F433691

General Info

Members Datasets Scaffolds Average Seq Length
397 211 393 184

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100125866|Ga0070660_1001258664
Length 200
Sequence VAEHFQSLKTKIKKPAMSRIGKNPVTITKGVNVSVGTDNVITVKGPKGELKQAIDPDIKVEVKDDKIVFTRPTDQIRHKAMHGLYRALVQNMVTGVTDGYKKTLELVGVGYKASNQGNLLDLSLGYSHNIIVEIPKELTVATAQEKGKNPKVILTSVDKQLLGAVAAKIRSLRKPEPYKGKGVKFEGEVLRRKAGKSAGK

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
4 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
199 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
202 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
207 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 2.77
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 0.76
Rhizosphere 88.66
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000003 3300002067 Bacteria 385983
2 rootH1_10047247 3300003316 Bacteria 3141
3 rootL2_10209350 3300003322 Bacteria 1613
4 rootH1_10097575 3300003323 Bacteria 3437
5 Ga0065715_10190231 3300005293 Bacteria 1420
6 Ga0070658_10036030 3300005327 Bacteria 3987
7 Ga0070658_10050877 3300005327 Bacteria 3358
8 Ga0070658_10105914 3300005327 Bacteria 2326
9 Ga0070658_10111943 3300005327 Bacteria 2262
10 Ga0070683_101540396 3300005329 Bacteria 639
11 Ga0070670_100074532 3300005331 Bacteria 2916
12 Ga0070670_100813313 3300005331 Bacteria 844
13 Ga0068869_100050260 3300005334 Bacteria 3021
14 Ga0070680_100009085 3300005336 Bacteria 7620
15 Ga0070680_100032060 3300005336 Bacteria 4227
16 Ga0070682_100011807 3300005337 Bacteria 4997
17 Ga0070682_100490037 3300005337 Bacteria 950
18 Ga0068868_100416100 3300005338 Unclassified 1163
19 Ga0070660_100003216 3300005339 Bacteria 11222
20 Ga0070660_100018370 3300005339 Bacteria 5109
21 Ga0070660_100124448 3300005339 Bacteria 2060
22 Ga0070660_100125866 3300005339 Bacteria 2048
23 Ga0070660_100324117 3300005339 Bacteria 1266
24 Ga0070661_100199061 3300005344 Bacteria 1530
25 Ga0070668_100824147 3300005347 Bacteria 825
26 Ga0070675_100081497 3300005354 Bacteria 2699
27 Ga0070674_100046466 3300005356 Bacteria 2970
28 Ga0070673_100611256 3300005364 Bacteria 995
29 Ga0070659_100012587 3300005366 Bacteria 6273
30 Ga0070659_100034080 3300005366 Bacteria 3959
31 Ga0070659_100393479 3300005366 Bacteria 1169
32 Ga0070667_100438079 3300005367 Bacteria 1193
33 Ga0070667_100764814 3300005367 Bacteria 896
34 Ga0070667_100853323 3300005367 Bacteria 847
35 Ga0070663_100485210 3300005455 Bacteria 1024
36 Ga0070663_101315181 3300005455 Bacteria 638
37 Ga0070678_100172179 3300005456 Bacteria 1764
38 Ga0070681_10007373 3300005458 Bacteria 10751
39 Ga0070681_10082340 3300005458 Unclassified 3173
40 Ga0070681_10104396 3300005458 Bacteria 2776
41 Ga0070681_10227885 3300005458 Unclassified 1778
42 Ga0070698_100838898 3300005471 Bacteria 864
43 Ga0070679_100000558 3300005530 Bacteria 31616
44 Ga0070679_100001469 3300005530 Bacteria 20899
45 Ga0070679_100075980 3300005530 Bacteria 3349
46 Ga0070679_100149611 3300005530 Bacteria 2312
47 Ga0070679_100237874 3300005530 Bacteria 1779
48 Ga0070679_100638396 3300005530 Bacteria 1008
49 Ga0070684_100308203 3300005535 Bacteria 1453
50 Ga0068853_100024566 3300005539 Bacteria 5054
51 Ga0068853_100239261 3300005539 Bacteria 1663
52 Ga0068853_100300731 3300005539 Bacteria 1483
53 Ga0068853_100596126 3300005539 Bacteria 1049
54 Ga0070672_100337374 3300005543 Bacteria 1283
55 Ga0070672_100414873 3300005543 Bacteria 1156
56 Ga0070665_100392646 3300005548 Bacteria 1395
57 Ga0068855_100000943 3300005563 Bacteria 36241
58 Ga0068855_100002973 3300005563 Bacteria 20715
59 Ga0068855_100035596 3300005563 Bacteria 5930
60 Ga0068855_100133466 3300005563 Bacteria 2833
61 Ga0068855_100207210 3300005563 Bacteria 2205
62 Ga0068855_100409917 3300005563 Bacteria 1484
63 Ga0070664_100258683 3300005564 Bacteria 1566
64 Ga0068854_100042884 3300005578 Bacteria 3204
65 Ga0068854_100617702 3300005578 Unclassified 927
66 Ga0068856_100046597 3300005614 Bacteria 4270
67 Ga0068852_100001428 3300005616 Bacteria 16112
68 Ga0068852_100133887 3300005616 Bacteria 2286
69 Ga0068852_100423973 3300005616 Bacteria 1313
70 Ga0068859_100020784 3300005617 Bacteria 6589
71 Ga0068859_100388178 3300005617 Bacteria 1492
72 Ga0068861_100217732 3300005719 Bacteria 1612
73 Ga0068851_10025528 3300005834 Bacteria 2899
74 Ga0068851_10062341 3300005834 Bacteria 1913
75 Ga0068870_10479351 3300005840 Bacteria 825
76 Ga0068870_10580401 3300005840 Bacteria 759
77 Ga0068863_100560499 3300005841 Bacteria 1129
78 Ga0068860_100008499 3300005843 Bacteria 10228
79 Ga0068860_100664914 3300005843 Bacteria 1050
80 Ga0068862_100016969 3300005844 Bacteria 6060
81 Ga0068862_100674765 3300005844 Unclassified 999
82 Ga0068862_100880612 3300005844 Bacteria 879
83 Ga0081540_1017421 3300005983 Bacteria 4449
84 Ga0075366_10062800 3300006195 Bacteria 2207
85 Ga0075366_10097627 3300006195 Bacteria 1762
86 Ga0075366_10428134 3300006195 Bacteria 816
87 Ga0097621_100028342 3300006237 Bacteria 4413
88 Ga0068871_100252352 3300006358 Bacteria 1537
89 Ga0068871_100559711 3300006358 Bacteria 1036
90 Ga0075429_100381858 3300006880 Bacteria 1234
91 Ga0097620_100020785 3300006931 Bacteria 6589
92 Ga0097620_100388215 3300006931 Bacteria 1492
93 Ga0105240_10050909 3300009093 Bacteria 5216
94 Ga0105240_10143798 3300009093 Bacteria 2848
95 Ga0111539_10037511 3300009094 Bacteria 5851
96 Ga0111539_10881632 3300009094 Bacteria 1041
97 Ga0105241_10017181 3300009174 Bacteria 5315
98 Ga0105242_10041358 3300009176 Bacteria 3717
99 Ga0105237_10030357 3300009545 Bacteria 5490
100 Ga0105249_10287856 3300009553 Bacteria 1643
101 Ga0105239_10041952 3300010375 Bacteria 5013
102 Ga0105239_10435509 3300010375 Bacteria 1486
103 Ga0105246_10130981 3300011119 Bacteria 1873
104 Ga0157373_10005189 3300013100 Bacteria 9789
105 Ga0157373_10009541 3300013100 Bacteria 7164
106 Ga0157373_10017909 3300013100 Bacteria 5157
107 Ga0157373_10142714 3300013100 Bacteria 1684
108 Ga0157373_10219775 3300013100 Bacteria 1340
109 Ga0157373_10328257 3300013100 Bacteria 1089
110 Ga0157371_10001816 3300013102 Bacteria 21541
111 Ga0157371_10004257 3300013102 Bacteria 12588
112 Ga0157371_10005830 3300013102 Bacteria 10306
113 Ga0157371_10010677 3300013102 Bacteria 7131
114 Ga0157371_10017891 3300013102 Bacteria 5255
115 Ga0157371_10021400 3300013102 Bacteria 4748
116 Ga0157371_10030995 3300013102 Bacteria 3853
117 Ga0157371_10100443 3300013102 Unclassified 2052
118 Ga0157371_10146020 3300013102 Bacteria 1685
119 Ga0157371_10290064 3300013102 Bacteria 1183
120 Ga0157371_10441603 3300013102 Unclassified 956
121 Ga0157370_10000926 3300013104 Bacteria 37246
122 Ga0157370_10006378 3300013104 Bacteria 13019
123 Ga0157370_10009487 3300013104 Bacteria 10389
124 Ga0157370_10178488 3300013104 Bacteria 1974
125 Ga0157370_10183669 3300013104 Bacteria 1942
126 Ga0157370_10257424 3300013104 Bacteria 1613
127 Ga0157370_10363542 3300013104 Bacteria 1333
128 Ga0157370_10900012 3300013104 Bacteria 803
129 Ga0157369_10015072 3300013105 Bacteria 8726
130 Ga0157369_10026567 3300013105 Bacteria 6421
131 Ga0157369_10111355 3300013105 Bacteria 2909
132 Ga0157369_10231290 3300013105 Bacteria 1933
133 Ga0157369_10757446 3300013105 Bacteria 999
134 Ga0157374_10055091 3300013296 Bacteria 3710
135 Ga0157378_10255889 3300013297 Unclassified 1678
136 Ga0157378_10295469 3300013297 Bacteria 1566
137 Ga0157378_10672115 3300013297 Bacteria 1053
138 Ga0163162_10007765 3300013306 Bacteria 10452
139 Ga0163162_10449985 3300013306 Bacteria 1420
140 Ga0163162_11461278 3300013306 Bacteria 778
141 Ga0157372_10009847 3300013307 Bacteria 10166
142 Ga0157372_10011651 3300013307 Bacteria 9360
143 Ga0157372_10023315 3300013307 Bacteria 6708
144 Ga0157372_10027520 3300013307 Bacteria 6194
145 Ga0157372_10047593 3300013307 Bacteria 4766
146 Ga0157372_10077350 3300013307 Bacteria 3758
147 Ga0157372_10209948 3300013307 Unclassified 2256
148 Ga0157372_10243386 3300013307 Bacteria 2087
149 Ga0157372_10578107 3300013307 Bacteria 1309
150 Ga0157372_10615210 3300013307 Bacteria 1266
151 Ga0157372_11419232 3300013307 Bacteria 800
152 Ga0157372_11540859 3300013307 Bacteria 765
153 Ga0157372_11958088 3300013307 Unclassified 673
154 Ga0157375_10189384 3300013308 Bacteria 2212
155 Ga0157375_10280646 3300013308 Bacteria 1829
156 Ga0163163_12204441 3300014325 Bacteria 610
157 Ga0157377_10741144 3300014745 Bacteria 718
158 Ga0157379_10241135 3300014968 Bacteria 1640
159 Ga0157376_10255777 3300014969 Bacteria 1638
160 Ga0157376_10496149 3300014969 Bacteria 1199
161 Ga0163161_10143269 3300017792 Bacteria 1811
162 Ga0197907_11497399 3300020069 Bacteria 1005
163 Ga0206351_10267476 3300020077 Bacteria 15418
164 Ga0154015_1410599 3300020610 Bacteria 3445
165 Ga0209646_1001707 3300025246 Bacteria 5564
166 Ga0209758_1115228 3300025297 Bacteria 736
167 Ga0207656_10064483 3300025321 Bacteria 1615
168 Ga0207682_10285264 3300025893 Bacteria 772
169 Ga0207647_10042359 3300025904 Bacteria 2857
170 Ga0207647_10470534 3300025904 Unclassified 703
171 Ga0207643_10409242 3300025908 Bacteria 858
172 Ga0207643_10509848 3300025908 Bacteria 769
173 Ga0207705_10003791 3300025909 Bacteria 11514
174 Ga0207705_10011169 3300025909 Bacteria 6510
175 Ga0207705_10022689 3300025909 Bacteria 4477
176 Ga0207705_10043781 3300025909 Bacteria 3216
177 Ga0207705_10187616 3300025909 Bacteria 1562
178 Ga0207654_10116685 3300025911 Bacteria 1670
179 Ga0207707_10026248 3300025912 Bacteria 5093
180 Ga0207707_10142862 3300025912 Bacteria 2092
181 Ga0207707_10219710 3300025912 Bacteria 1654
182 Ga0207695_10004647 3300025913 Bacteria 18602
183 Ga0207671_10065906 3300025914 Bacteria 2694
184 Ga0207660_10031422 3300025917 Bacteria 3657
185 Ga0207660_10039446 3300025917 Bacteria 3301
186 Ga0207660_10177060 3300025917 Unclassified 1654
187 Ga0207657_10021530 3300025919 Bacteria 6063
188 Ga0207657_10085929 3300025919 Bacteria 2634
189 Ga0207657_10115306 3300025919 Unclassified 2214
190 Ga0207657_10223073 3300025919 Bacteria 1509
191 Ga0207657_10302848 3300025919 Bacteria 1266
192 Ga0207657_10334045 3300025919 Bacteria 1197
193 Ga0207652_10000064 3300025921 Bacteria 111997
194 Ga0207652_10000387 3300025921 Bacteria 45946
195 Ga0207652_10022903 3300025921 Bacteria 5173
196 Ga0207652_10025804 3300025921 Bacteria 4889
197 Ga0207652_10068289 3300025921 Bacteria 3084
198 Ga0207652_10103594 3300025921 Bacteria 2516
199 Ga0207650_10045585 3300025925 Bacteria 3226
200 Ga0207650_10671490 3300025925 Bacteria 874
201 Ga0207650_11420659 3300025925 Bacteria 590
202 Ga0207659_10243762 3300025926 Bacteria 1455
203 Ga0207690_10132521 3300025932 Bacteria 1826
204 Ga0207690_10151125 3300025932 Unclassified 1721
205 Ga0207669_10039771 3300025937 Bacteria 2721
206 Ga0207665_10597801 3300025939 Bacteria 861
207 Ga0207691_10782800 3300025940 Bacteria 802
208 Ga0207689_10006806 3300025942 Bacteria 10058
209 Ga0207689_10245186 3300025942 Bacteria 1481
210 Ga0207661_10225808 3300025944 Bacteria 1657
211 Ga0207667_10001484 3300025949 Bacteria 29439
212 Ga0207667_10005923 3300025949 Bacteria 14885
213 Ga0207667_10013969 3300025949 Bacteria 9172
214 Ga0207667_10233561 3300025949 Bacteria 1883
215 Ga0207651_10520297 3300025960 Bacteria 1031
216 Ga0207668_10560348 3300025972 Bacteria 991
217 Ga0207640_10347264 3300025981 Bacteria 1191
218 Ga0207640_10426694 3300025981 Bacteria 1086
219 Ga0207658_10131159 3300025986 Bacteria 2014
220 Ga0207658_10426996 3300025986 Bacteria 1170
221 Ga0207677_10263194 3300026023 Bacteria 1407
222 Ga0207677_10335672 3300026023 Bacteria 1261
223 Ga0207639_10003633 3300026041 Bacteria 10364
224 Ga0207639_10074921 3300026041 Bacteria 2660
225 Ga0207639_10237515 3300026041 Bacteria 1583
226 Ga0207639_10623712 3300026041 Bacteria 996
227 Ga0207639_10648729 3300026041 Bacteria 976
228 Ga0207678_10042004 3300026067 Bacteria 3963
229 Ga0207678_10483019 3300026067 Bacteria 1079
230 Ga0207678_11371755 3300026067 Bacteria 625
231 Ga0207702_10159074 3300026078 Bacteria 2062
232 Ga0207648_10230232 3300026089 Bacteria 1648
233 Ga0207648_10547741 3300026089 Bacteria 1062
234 Ga0207648_10813060 3300026089 Bacteria 870
235 Ga0207676_10231153 3300026095 Bacteria 1653
236 Ga0207674_10041320 3300026116 Bacteria 4770
237 Ga0207674_10662166 3300026116 Bacteria 1008
238 Ga0207675_100071829 3300026118 Bacteria 3236
239 Ga0207683_10186074 3300026121 Bacteria 1884
240 Ga0207698_10001488 3300026142 Bacteria 13640
241 Ga0207698_10468073 3300026142 Bacteria 1220
242 Ga0207698_10759551 3300026142 Bacteria 969
243 Ga0207698_12165879 3300026142 Bacteria 569
244 Ga0268266_10768708 3300028379 Bacteria 930
245 Ga0268265_10141750 3300028380 Bacteria 2013
246 Ga0265327_10000159 3300031251 Bacteria 145537
247 Ga0307513_10323845 3300031456 Bacteria 1298
248 Ga0307509_10069095 3300031507 Bacteria 3694
249 Ga0307509_10255098 3300031507 Bacteria 1534
250 Ga0307508_10166328 3300031616 Bacteria 1809
251 Ga0307516_10098863 3300031730 Bacteria 2736
252 Ga0307410_10986143 3300031852 Bacteria 726
253 Ga0307414_10413986 3300032004 Bacteria 1174
254 Ga0373937_0664117 3300036401 Unclassified 988
255 Ga0373937_1217456 3300036401 Bacteria 701
256 Ga0395899_0011094 3300037312 Bacteria 6901
257 Ga0395899_0022301 3300037312 Bacteria 4802
258 Ga0395899_0071444 3300037312 Bacteria 2540
259 Ga0395899_0159830 3300037312 Bacteria 1592
260 Ga0395900_0006742 3300037418 Bacteria 11915
261 Ga0395900_0019424 3300037418 Bacteria 6928
262 Ga0395900_0099960 3300037418 Bacteria 2979
263 Ga0395900_0198144 3300037418 Bacteria 2033
264 Ga0395900_0225788 3300037418 Bacteria 1885
265 Ga0395900_0413576 3300037418 Bacteria 1310
266 Ga0395900_0621585 3300037418 Bacteria 1019
267 Ga0395900_0896207 3300037418 Bacteria 810
268 Ga0395898_0003249 3300037466 Bacteria 18266
269 Ga0395898_0032202 3300037466 Bacteria 5232
270 Ga0395898_0069098 3300037466 Bacteria 3418
271 Ga0395898_0078589 3300037466 Bacteria 3183
272 Ga0395898_0351513 3300037466 Bacteria 1405
273 Ga0395905_0002823 3300037471 Bacteria 19037
274 Ga0395905_0201470 3300037471 Bacteria 1866
275 Ga0395905_0500356 3300037471 Bacteria 1115
276 Ga0395901_0001115 3300038443 Bacteria 28520
277 Ga0395901_0019788 3300038443 Bacteria 6884
278 Ga0395901_0100428 3300038443 Bacteria 3035
279 Ga0395901_0426996 3300038443 Bacteria 1358
280 Ga0395901_0477821 3300038443 Bacteria 1271
281 Ga0439436_0002536 3300041404 Bacteria 5487
282 Ga0439439_0001870 3300041406 Bacteria 4343
283 Ga0439439_0021251 3300041406 Bacteria 1617
284 Ga0451793_1448693 3300041452 Bacteria 1625
285 Ga0451798_0348107 3300041458 Bacteria 1257
286 Ga0451839_0575414 3300041496 Bacteria 693
287 Ga0451843_0329621 3300041509 Bacteria 1108
288 Ga0451843_0522221 3300041509 Bacteria 945
289 Ga0451855_1301843 3300041511 Bacteria 859
290 Ga0451855_1949235 3300041511 Bacteria 2167
291 Ga0451853_3320593 3300041512 Bacteria 768
292 Ga0439448_0166295 3300042005 Bacteria 769
293 Ga0439449_0005081 3300042007 Bacteria 5060
294 Ga0439457_000313 3300042014 Bacteria 13359
295 Ga0439462_0011770 3300042015 Bacteria 2230
296 Ga0451577_0000255 3300042876 Bacteria 105353
297 Ga0466972_0000025 3300044658 Bacteria 186601
298 Ga0466972_0022492 3300044658 Bacteria 3139
299 Ga0466972_0053778 3300044658 Bacteria 1938
300 Ga0453683_0101992 3300044673 Unclassified 1802
301 Ga0453684_0000024 3300044712 Bacteria 819351
302 Ga0453684_0001121 3300044712 Bacteria 83919
303 Ga0453684_0054508 3300044712 Bacteria 5208
304 Ga0453684_0088184 3300044712 Bacteria 3842
305 Ga0466970_0005458 3300044765 Bacteria 6310
306 Ga0451576_0358289 3300045051 Unclassified 1527
307 Ga0495650_0000023 3300046471 Bacteria 527763
308 Ga0495605_0260613 3300046474 Bacteria 740
309 Ga0495585_0000476 3300046492 Bacteria 38316
310 Ga0495606_0003554 3300046507 Bacteria 16456
311 Ga0495606_0034482 3300046507 Bacteria 3474
312 Ga0495616_0004967 3300046513 Bacteria 8301
313 Ga0495630_0122515 3300046517 Bacteria 1973
314 Ga0495609_0095147 3300046538 Bacteria 1293
315 Ga0495668_0000191 3300046616 Bacteria 90923
316 Ga0495625_0000308 3300046660 Bacteria 74661
317 Ga0495661_0085204 3300046665 Bacteria 1811
318 Ga0495658_0037001 3300046683 Bacteria 2696
319 Ga0495670_0102739 3300046691 Bacteria 1473
320 Ga0495649_0000105 3300046694 Bacteria 74750
321 Ga0495600_0159053 3300046809 Bacteria 1461
322 Ga0495660_0155172 3300046810 Bacteria 1127
323 Ga0495672_0064063 3300047320 Bacteria 2106
324 Ga0495687_007622 3300047443 Bacteria 6340
325 Ga0495684_0154773 3300047471 Bacteria 1713
326 Ga0495686_0087827 3300047472 Bacteria 1891
327 Ga0496114_0425792 3300048917 Bacteria 1176
328 Ga0496121_0000030 3300048924 Bacteria 412079
329 Ga0501306_015441 3300049127 Bacteria 1016
330 Ga0501304_011291 3300049160 Bacteria 793
331 Ga0501334_03562 3300049550 Bacteria 969
332 Ga0501032_0017627 3300049569 Bacteria 5013
333 Ga0501033_0014327 3300049570 Bacteria 6026
334 Ga0501033_0681780 3300049570 Unclassified 700
335 Ga0501034_0008562 3300049571 Bacteria 10800
336 Ga0501034_0014513 3300049571 Bacteria 8112
337 Ga0501034_0155410 3300049571 Bacteria 2261
338 Ga0501034_0578112 3300049571 Bacteria 1031
339 Ga0501034_0942483 3300049571 Unclassified 749
340 Ga0501034_1251699 3300049571 Bacteria 620
341 Ga0501036_0012794 3300049572 Bacteria 6962
342 Ga0501037_0049107 3300049573 Bacteria 3090
343 Ga0501037_0331173 3300049573 Bacteria 1053
344 Ga0501038_0048422 3300049574 Bacteria 3678
345 Ga0501043_0013582 3300049579 Bacteria 6372
346 Ga0501043_0020173 3300049579 Bacteria 5233
347 Ga0501046_0034907 3300049580 Bacteria 4056
348 Ga0501047_0033543 3300049581 Bacteria 4955
349 Ga0501047_0066057 3300049581 Bacteria 3487
350 Ga0501047_0184402 3300049581 Bacteria 1952
351 Ga0501047_0261462 3300049581 Bacteria 1578
352 Ga0501048_0368444 3300049582 Bacteria 1025
353 Ga0501067_0063339 3300049583 Bacteria 2047
354 Ga0501069_0033598 3300049585 Bacteria 2825
355 Ga0501070_0177310 3300049586 Bacteria 1754
356 Ga0501070_0206828 3300049586 Bacteria 1611
357 Ga0501074_0137479 3300049590 Bacteria 1748
358 Ga0501219_000547 3300049703 Bacteria 5514
359 Ga0501225_0046238 3300049705 Bacteria 1206
360 Ga0501035_0003082 3300049822 Bacteria 16002
361 Ga0501035_1199321 3300049822 Unclassified 589
362 Ga0501044_0004256 3300049823 Bacteria 16057
363 Ga0501044_0018063 3300049823 Bacteria 7563
364 Ga0501044_0423971 3300049823 Bacteria 1240
365 Ga0501044_0605995 3300049823 Bacteria 988
366 Ga0501284_00138 3300050005 Bacteria 9008
367 nmdc:mga0k408_158598_c1 3300050493 Bacteria 1348
368 nmdc:mga0k408_202233_c1 3300050493 Bacteria 1186
369 nmdc:mga0k408_515530_c1 3300050493 Bacteria 708
370 nmdc:mga0k408_91126_c1 3300050493 Bacteria 1791
371 nmdc:mga09592_300612_c1 3300050508 Bacteria 1391
372 nmdc:mga08y16_507204_c1 3300050511 Bacteria 1225
373 nmdc:mga08y16_973027_c1 3300050511 Bacteria 830
374 Ga0500578_0000136 3300053086 Bacteria 88612
375 Ga0500578_0260307 3300053086 Bacteria 1042
376 Ga0500583_0000127 3300053092 Bacteria 35082
377 Ga0500651_0268990 3300053093 Bacteria 986
378 Ga0500650_0026236 3300053098 Bacteria 2613
379 Ga0500556_0073636 3300053104 Bacteria 1280
380 Ga0500572_017338 3300053111 Bacteria 1849
381 Ga0500594_0017219 3300053118 Bacteria 1766
382 Ga0500618_026316 3300053125 Bacteria 1389
383 Ga0500652_027328 3300053131 Bacteria 2205
384 Ga0500579_171622 3300053143 Bacteria 881
385 Ga0500588_0129162 3300053146 Bacteria 898
386 Ga0500622_0000156 3300053156 Bacteria 71907
387 Ga0500636_0028146 3300053177 Bacteria 3320
388 Ga0500584_135541 3300053726 Bacteria 949
389 Ga0587086_007525 3300059507 Bacteria 1251
390 Ga0587106_062944 3300059605 Bacteria 686
391 Ga0587109_007634 3300059624 Bacteria 1641
392 Ga0587068_014796 3300059641 Bacteria 1220
393 Ga0587076_006311 3300059645 Bacteria 1575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_12165879 Ga0207698_121658791 161
2 3300049571 Ga0501034_0014513 Ga0501034_0014513_7605_8090 161
3 3300013102 Ga0157371_10441603 Ga0157371_104416031 163
4 3300048924 Ga0496121_0000030 Ga0496121_0000030_211937_212491 164
5 3300036401 Ga0373937_1217456 Ga0373937_1217456_37_537 166
6 3300041512 Ga0451853_3320593 Ga0451853_3320593_258_758 166
7 3300049571 Ga0501034_1251699 Ga0501034_1251699_53_553 166
8 3300049579 Ga0501043_0020173 Ga0501043_0020173_2577_3077 166
9 3300049823 Ga0501044_0423971 Ga0501044_0423971_75_575 166
10 3300050511 nmdc:mga08y16_973027_c1 nmdc:mga08y16_973027_c1_19_519 166
11 3300005337 Ga0070682_100011807 Ga0070682_1000118072 174
12 3300005339 Ga0070660_100018370 Ga0070660_1000183709 174
13 3300005530 Ga0070679_100001469 Ga0070679_10000146912 174
14 3300005616 Ga0068852_100001428 Ga0068852_10000142810 174
15 3300010375 Ga0105239_10435509 Ga0105239_104355092 174
16 3300013307 Ga0157372_10077350 Ga0157372_100773505 174
17 3300025909 Ga0207705_10003791 Ga0207705_100037918 174
18 3300025944 Ga0207661_10225808 Ga0207661_102258081 174
19 3300026041 Ga0207639_10237515 Ga0207639_102375153 174
20 3300026142 Ga0207698_10001488 Ga0207698_100014887 174
21 3300026142 Ga0207698_10759551 Ga0207698_107595512 174
22 3300044712 Ga0453684_0001121 Ga0453684_0001121_50582_51136 176
23 3300042876 Ga0451577_0000255 Ga0451577_0000255_82863_83408 180
24 3300044712 Ga0453684_0000024 Ga0453684_0000024_293618_294163 180
25 iso_pu_bacteria 2818991444 2819590256 180
26 iso_pu_bacteria 2821136567 2821136757 180
27 iso_pu_bacteria 2904467357 2904468498 180
28 3300044673 Ga0453683_0101992 Ga0453683_0101992_147_692 181
29 3300045051 Ga0451576_0358289 Ga0451576_0358289_879_1424 181
30 iso_pu_bacteria 2932082852 2932085023 181
31 3300041511 Ga0451855_1949235 Ga0451855_1949235_349_906 182
32 3300005548 Ga0070665_100392646 Ga0070665_1003926462 183
33 3300044712 Ga0453684_0088184 Ga0453684_0088184_253_804 183
34 3300003316 rootH1_10047247 rootH1_100472473 184
35 3300003322 rootL2_10209350 rootL2_102093502 184
36 3300003323 rootH1_10097575 rootH1_100975756 184
37 3300005293 Ga0065715_10190231 Ga0065715_101902312 184
38 3300005327 Ga0070658_10036030 Ga0070658_100360306 184
39 3300005327 Ga0070658_10050877 Ga0070658_100508774 184
40 3300005327 Ga0070658_10105914 Ga0070658_101059141 184
41 3300005327 Ga0070658_10111943 Ga0070658_101119431 184
42 3300005329 Ga0070683_101540396 Ga0070683_1015403961 184
43 3300005331 Ga0070670_100074532 Ga0070670_1000745323 184
44 3300005331 Ga0070670_100813313 Ga0070670_1008133131 184
45 3300005334 Ga0068869_100050260 Ga0068869_1000502603 184
46 3300005336 Ga0070680_100009085 Ga0070680_1000090854 184
47 3300005336 Ga0070680_100032060 Ga0070680_1000320609 184
48 3300005337 Ga0070682_100490037 Ga0070682_1004900371 184
49 3300005338 Ga0068868_100416100 Ga0068868_1004161001 184
50 3300005339 Ga0070660_100003216 Ga0070660_1000032166 184
51 3300005339 Ga0070660_100124448 Ga0070660_1001244483 184
52 3300005339 Ga0070660_100125866 Ga0070660_1001258664 184
53 3300005339 Ga0070660_100324117 Ga0070660_1003241172 184
54 3300005344 Ga0070661_100199061 Ga0070661_1001990611 184
55 3300005347 Ga0070668_100824147 Ga0070668_1008241472 184
56 3300005354 Ga0070675_100081497 Ga0070675_1000814972 184
57 3300005356 Ga0070674_100046466 Ga0070674_1000464662 184
58 3300005364 Ga0070673_100611256 Ga0070673_1006112562 184
59 3300005366 Ga0070659_100012587 Ga0070659_10001258712 184
60 3300005366 Ga0070659_100034080 Ga0070659_1000340804 184
61 3300005366 Ga0070659_100393479 Ga0070659_1003934792 184
62 3300005367 Ga0070667_100438079 Ga0070667_1004380792 184
63 3300005367 Ga0070667_100764814 Ga0070667_1007648141 184
64 3300005367 Ga0070667_100853323 Ga0070667_1008533231 184
65 3300005455 Ga0070663_100485210 Ga0070663_1004852102 184
66 3300005455 Ga0070663_101315181 Ga0070663_1013151811 184
67 3300005456 Ga0070678_100172179 Ga0070678_1001721791 184
68 3300005458 Ga0070681_10007373 Ga0070681_100073732 184
69 3300005458 Ga0070681_10082340 Ga0070681_100823404 184
70 3300005458 Ga0070681_10104396 Ga0070681_101043962 184
71 3300005458 Ga0070681_10227885 Ga0070681_102278851 184
72 3300005471 Ga0070698_100838898 Ga0070698_1008388981 184
73 3300005530 Ga0070679_100000558 Ga0070679_10000055836 184
74 3300005530 Ga0070679_100075980 Ga0070679_1000759804 184
75 3300005530 Ga0070679_100149611 Ga0070679_1001496114 184
76 3300005530 Ga0070679_100237874 Ga0070679_1002378742 184
77 3300005530 Ga0070679_100638396 Ga0070679_1006383961 184
78 3300005535 Ga0070684_100308203 Ga0070684_1003082032 184
79 3300005539 Ga0068853_100024566 Ga0068853_1000245664 184
80 3300005539 Ga0068853_100239261 Ga0068853_1002392612 184
81 3300005539 Ga0068853_100300731 Ga0068853_1003007312 184
82 3300005539 Ga0068853_100596126 Ga0068853_1005961262 184
83 3300005543 Ga0070672_100337374 Ga0070672_1003373742 184
84 3300005543 Ga0070672_100414873 Ga0070672_1004148731 184
85 3300005563 Ga0068855_100000943 Ga0068855_10000094322 184
86 3300005563 Ga0068855_100002973 Ga0068855_10000297323 184
87 3300005563 Ga0068855_100035596 Ga0068855_1000355966 184
88 3300005563 Ga0068855_100133466 Ga0068855_1001334666 184
89 3300005563 Ga0068855_100207210 Ga0068855_1002072102 184
90 3300005563 Ga0068855_100409917 Ga0068855_1004099171 184
91 3300005564 Ga0070664_100258683 Ga0070664_1002586833 184
92 3300005578 Ga0068854_100042884 Ga0068854_1000428842 184
93 3300005578 Ga0068854_100617702 Ga0068854_1006177022 184
94 3300005614 Ga0068856_100046597 Ga0068856_1000465979 184
95 3300005616 Ga0068852_100133887 Ga0068852_1001338875 184
96 3300005616 Ga0068852_100423973 Ga0068852_1004239732 184
97 3300005617 Ga0068859_100020784 Ga0068859_1000207846 184
98 3300005617 Ga0068859_100388178 Ga0068859_1003881783 184
99 3300005719 Ga0068861_100217732 Ga0068861_1002177324 184
100 3300005834 Ga0068851_10025528 Ga0068851_100255287 184
101 3300005834 Ga0068851_10062341 Ga0068851_100623412 184
102 3300005840 Ga0068870_10479351 Ga0068870_104793511 184
103 3300005840 Ga0068870_10580401 Ga0068870_105804012 184
104 3300005841 Ga0068863_100560499 Ga0068863_1005604992 184
105 3300005843 Ga0068860_100008499 Ga0068860_1000084999 184
106 3300005843 Ga0068860_100664914 Ga0068860_1006649142 184
107 3300005844 Ga0068862_100016969 Ga0068862_1000169693 184
108 3300005844 Ga0068862_100674765 Ga0068862_1006747652 184
109 3300005844 Ga0068862_100880612 Ga0068862_1008806121 184
110 3300005983 Ga0081540_1017421 Ga0081540_10174216 184
111 3300006195 Ga0075366_10062800 Ga0075366_100628004 184
112 3300006195 Ga0075366_10097627 Ga0075366_100976272 184
113 3300006195 Ga0075366_10428134 Ga0075366_104281342 184
114 3300006237 Ga0097621_100028342 Ga0097621_1000283421 184
115 3300006358 Ga0068871_100252352 Ga0068871_1002523522 184
116 3300006358 Ga0068871_100559711 Ga0068871_1005597111 184
117 3300006880 Ga0075429_100381858 Ga0075429_1003818582 184
118 3300006931 Ga0097620_100020785 Ga0097620_1000207856 184
119 3300006931 Ga0097620_100388215 Ga0097620_1003882152 184
120 3300009093 Ga0105240_10050909 Ga0105240_100509098 184
121 3300009093 Ga0105240_10143798 Ga0105240_101437986 184
122 3300009094 Ga0111539_10037511 Ga0111539_100375118 184
123 3300009094 Ga0111539_10881632 Ga0111539_108816322 184
124 3300009174 Ga0105241_10017181 Ga0105241_1001718110 184
125 3300009176 Ga0105242_10041358 Ga0105242_100413584 184
126 3300009545 Ga0105237_10030357 Ga0105237_100303572 184
127 3300009553 Ga0105249_10287856 Ga0105249_102878562 184
128 3300010375 Ga0105239_10041952 Ga0105239_100419528 184
129 3300011119 Ga0105246_10130981 Ga0105246_101309812 184
130 3300013100 Ga0157373_10005189 Ga0157373_1000518910 184
131 3300013100 Ga0157373_10009541 Ga0157373_100095419 184
132 3300013100 Ga0157373_10017909 Ga0157373_100179096 184
133 3300013100 Ga0157373_10142714 Ga0157373_101427143 184
134 3300013100 Ga0157373_10219775 Ga0157373_102197751 184
135 3300013100 Ga0157373_10328257 Ga0157373_103282571 184
136 3300013102 Ga0157371_10001816 Ga0157371_1000181610 184
137 3300013102 Ga0157371_10004257 Ga0157371_100042574 184
138 3300013102 Ga0157371_10005830 Ga0157371_100058308 184
139 3300013102 Ga0157371_10010677 Ga0157371_100106775 184
140 3300013102 Ga0157371_10017891 Ga0157371_100178917 184
141 3300013102 Ga0157371_10021400 Ga0157371_1002140010 184
142 3300013102 Ga0157371_10030995 Ga0157371_100309953 184
143 3300013102 Ga0157371_10100443 Ga0157371_101004431 184
144 3300013102 Ga0157371_10146020 Ga0157371_101460201 184
145 3300013102 Ga0157371_10290064 Ga0157371_102900641 184
146 3300013104 Ga0157370_10000926 Ga0157370_1000092617 184
147 3300013104 Ga0157370_10009487 Ga0157370_100094874 184
148 3300013104 Ga0157370_10178488 Ga0157370_101784883 184
149 3300013104 Ga0157370_10257424 Ga0157370_102574242 184
150 3300013104 Ga0157370_10363542 Ga0157370_103635422 184
151 3300013104 Ga0157370_10900012 Ga0157370_109000121 184
152 3300013105 Ga0157369_10015072 Ga0157369_1001507214 184
153 3300013105 Ga0157369_10026567 Ga0157369_100265678 184
154 3300013105 Ga0157369_10111355 Ga0157369_101113552 184
155 3300013105 Ga0157369_10231290 Ga0157369_102312904 184
156 3300013105 Ga0157369_10757446 Ga0157369_107574462 184
157 3300013296 Ga0157374_10055091 Ga0157374_100550916 184
158 3300013297 Ga0157378_10255889 Ga0157378_102558894 184
159 3300013297 Ga0157378_10295469 Ga0157378_102954693 184
160 3300013297 Ga0157378_10672115 Ga0157378_106721152 184
161 3300013306 Ga0163162_10007765 Ga0163162_1000776510 184
162 3300013306 Ga0163162_10449985 Ga0163162_104499852 184
163 3300013306 Ga0163162_11461278 Ga0163162_114612781 184
164 3300013307 Ga0157372_10009847 Ga0157372_100098477 184
165 3300013307 Ga0157372_10023315 Ga0157372_100233158 184
166 3300013307 Ga0157372_10027520 Ga0157372_100275205 184
167 3300013307 Ga0157372_10047593 Ga0157372_100475937 184
168 3300013307 Ga0157372_10209948 Ga0157372_102099481 184
169 3300013307 Ga0157372_10243386 Ga0157372_102433864 184
170 3300013307 Ga0157372_10578107 Ga0157372_105781071 184
171 3300013307 Ga0157372_10615210 Ga0157372_106152102 184
172 3300013307 Ga0157372_11419232 Ga0157372_114192322 184
173 3300013307 Ga0157372_11540859 Ga0157372_115408591 184
174 3300013307 Ga0157372_11958088 Ga0157372_119580881 184
175 3300013308 Ga0157375_10189384 Ga0157375_101893841 184
176 3300013308 Ga0157375_10280646 Ga0157375_102806463 184
177 3300014325 Ga0163163_12204441 Ga0163163_122044411 184
178 3300014745 Ga0157377_10741144 Ga0157377_107411441 184
179 3300014968 Ga0157379_10241135 Ga0157379_102411352 184
180 3300014969 Ga0157376_10255777 Ga0157376_102557773 184
181 3300014969 Ga0157376_10496149 Ga0157376_104961491 184
182 3300017792 Ga0163161_10143269 Ga0163161_101432694 184
183 3300025246 Ga0209646_1001707 Ga0209646_10017076 184
184 3300025297 Ga0209758_1115228 Ga0209758_11152281 184
185 3300025321 Ga0207656_10064483 Ga0207656_100644833 184
186 3300025893 Ga0207682_10285264 Ga0207682_102852641 184
187 3300025904 Ga0207647_10042359 Ga0207647_100423593 184
188 3300025904 Ga0207647_10470534 Ga0207647_104705341 184
189 3300025908 Ga0207643_10409242 Ga0207643_104092421 184
190 3300025908 Ga0207643_10509848 Ga0207643_105098482 184
191 3300025909 Ga0207705_10011169 Ga0207705_1001116910 184
192 3300025909 Ga0207705_10022689 Ga0207705_1002268910 184
193 3300025909 Ga0207705_10043781 Ga0207705_100437813 184
194 3300025909 Ga0207705_10187616 Ga0207705_101876161 184
195 3300025911 Ga0207654_10116685 Ga0207654_101166852 184
196 3300025912 Ga0207707_10026248 Ga0207707_1002624810 184
197 3300025912 Ga0207707_10142862 Ga0207707_101428622 184
198 3300025912 Ga0207707_10219710 Ga0207707_102197103 184
199 3300025913 Ga0207695_10004647 Ga0207695_1000464712 184
200 3300025914 Ga0207671_10065906 Ga0207671_100659062 184
201 3300025917 Ga0207660_10031422 Ga0207660_100314226 184
202 3300025917 Ga0207660_10039446 Ga0207660_100394463 184
203 3300025917 Ga0207660_10177060 Ga0207660_101770601 184
204 3300025919 Ga0207657_10021530 Ga0207657_100215308 184
205 3300025919 Ga0207657_10085929 Ga0207657_100859295 184
206 3300025919 Ga0207657_10115306 Ga0207657_101153062 184
207 3300025919 Ga0207657_10223073 Ga0207657_102230731 184
208 3300025919 Ga0207657_10302848 Ga0207657_103028482 184
209 3300025919 Ga0207657_10334045 Ga0207657_103340451 184
210 3300025921 Ga0207652_10000064 Ga0207652_1000006478 184
211 3300025921 Ga0207652_10000387 Ga0207652_1000038746 184
212 3300025921 Ga0207652_10022903 Ga0207652_100229039 184
213 3300025921 Ga0207652_10025804 Ga0207652_100258044 184
214 3300025921 Ga0207652_10068289 Ga0207652_100682894 184
215 3300025921 Ga0207652_10103594 Ga0207652_101035944 184
216 3300025925 Ga0207650_10045585 Ga0207650_100455852 184
217 3300025925 Ga0207650_10671490 Ga0207650_106714901 184
218 3300025925 Ga0207650_11420659 Ga0207650_114206591 184
219 3300025926 Ga0207659_10243762 Ga0207659_102437623 184
220 3300025932 Ga0207690_10132521 Ga0207690_101325212 184
221 3300025932 Ga0207690_10151125 Ga0207690_101511253 184
222 3300025937 Ga0207669_10039771 Ga0207669_100397715 184
223 3300025939 Ga0207665_10597801 Ga0207665_105978012 184
224 3300025942 Ga0207689_10006806 Ga0207689_100068068 184
225 3300025942 Ga0207689_10245186 Ga0207689_102451863 184
226 3300025949 Ga0207667_10001484 Ga0207667_1000148420 184
227 3300025949 Ga0207667_10005923 Ga0207667_100059239 184
228 3300025949 Ga0207667_10013969 Ga0207667_1001396913 184
229 3300025949 Ga0207667_10233561 Ga0207667_102335613 184
230 3300025960 Ga0207651_10520297 Ga0207651_105202972 184
231 3300025972 Ga0207668_10560348 Ga0207668_105603482 184
232 3300025981 Ga0207640_10347264 Ga0207640_103472642 184
233 3300025981 Ga0207640_10426694 Ga0207640_104266942 184
234 3300025986 Ga0207658_10131159 Ga0207658_101311594 184
235 3300025986 Ga0207658_10426996 Ga0207658_104269962 184
236 3300026023 Ga0207677_10263194 Ga0207677_102631942 184
237 3300026023 Ga0207677_10335672 Ga0207677_103356721 184
238 3300026041 Ga0207639_10003633 Ga0207639_100036336 184
239 3300026041 Ga0207639_10074921 Ga0207639_100749215 184
240 3300026041 Ga0207639_10623712 Ga0207639_106237121 184
241 3300026041 Ga0207639_10648729 Ga0207639_106487292 184
242 3300026067 Ga0207678_10042004 Ga0207678_100420046 184
243 3300026067 Ga0207678_10483019 Ga0207678_104830192 184
244 3300026067 Ga0207678_11371755 Ga0207678_113717551 184
245 3300026078 Ga0207702_10159074 Ga0207702_101590741 184
246 3300026089 Ga0207648_10230232 Ga0207648_102302323 184
247 3300026089 Ga0207648_10547741 Ga0207648_105477411 184
248 3300026089 Ga0207648_10813060 Ga0207648_108130602 184
249 3300026095 Ga0207676_10231153 Ga0207676_102311533 184
250 3300026116 Ga0207674_10041320 Ga0207674_100413203 184
251 3300026116 Ga0207674_10662166 Ga0207674_106621661 184
252 3300026118 Ga0207675_100071829 Ga0207675_1000718292 184
253 3300026121 Ga0207683_10186074 Ga0207683_101860744 184
254 3300026142 Ga0207698_10468073 Ga0207698_104680733 184
255 3300028379 Ga0268266_10768708 Ga0268266_107687082 184
256 3300028380 Ga0268265_10141750 Ga0268265_101417503 184
257 3300031251 Ga0265327_10000159 Ga0265327_1000015923 184
258 3300031456 Ga0307513_10323845 Ga0307513_103238451 184
259 3300031507 Ga0307509_10069095 Ga0307509_100690956 184
260 3300031507 Ga0307509_10255098 Ga0307509_102550983 184
261 3300031616 Ga0307508_10166328 Ga0307508_101663283 184
262 3300031730 Ga0307516_10098863 Ga0307516_100988634 184
263 3300031852 Ga0307410_10986143 Ga0307410_109861431 184
264 3300032004 Ga0307414_10413986 Ga0307414_104139862 184
265 3300036401 Ga0373937_0664117 Ga0373937_0664117_189_743 184
266 3300037312 Ga0395899_0011094 Ga0395899_0011094_5253_5855 184
267 3300037312 Ga0395899_0022301 Ga0395899_0022301_1625_2179 184
268 3300037312 Ga0395899_0071444 Ga0395899_0071444_195_749 184
269 3300037312 Ga0395899_0159830 Ga0395899_0159830_638_1192 184
270 3300037418 Ga0395900_0006742 Ga0395900_0006742_10539_11093 184
271 3300037418 Ga0395900_0019424 Ga0395900_0019424_431_985 184
272 3300037418 Ga0395900_0099960 Ga0395900_0099960_2363_2965 184
273 3300037418 Ga0395900_0198144 Ga0395900_0198144_638_1192 184
274 3300037418 Ga0395900_0225788 Ga0395900_0225788_160_714 184
275 3300037418 Ga0395900_0413576 Ga0395900_0413576_373_927 184
276 3300037418 Ga0395900_0621585 Ga0395900_0621585_124_678 184
277 3300037418 Ga0395900_0896207 Ga0395900_0896207_22_576 184
278 3300037466 Ga0395898_0003249 Ga0395898_0003249_5079_5633 184
279 3300037466 Ga0395898_0032202 Ga0395898_0032202_803_1405 184
280 3300037466 Ga0395898_0069098 Ga0395898_0069098_2461_3015 184
281 3300037466 Ga0395898_0078589 Ga0395898_0078589_1394_1948 184
282 3300037466 Ga0395898_0351513 Ga0395898_0351513_22_576 184
283 3300037471 Ga0395905_0002823 Ga0395905_0002823_8187_8741 184
284 3300037471 Ga0395905_0201470 Ga0395905_0201470_1129_1683 184
285 3300037471 Ga0395905_0500356 Ga0395905_0500356_325_879 184
286 3300038443 Ga0395901_0001115 Ga0395901_0001115_7954_8508 184
287 3300038443 Ga0395901_0019788 Ga0395901_0019788_4547_5101 184
288 3300038443 Ga0395901_0100428 Ga0395901_0100428_196_798 184
289 3300038443 Ga0395901_0426996 Ga0395901_0426996_243_797 184
290 3300038443 Ga0395901_0477821 Ga0395901_0477821_372_926 184
291 3300041404 Ga0439436_0002536 Ga0439436_0002536_4564_5118 184
292 3300041406 Ga0439439_0001870 Ga0439439_0001870_1147_1701 184
293 3300041406 Ga0439439_0021251 Ga0439439_0021251_420_974 184
294 3300041452 Ga0451793_1448693 Ga0451793_1448693_100_654 184
295 3300041458 Ga0451798_0348107 Ga0451798_0348107_97_651 184
296 3300041496 Ga0451839_0575414 Ga0451839_0575414_90_644 184
297 3300041509 Ga0451843_0329621 Ga0451843_0329621_465_1019 184
298 3300041509 Ga0451843_0522221 Ga0451843_0522221_342_896 184
299 3300041511 Ga0451855_1301843 Ga0451855_1301843_283_837 184
300 3300042005 Ga0439448_0166295 Ga0439448_0166295_124_678 184
301 3300042007 Ga0439449_0005081 Ga0439449_0005081_2758_3312 184
302 3300042014 Ga0439457_000313 Ga0439457_000313_3622_4176 184
303 3300042015 Ga0439462_0011770 Ga0439462_0011770_361_915 184
304 3300044658 Ga0466972_0000025 Ga0466972_0000025_103042_103596 184
305 3300044658 Ga0466972_0022492 Ga0466972_0022492_231_785 184
306 3300044658 Ga0466972_0053778 Ga0466972_0053778_387_941 184
307 3300044765 Ga0466970_0005458 Ga0466970_0005458_5158_5712 184
308 3300046517 Ga0495630_0122515 Ga0495630_0122515_430_984 184
309 3300046616 Ga0495668_0000191 Ga0495668_0000191_48878_49432 184
310 3300046683 Ga0495658_0037001 Ga0495658_0037001_1357_1911 184
311 3300046691 Ga0495670_0102739 Ga0495670_0102739_107_661 184
312 3300046809 Ga0495600_0159053 Ga0495600_0159053_550_1104 184
313 3300047320 Ga0495672_0064063 Ga0495672_0064063_926_1480 184
314 3300047471 Ga0495684_0154773 Ga0495684_0154773_384_938 184
315 3300048917 Ga0496114_0425792 Ga0496114_0425792_201_755 184
316 3300049127 Ga0501306_015441 Ga0501306_015441_341_895 184
317 3300049160 Ga0501304_011291 Ga0501304_011291_144_698 184
318 3300049550 Ga0501334_03562 Ga0501334_03562_180_734 184
319 3300049569 Ga0501032_0017627 Ga0501032_0017627_3162_3716 184
320 3300049570 Ga0501033_0014327 Ga0501033_0014327_3536_4090 184
321 3300049570 Ga0501033_0681780 Ga0501033_0681780_82_636 184
322 3300049571 Ga0501034_0008562 Ga0501034_0008562_5190_5744 184
323 3300049571 Ga0501034_0155410 Ga0501034_0155410_320_874 184
324 3300049571 Ga0501034_0578112 Ga0501034_0578112_286_840 184
325 3300049571 Ga0501034_0942483 Ga0501034_0942483_64_618 184
326 3300049572 Ga0501036_0012794 Ga0501036_0012794_481_1035 184
327 3300049573 Ga0501037_0049107 Ga0501037_0049107_2469_3023 184
328 3300049573 Ga0501037_0331173 Ga0501037_0331173_41_595 184
329 3300049574 Ga0501038_0048422 Ga0501038_0048422_2380_2934 184
330 3300049579 Ga0501043_0013582 Ga0501043_0013582_1762_2316 184
331 3300049580 Ga0501046_0034907 Ga0501046_0034907_2434_2988 184
332 3300049581 Ga0501047_0033543 Ga0501047_0033543_808_1362 184
333 3300049581 Ga0501047_0066057 Ga0501047_0066057_694_1248 184
334 3300049581 Ga0501047_0184402 Ga0501047_0184402_1364_1918 184
335 3300049581 Ga0501047_0261462 Ga0501047_0261462_270_824 184
336 3300049582 Ga0501048_0368444 Ga0501048_0368444_317_871 184
337 3300049583 Ga0501067_0063339 Ga0501067_0063339_1185_1739 184
338 3300049585 Ga0501069_0033598 Ga0501069_0033598_1194_1748 184
339 3300049586 Ga0501070_0177310 Ga0501070_0177310_733_1287 184
340 3300049586 Ga0501070_0206828 Ga0501070_0206828_864_1418 184
341 3300049590 Ga0501074_0137479 Ga0501074_0137479_932_1486 184
342 3300049703 Ga0501219_000547 Ga0501219_000547_1627_2181 184
343 3300049705 Ga0501225_0046238 Ga0501225_0046238_46_600 184
344 3300049822 Ga0501035_0003082 Ga0501035_0003082_11924_12478 184
345 3300049822 Ga0501035_1199321 Ga0501035_1199321_17_571 184
346 3300049823 Ga0501044_0004256 Ga0501044_0004256_1171_1725 184
347 3300049823 Ga0501044_0018063 Ga0501044_0018063_5587_6141 184
348 3300049823 Ga0501044_0605995 Ga0501044_0605995_403_957 184
349 3300050005 Ga0501284_00138 Ga0501284_00138_5412_5966 184
350 3300050493 nmdc:mga0k408_158598_c1 nmdc:mga0k408_158598_c1_221_775 184
351 3300050493 nmdc:mga0k408_202233_c1 nmdc:mga0k408_202233_c1_190_744 184
352 3300050493 nmdc:mga0k408_515530_c1 nmdc:mga0k408_515530_c1_107_661 184
353 3300050493 nmdc:mga0k408_91126_c1 nmdc:mga0k408_91126_c1_820_1374 184
354 3300050508 nmdc:mga09592_300612_c1 nmdc:mga09592_300612_c1_697_1251 184
355 3300050511 nmdc:mga08y16_507204_c1 nmdc:mga08y16_507204_c1_76_630 184
356 3300053086 Ga0500578_0000136 Ga0500578_0000136_7304_7858 184
357 3300053086 Ga0500578_0260307 Ga0500578_0260307_17_571 184
358 3300053092 Ga0500583_0000127 Ga0500583_0000127_1568_2122 184
359 3300053093 Ga0500651_0268990 Ga0500651_0268990_271_825 184
360 3300053098 Ga0500650_0026236 Ga0500650_0026236_1765_2319 184
361 3300053104 Ga0500556_0073636 Ga0500556_0073636_656_1210 184
362 3300053111 Ga0500572_017338 Ga0500572_017338_797_1351 184
363 3300053118 Ga0500594_0017219 Ga0500594_0017219_816_1370 184
364 3300053131 Ga0500652_027328 Ga0500652_027328_1457_2011 184
365 3300053143 Ga0500579_171622 Ga0500579_171622_291_845 184
366 3300053146 Ga0500588_0129162 Ga0500588_0129162_101_655 184
367 3300053156 Ga0500622_0000156 Ga0500622_0000156_39762_40316 184
368 3300053177 Ga0500636_0028146 Ga0500636_0028146_598_1152 184
369 3300053726 Ga0500584_135541 Ga0500584_135541_329_883 184
370 3300059507 Ga0587086_007525 Ga0587086_007525_685_1239 184
371 3300059605 Ga0587106_062944 Ga0587106_062944_26_580 184
372 3300059624 Ga0587109_007634 Ga0587109_007634_844_1398 184
373 3300059641 Ga0587068_014796 Ga0587068_014796_271_825 184
374 3300059645 Ga0587076_006311 Ga0587076_006311_592_1146 184
375 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003350 185
376 3300013104 Ga0157370_10006378 Ga0157370_100063786 185
377 3300013104 Ga0157370_10183669 Ga0157370_101836695 185
378 3300013307 Ga0157372_10011651 Ga0157372_1001165110 185
379 3300020069 Ga0197907_11497399 Ga0197907_114973992 185
380 3300020077 Ga0206351_10267476 Ga0206351_1026747614 185
381 3300020610 Ga0154015_1410599 Ga0154015_14105998 185
382 3300025940 Ga0207691_10782800 Ga0207691_107828001 185
383 3300044712 Ga0453684_0054508 Ga0453684_0054508_1742_2299 185
384 3300046471 Ga0495650_0000023 Ga0495650_0000023_56126_56683 185
385 3300046474 Ga0495605_0260613 Ga0495605_0260613_143_700 185
386 3300046492 Ga0495585_0000476 Ga0495585_0000476_31176_31733 185
387 3300046507 Ga0495606_0003554 Ga0495606_0003554_111_668 185
388 3300046507 Ga0495606_0034482 Ga0495606_0034482_1093_1650 185
389 3300046513 Ga0495616_0004967 Ga0495616_0004967_1069_1626 185
390 3300046538 Ga0495609_0095147 Ga0495609_0095147_690_1247 185
391 3300046660 Ga0495625_0000308 Ga0495625_0000308_15694_16251 185
392 3300046665 Ga0495661_0085204 Ga0495661_0085204_935_1492 185
393 3300046694 Ga0495649_0000105 Ga0495649_0000105_58501_59058 185
394 3300046810 Ga0495660_0155172 Ga0495660_0155172_30_587 185
395 3300047443 Ga0495687_007622 Ga0495687_007622_4853_5410 185
396 3300047472 Ga0495686_0087827 Ga0495686_0087827_1161_1718 185
397 3300053125 Ga0500618_026316 Ga0500618_026316_400_957 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

107

186

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

27

99

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.91 2 179
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.9051 2 179
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.8932 5 180
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.8883 5 180
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.8846 9 177
ID Description Score Start End Superfamily
4io9E01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9328 5 83 3.90.930.12
2zjqE01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9229 5 83 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9222 2 83 3.90.930.12
4io9E01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9217 5 83 3.90.930.12
2xg0H01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9152 7 83 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2T2TME1-F1-model_v4 50S ribosomal protein L6 0.9549 5 81 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A3M1AVQ4-F1-model_v4 50S ribosomal protein L6 0.9477 26 125 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A7Y4T453-F1-model_v4 50S ribosomal protein L6 0.9462 1 157 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A7J5WP81-F1-model_v4 Large subunit ribosomal protein 0.9442 1 81 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A662CJF3-F1-model_v4 50S ribosomal protein L6 0.942 1 83 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
80.14 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map