580
270 Ga0495645_0782540 3300046543 Bacteria 574
271 Ga0495635_0481674 3300046663 Bacteria 818
272 Ga0495658_0067186 3300046683 Bacteria 2073
273 Ga0495613_0145869 3300046689 Bacteria 1689
274 Ga0496100_0113132 3300048903 Bacteria 1889
275 Ga0496100_0506661 3300048903 Bacteria 930
276 Ga0496101_0176603 3300048904 Bacteria 1643
277 Ga0496101_0215718 3300048904 Bacteria 1488
278 Ga0496102_0018198 3300048905 Bacteria 6167
279 Ga0496102_0065398 3300048905 Bacteria 3333
280 Ga0496102_0080648 3300048905 Bacteria 2998
281 Ga0496102_0771107 3300048905 Bacteria 884
282 Ga0496102_1052822 3300048905 Bacteria 734
283 Ga0496103_0023976 3300048906 Bacteria 3681
284 Ga0496103_0268628 3300048906 Bacteria 1097
285 Ga0496103_0348651 3300048906 Bacteria 952
286 Ga0496104_0004746 3300048907 Bacteria 11831
287 Ga0496104_0179373 3300048907 Bacteria 2028
288 Ga0496105_0126262 3300048908 Bacteria 2109
289 Ga0496106_0253582 3300048909 Bacteria 1407
290 Ga0496106_0704648 3300048909 Bacteria 804
291 Ga0496107_0031604 3300048910 Bacteria 3780
292 Ga0496107_0098941 3300048910 Bacteria 2137
293 Ga0496107_0568205 3300048910 Bacteria 839
294 Ga0496108_0002062 3300048911 Bacteria 16102
295 Ga0496108_0006445 3300048911 Bacteria 9513
296 Ga0496108_0132601 3300048911 Bacteria 2141
297 Ga0496109_0009821 3300048912 Bacteria 8170
298 Ga0496109_0201680 3300048912 Bacteria 1870
299 Ga0496109_0278126 3300048912 Bacteria 1577
300 Ga0496110_0024516 3300048913 Bacteria 5141
301 Ga0496110_0054457 3300048913 Bacteria 3519
302 Ga0496110_0142160 3300048913 Bacteria 2169
303 Ga0496110_0346080 3300048913 Bacteria 1354
304 Ga0496110_0356142 3300048913 Bacteria 1333
305 Ga0496111_0018174 3300048914 Unclassified 4868
306 Ga0496111_0048036 3300048914 Bacteria 3074
307 Ga0496111_0078519 3300048914 Bacteria 2407
308 Ga0496111_0405253 3300048914 Bacteria 1008
309 Ga0496112_0000698 3300048915 Bacteria 23333
310 Ga0496112_0921264 3300048915 Unclassified 795
311 Ga0496113_0040495 3300048916 Bacteria 3433
312 Ga0496113_0101323 3300048916 Bacteria 2232
313 Ga0496114_0426360 3300048917 Bacteria 1175
314 Ga0496115_0091295 3300048918 Bacteria 2489
315 Ga0501031_0308742 3300049568 Bacteria 1025
316 Ga0501033_0434611 3300049570 Bacteria 913
317 Ga0501036_0186373 3300049572 Bacteria 1746
318 Ga0501038_0418164 3300049574 Unclassified 1035
319 Ga0501039_0019973 3300049575 Bacteria 5135
320 Ga0501039_0045005 3300049575 Bacteria 3409
321 Ga0501039_0708145 3300049575 Bacteria 787
322 Ga0501040_0052505 3300049576 Bacteria 2790
323 Ga0501041_0085652 3300049577 Bacteria 1943
324 Ga0501042_0023637 3300049578 Bacteria 4303
325 Ga0501042_0115249 3300049578 Bacteria 1935
326 Ga0501043_0384158 3300049579 Bacteria 1063
327 Ga0501043_0626463 3300049579 Bacteria 792
328 Ga0501046_0515235 3300049580 Bacteria 855
329 Ga0501048_0042189 3300049582 Bacteria 3267
330 Ga0501048_1070296 3300049582 Unclassified 580
331 Ga0501067_0002788 3300049583 Bacteria 9612
332 Ga0501069_0030470 3300049585 Bacteria 2963
333 Ga0501070_0408196 3300049586 Unclassified 1098
334 Ga0501071_0751065 3300049587 Bacteria 751
335 Ga0501072_0045998 3300049588 Bacteria 3433
336 Ga0501072_0176349 3300049588 Bacteria 1705
337 Ga0501073_0061437 3300049589 Bacteria 2622
338 Ga0501074_0103292 3300049590 Bacteria 2040
339 Ga0501074_0527385 3300049590 Bacteria 836
340 Ga0501075_0130258 3300049591 Bacteria 1916
341 Ga0501075_0752064 3300049591 Bacteria 742
342 Ga0501076_0007568 3300049592 Bacteria 7907
343 Ga0501076_0410669 3300049592 Bacteria 1113
344 Ga0501076_0547133 3300049592 Bacteria 954
345 Ga0501077_0021265 3300049593 Bacteria 4106
346 Ga0501077_0034515 3300049593 Bacteria 3219
347 Ga0501077_0450021 3300049593 Bacteria 825
348 Ga0501235_033999 3300049669 Bacteria 1156
349 Ga0501079_0053119 3300049741 Bacteria 3126
350 Ga0501079_0296376 3300049741 Bacteria 1265
351 Ga0501080_0090458 3300049742 Bacteria 2843
352 Ga0501080_0156181 3300049742 Bacteria 2107
353 Ga0501080_0166178 3300049742 Bacteria 2036
354 Ga0501081_0146203 3300049743 Bacteria 1696
355 Ga0501081_0210505 3300049743 Bacteria 1412
356 Ga0501035_0149160 3300049822 Bacteria 2030
357 Ga0501035_0563439 3300049822 Bacteria 932
358 Ga0501045_0017230 3300049824 Bacteria 5127
359 Ga0501045_0032766 3300049824 Bacteria 3766
360 Ga0501045_0306308 3300049824 Bacteria 1182
361 nmdc:mga05p37_518867_c1 3300050507 Unclassified 1363
362 nmdc:mga09592_53306_c1 3300050508 Bacteria 3415
363 nmdc:mga09592_676991_c1 3300050508 Bacteria 879
364 nmdc:mga0qj67_423663_c1 3300050509 Unclassified 1073
365 nmdc:mga06r32_136714_c1 3300050510 Unclassified 2425
366 nmdc:mga06r32_258289_c1 3300050510 Bacteria 1730
367 nmdc:mga06r32_775937_c1 3300050510 Bacteria 920
368 nmdc:mga08y16_67353_c1 3300050511 Bacteria 3735
369 nmdc:mga0n895_197537_c1 3300050512 Unclassified 2043
370 nmdc:mga0n895_286150_c1 3300050512 Bacteria 1671
371 nmdc:mga0n895_345322_c1 3300050512 Bacteria 1507
372 nmdc:mga0n895_411931_c1 3300050512 Unclassified 1367
373 nmdc:mga0n895_97073_c1 3300050512 Bacteria 2952
374 nmdc:mga0rr50_11919_c1 3300050513 Bacteria 5591
375 nmdc:mga0rr50_16626_c1 3300050513 Bacteria 4893
376 nmdc:mga0rr50_379693_c1 3300050513 Bacteria 1191
377 nmdc:mga0rr50_55872_c1 3300050513 Bacteria 2947
378 nmdc:mga0rr50_56199_c1 3300050513 Bacteria 2940
379 nmdc:mga08x19_106479_c1 3300050514 Bacteria 1866
380 nmdc:mga08x19_175842_c1 3300050514 Bacteria 1460
381 nmdc:mga08x19_4739_c1 3300050514 Bacteria 8065
382 nmdc:mga08x19_69470_c1 3300050514 Bacteria 2294
383 nmdc:mga08x19_96310_c1 3300050514 Unclassified 1959
384 nmdc:mga0a205_125694_c1 3300050515 Bacteria 2464
385 nmdc:mga0a205_14_c2 3300050515 Bacteria 99560
386 nmdc:mga0a205_202962_c1 3300050515 Unclassified 1873
387 nmdc:mga0a205_40534_c1 3300050515 Bacteria 4483
388 nmdc:mga0a205_82725_c1 3300050515 Bacteria 3101
389 nmdc:mga0a205_872576_c1 3300050515 Bacteria 747
390 nmdc:mga0a205_97577_c1 3300050515 Bacteria 2837
391 Ga0495612_0003831 3300053078 Bacteria 6249
392 Ga0501084_0007841 3300054114 Bacteria 8785
393 Ga0501084_0062181 3300054114 Bacteria 3125
394 Ga0501084_1222285 3300054114 Bacteria 630
395 Ga0501082_0061275 3300060353 Bacteria 3239
396 Ga0501082_0740443 3300060353 Bacteria 860
397 Ga0530510_0163674 3300061734 Bacteria 1646
398 Ga0530510_0234877 3300061734 Bacteria 1364
399 Ga0070694_100022393
400 CNAas_1002969
401 Ga0065715_10177787
402 Ga0070680_100108877
403 Ga0070682_100398799
404 Ga0070689_100093990
405 Ga0070691_10294196
406 Ga0070692_10023016
407 Ga0070692_10114628
408 Ga0070692_10146037
409 Ga0070674_100356922
410 Ga0070659_100059461
411 Ga0070703_10000055
412 Ga0070703_10167190
413 Ga0070701_10058138
414 Ga0070705_100004114
415 Ga0070705_100016153
416 Ga0070705_100067801
417 Ga0070705_100072052
418 Ga0070705_100115650
419 Ga0070705_100236705
420 Ga0070705_100351055
421 Ga0070694_100000197
422 Ga0070694_100003789
423 Ga0070694_100009221
424 Ga0070694_100034547
425 Ga0070694_100057140
426 Ga0070694_100091625
427 Ga0070694_100124572
428 Ga0070694_100141622
429 Ga0070694_100889358
430 Ga0070708_100002078
431 Ga0070708_100170319
432 Ga0070708_100247935
433 Ga0070708_100700762
434 Ga0070708_100739855
435 Ga0070708_101276017
436 Ga0070663_101207004
437 Ga0070681_10053916
438 Ga0070681_10675351
439 Ga0070706_100002345
440 Ga0070706_100006669
441 Ga0070706_100031428
442 Ga0070706_100039095
443 Ga0070706_100054032
444 Ga0070707_100001626
445 Ga0070707_100003919
446 Ga0070707_100012636
447 Ga0070707_100024993
448 Ga0070707_100053064
449 Ga0070707_100078889
450 Ga0070707_100526538
451 Ga0070707_101287513
452 Ga0070698_100006039
453 Ga0070698_100014022
454 Ga0070699_100027797
455 Ga0070699_100050499
456 Ga0070699_100110681
457 Ga0070679_100071369
458 Ga0070684_100328846
459 Ga0070697_100002340
460 Ga0070697_100019747
461 Ga0070697_100025145
462 Ga0070697_100027549
463 Ga0070697_100037430
464 Ga0070697_100120173
465 Ga0070686_101188464
466 Ga0070695_100000433
467 Ga0070695_100001730
468 Ga0070695_100045620
469 Ga0070695_100046713
470 Ga0070695_100160265
471 Ga0070695_100399753
472 Ga0070695_100748716
473 Ga0070696_100000171
474 Ga0070696_100002334
475 Ga0070696_100002844
476 Ga0070696_100126914
477 Ga0070696_100128023
478 Ga0070696_100141369
479 Ga0070696_100196410
480 Ga0070693_100168449
481 Ga0070693_100202787
482 Ga0070665_100266276
483 Ga0070704_100002396
484 Ga0070704_100002633
485 Ga0070704_100017794
486 Ga0070704_100197321
487 Ga0070704_100517634
488 Ga0068855_100792290
489 Ga0070664_100517285
490 Ga0068857_100179614
491 Ga0068854_100311543
492 Ga0070702_100267756
493 Ga0068863_100646192
494 Ga0068860_100344432
495 Ga0081455_10016303
496 Ga0070715_10176051
497 Ga0075428_100029991
498 Ga0075428_100249922
499 Ga0075428_100271810
500 Ga0075428_101628479
501 Ga0075428_101662213
502 Ga0075430_100470582
503 Ga0075430_100480804
504 Ga0075431_100031696
505 Ga0075431_100039589
506 Ga0075433_10000831
507 Ga0075433_10091271
508 Ga0075433_10108398
509 Ga0075433_10206690
510 Ga0075434_100030641
511 Ga0075434_100078500
512 Ga0075434_100107571
513 Ga0075434_100289587
514 Ga0075434_101397539
515 Ga0075429_100062906
516 Ga0075429_100731170
517 Ga0068865_100169733
518 Ga0075436_100003796
519 Ga0075436_100094709
520 Ga0075436_100157254
521 Ga0075436_100336410
522 Ga0075436_100530664
523 Ga0075435_100003940
524 Ga0075435_100343035
525 Ga0099794_10000007
526 Ga0099794_10004079
527 Ga0099794_10044802
528 Ga0099794_10343437
529 Ga0099795_10122226
530 Ga0111539_10023650
531 Ga0111539_10074837
532 Ga0111539_10600817
533 Ga0111539_11366126
534 Ga0114129_10002529
535 Ga0114129_10068394
536 Ga0114129_10211224
537 Ga0114129_10342194
538 Ga0114129_10560967
539 Ga0114129_11195035
540 Ga0114129_11990162
541 Ga0105241_11087823
542 Ga0105242_11810427
543 Ga0105249_10083236
544 Ga0105249_10645918
545 Ga0105239_10055575
546 Ga0105246_10173060
547 Ga0105246_11553543
548 Ga0157378_10059520
549 Ga0163162_10335389
550 Ga0157377_10415426
551 Ga0163161_10332128
552 Ga0213876_10032001
553 Ga0207653_10000005
554 Ga0207642_10284856
555 Ga0207699_10506391
556 Ga0207684_10019395
557 Ga0207684_10027129
558 Ga0207684_10031181
559 Ga0207684_10109130
560 Ga0207684_10172360
561 Ga0207707_10041640
562 Ga0207663_10042392
563 Ga0207660_10033061
564 Ga0207660_10934921
565 Ga0207662_10022780
566 Ga0207652_10034338
567 Ga0207646_10004793
568 Ga0207646_10007308
569 Ga0207646_10058799
570 Ga0207646_10073480
571 Ga0207646_10390645
572 Ga0207690_10042414
573 Ga0207669_10321179
574 Ga0207679_10927400
575 Ga0207640_10565051
576 Ga0207708_10024793
577 Ga0207708_10384141
578 Ga0207676_10576036
579 Ga0207674_10492287
580 Ga0209588_1006058
581 Ga0209588_1053880
582 Ga0209971_1018826
583 Ga0268266_10227637
584 Ga0268265_10533244
585 Ga0268265_11371552
586 Ga0265337_1159056
587 Ga0265334_10002550
588 Ga0265338_10049406
589 Ga0265338_10086695
590 Ga0265316_10113428
591 Ga0265316_10134691
592 Ga0307408_100057812
593 Ga0307408_100085644
594 Ga0307408_100088652
595 Ga0307408_101434810
596 Ga0307405_10165509
597 Ga0307405_10351688
598 Ga0307405_10882169
599 Ga0307413_10000311
600 Ga0307413_10146804
601 Ga0307413_10301001
602 Ga0307413_10413542
603 Ga0307410_10000890
604 Ga0307410_10191593
605 Ga0307410_10635185
606 Ga0307406_10034794
607 Ga0307406_10236569
608 Ga0307406_10239842
609 Ga0307406_10322895
610 Ga0307406_10426374
611 Ga0307407_10015931
612 Ga0307407_10218509
613 Ga0307412_10363459
614 Ga0307412_10931874
615 Ga0307409_100001397
616 Ga0307409_100037653
617 Ga0307409_101293833
618 Ga0307416_100005105
619 Ga0307416_100008198
620 Ga0307416_100016878
621 Ga0307416_100034879
622 Ga0307416_100041292
623 Ga0307414_10009799
624 Ga0307414_10041645
625 Ga0307414_10072443
626 Ga0307414_10506625
627 Ga0307411_10030020
628 Ga0307411_10039604
629 Ga0307411_10312449
630 Ga0307411_10480471
631 Ga0307415_100005866
632 Ga0307415_100062083
633 Ga0307415_100068420
634 Ga0307415_100102772
635 Ga0373952_0022027
636 Ga0373954_0144403
637 Ga0373943_0151905
638 Ga0373946_0158397
639 Ga0373955_0048949
640 Ga0373942_0169592
641 Ga0373931_0038558
642 Ga0373931_0156194
643 Ga0373931_0206583
644 Ga0373937_0582205
645 Ga0373925_0309234
646 Ga0400488_07021
647 Ga0436365_0108994
648 Ga0451787_250532
649 Ga0439433_0041977
650 Ga0439434_0136408
651 Ga0439434_0145035
652 Ga0439435_0040270
653 Ga0439444_0044045
654 Ga0451577_1179121
655 Ga0453683_0036684
656 Ga0453683_0177301
657 Ga0453684_0000132
658 Ga0451576_0002086
659 Ga0451576_0002904
660 Ga0451576_0059153
661 Ga0451576_0231823
662 Ga0495592_0421724
663 Ga0495639_0094305
664 Ga0495618_0080219
665 Ga0495628_0035724
666 Ga0495630_0011455
667 Ga0495621_0043767
668 Ga0495645_0782540
669 Ga0495635_0481674
670 Ga0495658_0067186
671 Ga0495613_0145869
672 Ga0496100_0113132
673 Ga0496100_0506661
674 Ga0496101_0176603
675 Ga0496101_0215718
676 Ga0496102_0018198
677 Ga0496102_0065398
678 Ga0496102_0080648
679 Ga0496102_0771107
680 Ga0496102_1052822
681 Ga0496103_0023976
682 Ga0496103_0268628
683 Ga0496103_0348651
684 Ga0496104_0004746
685 Ga0496104_0179373
686 Ga0496105_0126262
687 Ga0496106_0253582
688 Ga0496106_0704648
689 Ga0496107_0031604
690 Ga0496107_0098941
691 Ga0496107_0568205
692 Ga0496108_0002062
693 Ga0496108_0006445
694 Ga0496108_0132601
695 Ga0496109_0009821
696 Ga0496109_0201680
697 Ga0496109_0278126
698 Ga0496110_0024516
699 Ga0496110_0054457
700 Ga0496110_0142160
701 Ga0496110_0346080
702 Ga0496110_0356142
703 Ga0496111_0018174
704 Ga0496111_0048036
705 Ga0496111_0078519
706 Ga0496111_0405253
707 Ga0496112_0000698
708 Ga0496112_0921264
709 Ga0496113_0040495
710 Ga0496113_0101323
711 Ga0496114_0426360
712 Ga0496115_0091295
713 Ga0501031_0308742
714 Ga0501033_0434611
715 Ga0501036_0186373
716 Ga0501038_0418164
717 Ga0501039_0019973
718 Ga0501039_0045005
719 Ga0501039_0708145
720 Ga0501040_0052505
721 Ga0501041_0085652
722 Ga0501042_0023637
723 Ga0501042_0115249
724 Ga0501043_0384158
725 Ga0501043_0626463
726 Ga0501046_0515235
727 Ga0501048_0042189
728 Ga0501048_1070296
729 Ga0501067_0002788
730 Ga0501069_0030470
731 Ga0501070_0408196
732 Ga0501071_0751065
733 Ga0501072_0045998
734 Ga0501072_0176349
735 Ga0501073_0061437
736 Ga0501074_0103292
737 Ga0501074_0527385
738 Ga0501075_0130258
739 Ga0501075_0752064
740 Ga0501076_0007568
741 Ga0501076_0410669
742 Ga0501076_0547133
743 Ga0501077_0021265
744 Ga0501077_0034515
745 Ga0501077_0450021
746 Ga0501235_033999
747 Ga0501079_0053119
748 Ga0501079_0296376
749 Ga0501080_0090458
750 Ga0501080_0156181
751 Ga0501080_0166178
752 Ga0501081_0146203
753 Ga0501081_0210505
754 Ga0501035_0149160
755 Ga0501035_0563439
756 Ga0501045_0017230
757 Ga0501045_0032766
758 Ga0501045_0306308
759 nmdc:mga05p37_518867_c1
760 nmdc:mga09592_53306_c1
761 nmdc:mga09592_676991_c1
762 nmdc:mga0qj67_423663_c1
763 nmdc:mga06r32_136714_c1
764 nmdc:mga06r32_258289_c1
765 nmdc:mga06r32_775937_c1
766 nmdc:mga08y16_67353_c1
767 nmdc:mga0n895_197537_c1
768 nmdc:mga0n895_286150_c1
769 nmdc:mga0n895_345322_c1
770 nmdc:mga0n895_411931_c1
771 nmdc:mga0n895_97073_c1
772 nmdc:mga0rr50_11919_c1
773 nmdc:mga0rr50_16626_c1
774 nmdc:mga0rr50_379693_c1
775 nmdc:mga0rr50_55872_c1
776 nmdc:mga0rr50_56199_c1
777 nmdc:mga08x19_106479_c1
778 nmdc:mga08x19_175842_c1
779 nmdc:mga08x19_4739_c1
780 nmdc:mga08x19_69470_c1
781 nmdc:mga08x19_96310_c1
782 nmdc:mga0a205_125694_c1
783 nmdc:mga0a205_14_c2
784 nmdc:mga0a205_202962_c1
785 nmdc:mga0a205_40534_c1
786 nmdc:mga0a205_82725_c1
787 nmdc:mga0a205_872576_c1
788 nmdc:mga0a205_97577_c1
789 Ga0495612_0003831
790 Ga0501084_0007841
791 Ga0501084_0062181
792 Ga0501084_1222285
793 Ga0501082_0061275
794 Ga0501082_0740443
795 Ga0530510_0163674
796 Ga0530510_0234877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

2

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9878 7 170
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9876 7 170
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9866 5 170
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9847 7 170
1oi4-assembly1.cif.gz_A crystal structure of yhbo from escherichia coli 0.9788 6 170
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9878 7 170 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9764 6 170 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9702 7 170 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9693 5 170 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9687 5 171 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A524HTK1-F1-model_v4 Type 1 glutamine amidotransferase 1.002 1 171 GO:0016740
AF-A0A2G4I534-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9992 67 172
AF-A0A7W1F484-F1-model_v4 Type 1 glutamine amidotransferase 0.9965 1 172 GO:0016740
AF-A0A7W1WPC5-F1-model_v4 Type 1 glutamine amidotransferase 0.996 1 172 GO:0016740
AF-A0A3C0TIG2-F1-model_v4 Type 1 glutamine amidotransferase 0.9955 58 172 GO:0016740

Map