F433674

General Info

Members Datasets Scaffolds Average Seq Length
397 192 794 106

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10076098|Ga0065704_100760982
Length 116
Sequence VQLADVGDPHMSNERRSSQRKRLLLEAKWESMSRTHEARVDDVSLSGCFVNTYGRVESNEEIDLQIELPSGEWLSLSGRVASYQPGVGFGMAFTSLSKEKLAKLEEMIATSEERRI

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
147 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
148 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
149 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
155 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
156 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
157 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
158 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
163 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
164 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
165 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
166 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
167 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
168 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
169 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
170 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
171 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
172 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
173 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
174 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
177 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
178 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
179 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
180 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
181 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
182 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
183 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
184 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.02
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 37.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10076098 3300005289 Bacteria 5265
2 SwRhRL3b_contig_1529249 2162886006 Unclassified 1284
3 SwRhRL3b_contig_2272043 2162886006 Bacteria 1985
4 MBSR1b_contig_12482247 2162886012 Unclassified 916
5 MBSR1b_contig_8343946 2162886012 Unclassified 1350
6 JGI25406J46586_10009981 3300003203 Bacteria 4235
7 rootL2_10092906 3300003322 Bacteria 1573
8 Ga0065712_10001685 3300005290 Bacteria 5963
9 Ga0065715_10100420 3300005293 Bacteria 3291
10 Ga0065715_10221022 3300005293 Bacteria 1272
11 Ga0065715_10278618 3300005293 Bacteria 1092
12 Ga0065715_10439559 3300005293 Unclassified 838
13 Ga0065715_10533623 3300005293 Unclassified 754
14 Ga0065707_10005342 3300005295 Bacteria 5401
15 Ga0065707_10124567 3300005295 Bacteria 2041
16 Ga0070670_100004801 3300005331 Bacteria 11348
17 Ga0070670_100049744 3300005331 Bacteria 3603
18 Ga0068869_100010281 3300005334 Bacteria 6099
19 Ga0068869_100672387 3300005334 Unclassified 881
20 Ga0070680_101475183 3300005336 Unclassified 589
21 Ga0070682_100001346 3300005337 Bacteria 13865
22 Ga0070682_101370610 3300005337 Unclassified 603
23 Ga0070661_100159524 3300005344 Bacteria 1708
24 Ga0070661_101308495 3300005344 Unclassified 608
25 Ga0070692_10112266 3300005345 Unclassified 1509
26 Ga0070692_11007248 3300005345 Unclassified 583
27 Ga0070692_11067695 3300005345 Unclassified 568
28 Ga0070675_100064927 3300005354 Bacteria 3018
29 Ga0070675_100984652 3300005354 Unclassified 774
30 Ga0070671_100551496 3300005355 Bacteria 994
31 Ga0070673_100441309 3300005364 Unclassified 1170
32 Ga0070701_10393512 3300005438 Unclassified 876
33 Ga0070701_10507958 3300005438 Unclassified 784
34 Ga0070701_10613917 3300005438 Unclassified 722
35 Ga0070705_100052405 3300005440 Bacteria 2384
36 Ga0070705_100297866 3300005440 Unclassified 1154
37 Ga0070700_100020574 3300005441 Bacteria 3824
38 Ga0070700_100021815 3300005441 Bacteria 3726
39 Ga0070694_100016131 3300005444 Bacteria 4701
40 Ga0070694_100156824 3300005444 Bacteria 1667
41 Ga0070694_100903851 3300005444 Unclassified 729
42 Ga0070681_10002770 3300005458 Bacteria 16179
43 Ga0070681_10815160 3300005458 Bacteria 851
44 Ga0068867_100150143 3300005459 Bacteria 1829
45 Ga0070707_100104586 3300005468 Unclassified 2745
46 Ga0070707_100803604 3300005468 Unclassified 904
47 Ga0070698_100015717 3300005471 Bacteria 7994
48 Ga0070699_100008959 3300005518 Bacteria 8670
49 Ga0070699_100018179 3300005518 Bacteria 6039
50 Ga0070679_100115002 3300005530 Bacteria 2676
51 Ga0070697_100014598 3300005536 Bacteria 6169
52 Ga0068853_100024704 3300005539 Bacteria 5040
53 Ga0070672_100159234 3300005543 Unclassified 1872
54 Ga0070672_100903368 3300005543 Unclassified 780
55 Ga0070695_100019167 3300005545 Bacteria 4162
56 Ga0070695_100032779 3300005545 Bacteria 3247
57 Ga0070695_100521107 3300005545 Unclassified 922
58 Ga0070696_100051426 3300005546 Bacteria 2866
59 Ga0070693_100029574 3300005547 Bacteria 2989
60 Ga0070693_100270732 3300005547 Unclassified 1134
61 Ga0070693_101006828 3300005547 Unclassified 631
62 Ga0070704_100083534 3300005549 Bacteria 2358
63 Ga0070704_100480785 3300005549 Bacteria 1075
64 Ga0068855_102423467 3300005563 Unclassified 523
65 Ga0070664_100097528 3300005564 Unclassified 2552
66 Ga0070664_100238447 3300005564 Bacteria 1632
67 Ga0068857_100049672 3300005577 Bacteria 3722
68 Ga0068857_100152143 3300005577 Unclassified 2097
69 Ga0068857_100361538 3300005577 Bacteria 1345
70 Ga0068857_100503701 3300005577 Unclassified 1137
71 Ga0068857_100711133 3300005577 Unclassified 955
72 Ga0068854_100251410 3300005578 Bacteria 1411
73 Ga0068854_100612146 3300005578 Bacteria 931
74 Ga0068854_101458199 3300005578 Bacteria 620
75 Ga0070702_100030591 3300005615 Bacteria 2936
76 Ga0070702_100667633 3300005615 Unclassified 788
77 Ga0070702_101411299 3300005615 Unclassified 570
78 Ga0068852_100160615 3300005616 Bacteria 2098
79 Ga0068852_100387701 3300005616 Unclassified 1372
80 Ga0068852_102505910 3300005616 Unclassified 536
81 Ga0068859_100015214 3300005617 Bacteria 7723
82 Ga0068859_100024100 3300005617 Bacteria 6107
83 Ga0068859_100283441 3300005617 Bacteria 1750
84 Ga0068859_100373494 3300005617 Bacteria 1521
85 Ga0068859_100378359 3300005617 Unclassified 1511
86 Ga0068859_100662325 3300005617 Unclassified 1135
87 Ga0068859_101720461 3300005617 Unclassified 693
88 Ga0068864_100002204 3300005618 Bacteria 16082
89 Ga0068864_100022457 3300005618 Bacteria 5292
90 Ga0068864_100075234 3300005618 Bacteria 2948
91 Ga0068864_100165755 3300005618 Bacteria 2011
92 Ga0068864_100176716 3300005618 Bacteria 1950
93 Ga0068864_100530431 3300005618 Unclassified 1136
94 Ga0068864_101636095 3300005618 Unclassified 648
95 Ga0068864_102170313 3300005618 Unclassified 562
96 Ga0068861_100158223 3300005719 Bacteria 1866
97 Ga0068861_101155278 3300005719 Unclassified 747
98 Ga0068861_101729273 3300005719 Unclassified 619
99 Ga0068870_10011736 3300005840 Bacteria 4073
100 Ga0068870_10230399 3300005840 Bacteria 1139
101 Ga0068870_10854074 3300005840 Unclassified 640
102 Ga0068863_100043173 3300005841 Bacteria 4281
103 Ga0068863_100057688 3300005841 Bacteria 3674
104 Ga0068863_100325870 3300005841 Bacteria 1493
105 Ga0068863_100629083 3300005841 Unclassified 1063
106 Ga0068863_100762366 3300005841 Bacteria 964
107 Ga0068858_100190351 3300005842 Bacteria 1939
108 Ga0068858_100420252 3300005842 Bacteria 1286
109 Ga0068858_100521845 3300005842 Bacteria 1149
110 Ga0068858_100702557 3300005842 Unclassified 984
111 Ga0068860_100015891 3300005843 Bacteria 7346
112 Ga0068860_100379284 3300005843 Bacteria 1396
113 Ga0068860_100947946 3300005843 Unclassified 878
114 Ga0068862_100293238 3300005844 Bacteria 1494
115 Ga0068862_100500008 3300005844 Unclassified 1154
116 Ga0068862_100511197 3300005844 Unclassified 1142
117 Ga0068862_101550691 3300005844 Unclassified 669
118 Ga0081539_10003540 3300005985 Bacteria 18990
119 Ga0081539_10058893 3300005985 Bacteria 2117
120 Ga0075432_10293397 3300006058 Unclassified 673
121 Ga0097621_100000803 3300006237 Bacteria 22128
122 Ga0097621_101862873 3300006237 Unclassified 574
123 Ga0068871_100011235 3300006358 Bacteria 6562
124 Ga0068871_100267540 3300006358 Bacteria 1493
125 Ga0075428_100649768 3300006844 Unclassified 1125
126 Ga0075428_101141633 3300006844 Unclassified 822
127 Ga0075430_100047804 3300006846 Unclassified 3613
128 Ga0075433_10034165 3300006852 Bacteria 4365
129 Ga0075433_10051652 3300006852 Bacteria 3580
130 Ga0075433_10094541 3300006852 Bacteria 2645
131 Ga0075433_10857696 3300006852 Bacteria 793
132 Ga0075434_100023361 3300006871 Bacteria 6024
133 Ga0075434_100077085 3300006871 Bacteria 3328
134 Ga0075429_100225309 3300006880 Unclassified 1642
135 Ga0075429_101399838 3300006880 Bacteria 609
136 Ga0068865_100145179 3300006881 Unclassified 1794
137 Ga0097620_100015214 3300006931 Bacteria 7723
138 Ga0097620_100024098 3300006931 Bacteria 6107
139 Ga0097620_100283452 3300006931 Bacteria 1750
140 Ga0097620_100373480 3300006931 Bacteria 1521
141 Ga0097620_100378327 3300006931 Unclassified 1511
142 Ga0097620_100662334 3300006931 Unclassified 1135
143 Ga0097620_100810015 3300006931 Bacteria 1024
144 Ga0097620_101720203 3300006931 Unclassified 693
145 Ga0097620_102235994 3300006931 Bacteria 603
146 Ga0105251_10101181 3300009011 Bacteria 1317
147 Ga0105251_10334678 3300009011 Unclassified 689
148 Ga0105240_12077158 3300009093 Unclassified 590
149 Ga0111539_10002073 3300009094 Bacteria 26784
150 Ga0111539_10015132 3300009094 Bacteria 9613
151 Ga0111539_12281165 3300009094 Unclassified 628
152 Ga0105245_10588814 3300009098 Bacteria 1138
153 Ga0105247_10062324 3300009101 Bacteria 2313
154 Ga0105247_10093153 3300009101 Bacteria 1915
155 Ga0105247_10501733 3300009101 Bacteria 884
156 Ga0105247_10507077 3300009101 Bacteria 880
157 Ga0114129_10034388 3300009147 Bacteria 7158
158 Ga0114129_10043893 3300009147 Bacteria 6290
159 Ga0114129_10513327 3300009147 Unclassified 1563
160 Ga0114129_10604342 3300009147 Bacteria 1421
161 Ga0105243_10009837 3300009148 Bacteria 7277
162 Ga0105243_10856437 3300009148 Unclassified 900
163 Ga0105243_11685259 3300009148 Unclassified 663
164 Ga0105241_10026618 3300009174 Bacteria 4304
165 Ga0105241_10048874 3300009174 Bacteria 3220
166 Ga0105241_10181277 3300009174 Bacteria 1747
167 Ga0105241_10319600 3300009174 Unclassified 1338
168 Ga0105248_10002530 3300009177 Bacteria 20349
169 Ga0105248_10034888 3300009177 Bacteria 5629
170 Ga0105248_10137817 3300009177 Bacteria 2753
171 Ga0105248_10199560 3300009177 Unclassified 2254
172 Ga0105248_10485027 3300009177 Unclassified 1393
173 Ga0105248_10600067 3300009177 Bacteria 1242
174 Ga0105248_10628168 3300009177 Unclassified 1212
175 Ga0105248_10851021 3300009177 Bacteria 1029
176 Ga0105248_11164317 3300009177 Bacteria 872
177 Ga0105237_10035131 3300009545 Bacteria 5073
178 Ga0105238_10007483 3300009551 Bacteria 10943
179 Ga0105238_12866152 3300009551 Bacteria 518
180 Ga0105249_10478281 3300009553 Bacteria 1288
181 Ga0105249_10914900 3300009553 Unclassified 944
182 Ga0105239_10422756 3300010375 Unclassified 1510
183 Ga0105246_10389981 3300011119 Bacteria 1153
184 Ga0105246_10932681 3300011119 Unclassified 781
185 Ga0157373_10131469 3300013100 Bacteria 1760
186 Ga0157373_10305872 3300013100 Bacteria 1129
187 Ga0157373_10355574 3300013100 Bacteria 1045
188 Ga0157373_10475353 3300013100 Bacteria 901
189 Ga0157373_11094394 3300013100 Unclassified 598
190 Ga0157371_10807966 3300013102 Bacteria 707
191 Ga0157378_10078076 3300013297 Bacteria 2986
192 Ga0157378_11230222 3300013297 Unclassified 789
193 Ga0163162_10068000 3300013306 Bacteria 3613
194 Ga0163162_10101871 3300013306 Bacteria 2964
195 Ga0163162_11246000 3300013306 Unclassified 845
196 Ga0163162_11451947 3300013306 Unclassified 781
197 Ga0157372_10523194 3300013307 Unclassified 1383
198 Ga0157372_11171304 3300013307 Unclassified 888
199 Ga0157372_11248475 3300013307 Unclassified 858
200 Ga0157375_10852790 3300013308 Bacteria 1057
201 Ga0157375_11574116 3300013308 Unclassified 777
202 Ga0157375_12617519 3300013308 Unclassified 603
203 Ga0163163_10008237 3300014325 Bacteria 9251
204 Ga0163163_10035570 3300014325 Bacteria 4832
205 Ga0163163_10076621 3300014325 Bacteria 3339
206 Ga0163163_10545759 3300014325 Bacteria 1222
207 Ga0163163_10555662 3300014325 Bacteria 1210
208 Ga0157380_10044096 3300014326 Bacteria 3493
209 Ga0157380_10251993 3300014326 Bacteria 1598
210 Ga0157377_10758321 3300014745 Unclassified 711
211 Ga0157379_10221316 3300014968 Bacteria 1715
212 Ga0157379_10236397 3300014968 Bacteria 1657
213 Ga0157379_10534996 3300014968 Unclassified 1089
214 Ga0182007_10109642 3300015262 Unclassified 918
215 Ga0207710_10224384 3300025900 Bacteria 934
216 Ga0207710_10329855 3300025900 Unclassified 775
217 Ga0207647_10004286 3300025904 Bacteria 10584
218 Ga0207643_10001384 3300025908 Bacteria 13921
219 Ga0207643_10068711 3300025908 Bacteria 2036
220 Ga0207643_10736541 3300025908 Unclassified 638
221 Ga0207654_10035946 3300025911 Bacteria 2764
222 Ga0207654_10058490 3300025911 Unclassified 2244
223 Ga0207654_10160147 3300025911 Unclassified 1453
224 Ga0207707_10009335 3300025912 Bacteria 8506
225 Ga0207695_10820567 3300025913 Unclassified 810
226 Ga0207671_10120755 3300025914 Bacteria 2003
227 Ga0207662_10076991 3300025918 Bacteria 2028
228 Ga0207649_10217219 3300025920 Bacteria 1360
229 Ga0207652_10032304 3300025921 Bacteria 4399
230 Ga0207646_10106056 3300025922 Unclassified 2520
231 Ga0207646_10629620 3300025922 Unclassified 962
232 Ga0207694_10034792 3300025924 Bacteria 3863
233 Ga0207650_10000007 3300025925 Bacteria 530810
234 Ga0207650_10026485 3300025925 Bacteria 4137
235 Ga0207650_10098018 3300025925 Bacteria 2251
236 Ga0207650_10119189 3300025925 Unclassified 2052
237 Ga0207650_10814134 3300025925 Unclassified 792
238 Ga0207659_10390870 3300025926 Unclassified 1161
239 Ga0207687_10762048 3300025927 Unclassified 824
240 Ga0207686_10040212 3300025934 Bacteria 2842
241 Ga0207709_10012421 3300025935 Bacteria 4692
242 Ga0207709_10172379 3300025935 Unclassified 1520
243 Ga0207670_10015904 3300025936 Bacteria 4506
244 Ga0207670_11490950 3300025936 Unclassified 575
245 Ga0207704_10631103 3300025938 Unclassified 880
246 Ga0207691_10178717 3300025940 Unclassified 1855
247 Ga0207691_10365621 3300025940 Bacteria 1233
248 Ga0207711_10016784 3300025941 Bacteria 6080
249 Ga0207711_10083396 3300025941 Bacteria 2796
250 Ga0207711_10085778 3300025941 Bacteria 2759
251 Ga0207711_10837958 3300025941 Bacteria 856
252 Ga0207711_11205443 3300025941 Unclassified 698
253 Ga0207711_11974585 3300025941 Unclassified 526
254 Ga0207689_10109955 3300025942 Bacteria 2265
255 Ga0207689_10256695 3300025942 Bacteria 1446
256 Ga0207689_10263862 3300025942 Unclassified 1425
257 Ga0207689_10302027 3300025942 Unclassified 1327
258 Ga0207689_10633017 3300025942 Unclassified 901
259 Ga0207679_10045780 3300025945 Bacteria 3166
260 Ga0207651_10987012 3300025960 Unclassified 752
261 Ga0207712_10227005 3300025961 Bacteria 1496
262 Ga0207640_10444697 3300025981 Bacteria 1067
263 Ga0207640_11676183 3300025981 Unclassified 574
264 Ga0207703_10080750 3300026035 Bacteria 2709
265 Ga0207703_10289008 3300026035 Bacteria 1491
266 Ga0207703_10919820 3300026035 Bacteria 838
267 Ga0207703_11731269 3300026035 Unclassified 601
268 Ga0207708_10015213 3300026075 Bacteria 5769
269 Ga0207708_10075011 3300026075 Bacteria 2593
270 Ga0207708_10087341 3300026075 Bacteria 2401
271 Ga0207708_11494398 3300026075 Unclassified 593
272 Ga0207641_10105215 3300026088 Unclassified 2492
273 Ga0207641_10244440 3300026088 Unclassified 1673
274 Ga0207641_10272026 3300026088 Bacteria 1590
275 Ga0207641_10272977 3300026088 Bacteria 1587
276 Ga0207641_10425334 3300026088 Unclassified 1280
277 Ga0207641_12159102 3300026088 Unclassified 557
278 Ga0207648_10030092 3300026089 Bacteria 4813
279 Ga0207648_10039893 3300026089 Bacteria 4127
280 Ga0207648_10251656 3300026089 Bacteria 1575
281 Ga0207676_10004138 3300026095 Bacteria 10246
282 Ga0207676_10077777 3300026095 Unclassified 2685
283 Ga0207676_10198488 3300026095 Bacteria 1771
284 Ga0207676_10231689 3300026095 Bacteria 1651
285 Ga0207676_10353547 3300026095 Bacteria 1359
286 Ga0207676_11910608 3300026095 Unclassified 592
287 Ga0207676_12091334 3300026095 Bacteria 565
288 Ga0207674_10042390 3300026116 Bacteria 4701
289 Ga0207674_10060695 3300026116 Unclassified 3823
290 Ga0207674_11123882 3300026116 Unclassified 755
291 Ga0207675_100767315 3300026118 Unclassified 976
292 Ga0207698_10043236 3300026142 Unclassified 3374
293 Ga0207698_10052073 3300026142 Bacteria 3134
294 Ga0207698_10121735 3300026142 Bacteria 2210
295 Ga0207698_10994823 3300026142 Unclassified 849
296 Ga0207428_10010243 3300027907 Bacteria 8378
297 Ga0207428_10099679 3300027907 Bacteria 2246
298 Ga0268265_10253160 3300028380 Bacteria 1561
299 Ga0268265_11727453 3300028380 Unclassified 632
300 Ga0268264_10073128 3300028381 Bacteria 2908
301 Ga0268264_10096212 3300028381 Unclassified 2564
302 Ga0268264_10375603 3300028381 Unclassified 1360
303 Ga0268264_10582396 3300028381 Bacteria 1101
304 Ga0307408_100139545 3300031548 Bacteria 1901
305 Ga0307408_100283583 3300031548 Bacteria 1380
306 Ga0307405_10027425 3300031731 Bacteria 3302
307 Ga0307410_10181166 3300031852 Bacteria 1595
308 Ga0307406_10114693 3300031901 Bacteria 1861
309 Ga0307407_10108836 3300031903 Bacteria 1736
310 Ga0307412_10014594 3300031911 Bacteria 4638
311 Ga0307416_100020057 3300032002 Unclassified 4759
312 Ga0307414_10017661 3300032004 Unclassified 4371
313 Ga0307414_10356985 3300032004 Bacteria 1256
314 Ga0307411_10095854 3300032005 Bacteria 2084
315 Ga0307411_11292016 3300032005 Bacteria 664
316 Ga0307415_100006743 3300032126 Bacteria 6223
317 Ga0373940_0044689 3300035088 Unclassified 1228
318 Ga0373951_0010028 3300035091 Bacteria 2125
319 Ga0373939_0045049 3300035114 Bacteria 1345
320 Ga0373942_0149450 3300035207 Unclassified 749
321 Ga0395901_0239377 3300038443 Bacteria 1893
322 Ga0395901_0555627 3300038443 Bacteria 1163
323 Ga0439435_0075373 3300042436 Bacteria 1005
324 Ga0451576_0168902 3300045051 Unclassified 2283
325 Ga0496106_0803058 3300048909 Unclassified 746
326 Ga0496108_0866323 3300048911 Unclassified 777
327 Ga0496109_0908269 3300048912 Unclassified 819
328 Ga0496110_0108541 3300048913 Bacteria 2492
329 Ga0496110_0672383 3300048913 Bacteria 936
330 Ga0496111_0981239 3300048914 Unclassified 606
331 Ga0496112_0113563 3300048915 Bacteria 2680
332 Ga0496113_1342628 3300048916 Unclassified 555
333 Ga0501291_001541 3300049514 Bacteria 2686
334 Ga0501292_078959 3300049515 Unclassified 623
335 Ga0501293_016196 3300049516 Bacteria 692
336 Ga0501296_003155 3300049519 Bacteria 1752
337 Ga0501074_0143628 3300049590 Bacteria 1707
338 Ga0501076_0419671 3300049592 Unclassified 1101
339 Ga0501198_010710 3300049649 Bacteria 1359
340 Ga0501202_027893 3300049652 Bacteria 1163
341 Ga0501206_059834 3300049653 Unclassified 623
342 Ga0501209_003670 3300049656 Bacteria 2570
343 Ga0501209_025637 3300049656 Bacteria 1448
344 Ga0501216_000138 3300049660 Bacteria 7447
345 Ga0501216_002737 3300049660 Bacteria 2525
346 Ga0501217_001040 3300049661 Bacteria 5039
347 Ga0501217_213550 3300049661 Unclassified 606
348 Ga0501223_000999 3300049663 Bacteria 6690
349 Ga0501223_008710 3300049663 Bacteria 2066
350 Ga0501227_000375 3300049665 Bacteria 9414
351 Ga0501227_037394 3300049665 Bacteria 1188
352 Ga0501228_006349 3300049666 Bacteria 1077
353 Ga0501233_005331 3300049668 Bacteria 2386
354 Ga0501235_001489 3300049669 Bacteria 5010
355 Ga0501239_016680 3300049672 Bacteria 869
356 Ga0501247_000931 3300049677 Bacteria 2636
357 Ga0501248_017498 3300049678 Bacteria 710
358 Ga0501249_003555 3300049679 Bacteria 3131
359 Ga0501250_009647 3300049680 Bacteria 1091
360 Ga0501250_051766 3300049680 Bacteria 632
361 Ga0501253_037742 3300049683 Bacteria 958
362 Ga0501257_006335 3300049686 Bacteria 2625
363 Ga0501257_150487 3300049686 Unclassified 641
364 Ga0501258_027326 3300049687 Bacteria 704
365 Ga0501259_029078 3300049688 Unclassified 1032
366 Ga0501261_020700 3300049690 Bacteria 941
367 Ga0501219_001912 3300049703 Bacteria 1749
368 Ga0501221_036035 3300049704 Bacteria 1058
369 Ga0501225_0012986 3300049705 Bacteria 2334
370 Ga0501225_0034999 3300049705 Bacteria 1382
371 Ga0501229_002522 3300049706 Bacteria 2158
372 Ga0501234_004795 3300049707 Bacteria 2122
373 Ga0501232_094480 3300049757 Unclassified 517
374 Ga0501241_105645 3300049758 Unclassified 611
375 Ga0501268_018946 3300049765 Bacteria 1162
376 Ga0501273_009825 3300049770 Bacteria 1167
377 Ga0501273_016481 3300049770 Unclassified 968
378 Ga0501283_003279 3300049779 Bacteria 2135
379 Ga0501204_007259 3300049850 Bacteria 1244
380 Ga0501212_083281 3300049851 Bacteria 582
381 nmdc:mga05p37_35161_c1 3300050507 Bacteria 6142
382 nmdc:mga05p37_429058_c1 3300050507 Unclassified 1536
383 nmdc:mga05p37_492920_c1 3300050507 Bacteria 1408
384 nmdc:mga05p37_832412_c1 3300050507 Bacteria 1005
385 nmdc:mga05p37_97021_c1 3300050507 Bacteria 3631
386 nmdc:mga09592_897582_c1 3300050508 Unclassified 745
387 nmdc:mga0qj67_276599_c1 3300050509 Bacteria 1361
388 nmdc:mga06r32_1302217_c1 3300050510 Unclassified 670
389 nmdc:mga08y16_59715_c1 3300050511 Bacteria 3983
390 nmdc:mga0n895_1637877_c1 3300050512 Unclassified 607
391 nmdc:mga0n895_67503_c1 3300050512 Bacteria 3542
392 nmdc:mga0a205_317886_c1 3300050515 Bacteria 1428
393 nmdc:mga0a205_405686_c1 3300050515 Bacteria 1226
394 nmdc:mga0a205_53299_c1 3300050515 Bacteria 3904
395 nmdc:mga0a205_58864_c1 3300050515 Bacteria 3711
396 nmdc:mga0a205_83415_c1 3300050515 Bacteria 3087
397 Ga0501084_0126258 3300054114 Unclassified 2153
398 Ga0065704_10076098
399 SwRhRL3b_contig_1529249
400 SwRhRL3b_contig_2272043
401 MBSR1b_contig_12482247
402 MBSR1b_contig_8343946
403 JGI25406J46586_10009981
404 rootL2_10092906
405 Ga0065712_10001685
406 Ga0065715_10100420
407 Ga0065715_10221022
408 Ga0065715_10278618
409 Ga0065715_10439559
410 Ga0065715_10533623
411 Ga0065707_10005342
412 Ga0065707_10124567
413 Ga0070670_100004801
414 Ga0070670_100049744
415 Ga0068869_100010281
416 Ga0068869_100672387
417 Ga0070680_101475183
418 Ga0070682_100001346
419 Ga0070682_101370610
420 Ga0070661_100159524
421 Ga0070661_101308495
422 Ga0070692_10112266
423 Ga0070692_11007248
424 Ga0070692_11067695
425 Ga0070675_100064927
426 Ga0070675_100984652
427 Ga0070671_100551496
428 Ga0070673_100441309
429 Ga0070701_10393512
430 Ga0070701_10507958
431 Ga0070701_10613917
432 Ga0070705_100052405
433 Ga0070705_100297866
434 Ga0070700_100020574
435 Ga0070700_100021815
436 Ga0070694_100016131
437 Ga0070694_100156824
438 Ga0070694_100903851
439 Ga0070681_10002770
440 Ga0070681_10815160
441 Ga0068867_100150143
442 Ga0070707_100104586
443 Ga0070707_100803604
444 Ga0070698_100015717
445 Ga0070699_100008959
446 Ga0070699_100018179
447 Ga0070679_100115002
448 Ga0070697_100014598
449 Ga0068853_100024704
450 Ga0070672_100159234
451 Ga0070672_100903368
452 Ga0070695_100019167
453 Ga0070695_100032779
454 Ga0070695_100521107
455 Ga0070696_100051426
456 Ga0070693_100029574
457 Ga0070693_100270732
458 Ga0070693_101006828
459 Ga0070704_100083534
460 Ga0070704_100480785
461 Ga0068855_102423467
462 Ga0070664_100097528
463 Ga0070664_100238447
464 Ga0068857_100049672
465 Ga0068857_100152143
466 Ga0068857_100361538
467 Ga0068857_100503701
468 Ga0068857_100711133
469 Ga0068854_100251410
470 Ga0068854_100612146
471 Ga0068854_101458199
472 Ga0070702_100030591
473 Ga0070702_100667633
474 Ga0070702_101411299
475 Ga0068852_100160615
476 Ga0068852_100387701
477 Ga0068852_102505910
478 Ga0068859_100015214
479 Ga0068859_100024100
480 Ga0068859_100283441
481 Ga0068859_100373494
482 Ga0068859_100378359
483 Ga0068859_100662325
484 Ga0068859_101720461
485 Ga0068864_100002204
486 Ga0068864_100022457
487 Ga0068864_100075234
488 Ga0068864_100165755
489 Ga0068864_100176716
490 Ga0068864_100530431
491 Ga0068864_101636095
492 Ga0068864_102170313
493 Ga0068861_100158223
494 Ga0068861_101155278
495 Ga0068861_101729273
496 Ga0068870_10011736
497 Ga0068870_10230399
498 Ga0068870_10854074
499 Ga0068863_100043173
500 Ga0068863_100057688
501 Ga0068863_100325870
502 Ga0068863_100629083
503 Ga0068863_100762366
504 Ga0068858_100190351
505 Ga0068858_100420252
506 Ga0068858_100521845
507 Ga0068858_100702557
508 Ga0068860_100015891
509 Ga0068860_100379284
510 Ga0068860_100947946
511 Ga0068862_100293238
512 Ga0068862_100500008
513 Ga0068862_100511197
514 Ga0068862_101550691
515 Ga0081539_10003540
516 Ga0081539_10058893
517 Ga0075432_10293397
518 Ga0097621_100000803
519 Ga0097621_101862873
520 Ga0068871_100011235
521 Ga0068871_100267540
522 Ga0075428_100649768
523 Ga0075428_101141633
524 Ga0075430_100047804
525 Ga0075433_10034165
526 Ga0075433_10051652
527 Ga0075433_10094541
528 Ga0075433_10857696
529 Ga0075434_100023361
530 Ga0075434_100077085
531 Ga0075429_100225309
532 Ga0075429_101399838
533 Ga0068865_100145179
534 Ga0097620_100015214
535 Ga0097620_100024098
536 Ga0097620_100283452
537 Ga0097620_100373480
538 Ga0097620_100378327
539 Ga0097620_100662334
540 Ga0097620_100810015
541 Ga0097620_101720203
542 Ga0097620_102235994
543 Ga0105251_10101181
544 Ga0105251_10334678
545 Ga0105240_12077158
546 Ga0111539_10002073
547 Ga0111539_10015132
548 Ga0111539_12281165
549 Ga0105245_10588814
550 Ga0105247_10062324
551 Ga0105247_10093153
552 Ga0105247_10501733
553 Ga0105247_10507077
554 Ga0114129_10034388
555 Ga0114129_10043893
556 Ga0114129_10513327
557 Ga0114129_10604342
558 Ga0105243_10009837
559 Ga0105243_10856437
560 Ga0105243_11685259
561 Ga0105241_10026618
562 Ga0105241_10048874
563 Ga0105241_10181277
564 Ga0105241_10319600
565 Ga0105248_10002530
566 Ga0105248_10034888
567 Ga0105248_10137817
568 Ga0105248_10199560
569 Ga0105248_10485027
570 Ga0105248_10600067
571 Ga0105248_10628168
572 Ga0105248_10851021
573 Ga0105248_11164317
574 Ga0105237_10035131
575 Ga0105238_10007483
576 Ga0105238_12866152
577 Ga0105249_10478281
578 Ga0105249_10914900
579 Ga0105239_10422756
580 Ga0105246_10389981
581 Ga0105246_10932681
582 Ga0157373_10131469
583 Ga0157373_10305872
584 Ga0157373_10355574
585 Ga0157373_10475353
586 Ga0157373_11094394
587 Ga0157371_10807966
588 Ga0157378_10078076
589 Ga0157378_11230222
590 Ga0163162_10068000
591 Ga0163162_10101871
592 Ga0163162_11246000
593 Ga0163162_11451947
594 Ga0157372_10523194
595 Ga0157372_11171304
596 Ga0157372_11248475
597 Ga0157375_10852790
598 Ga0157375_11574116
599 Ga0157375_12617519
600 Ga0163163_10008237
601 Ga0163163_10035570
602 Ga0163163_10076621
603 Ga0163163_10545759
604 Ga0163163_10555662
605 Ga0157380_10044096
606 Ga0157380_10251993
607 Ga0157377_10758321
608 Ga0157379_10221316
609 Ga0157379_10236397
610 Ga0157379_10534996
611 Ga0182007_10109642
612 Ga0207710_10224384
613 Ga0207710_10329855
614 Ga0207647_10004286
615 Ga0207643_10001384
616 Ga0207643_10068711
617 Ga0207643_10736541
618 Ga0207654_10035946
619 Ga0207654_10058490
620 Ga0207654_10160147
621 Ga0207707_10009335
622 Ga0207695_10820567
623 Ga0207671_10120755
624 Ga0207662_10076991
625 Ga0207649_10217219
626 Ga0207652_10032304
627 Ga0207646_10106056
628 Ga0207646_10629620
629 Ga0207694_10034792
630 Ga0207650_10000007
631 Ga0207650_10026485
632 Ga0207650_10098018
633 Ga0207650_10119189
634 Ga0207650_10814134
635 Ga0207659_10390870
636 Ga0207687_10762048
637 Ga0207686_10040212
638 Ga0207709_10012421
639 Ga0207709_10172379
640 Ga0207670_10015904
641 Ga0207670_11490950
642 Ga0207704_10631103
643 Ga0207691_10178717
644 Ga0207691_10365621
645 Ga0207711_10016784
646 Ga0207711_10083396
647 Ga0207711_10085778
648 Ga0207711_10837958
649 Ga0207711_11205443
650 Ga0207711_11974585
651 Ga0207689_10109955
652 Ga0207689_10256695
653 Ga0207689_10263862
654 Ga0207689_10302027
655 Ga0207689_10633017
656 Ga0207679_10045780
657 Ga0207651_10987012
658 Ga0207712_10227005
659 Ga0207640_10444697
660 Ga0207640_11676183
661 Ga0207703_10080750
662 Ga0207703_10289008
663 Ga0207703_10919820
664 Ga0207703_11731269
665 Ga0207708_10015213
666 Ga0207708_10075011
667 Ga0207708_10087341
668 Ga0207708_11494398
669 Ga0207641_10105215
670 Ga0207641_10244440
671 Ga0207641_10272026
672 Ga0207641_10272977
673 Ga0207641_10425334
674 Ga0207641_12159102
675 Ga0207648_10030092
676 Ga0207648_10039893
677 Ga0207648_10251656
678 Ga0207676_10004138
679 Ga0207676_10077777
680 Ga0207676_10198488
681 Ga0207676_10231689
682 Ga0207676_10353547
683 Ga0207676_11910608
684 Ga0207676_12091334
685 Ga0207674_10042390
686 Ga0207674_10060695
687 Ga0207674_11123882
688 Ga0207675_100767315
689 Ga0207698_10043236
690 Ga0207698_10052073
691 Ga0207698_10121735
692 Ga0207698_10994823
693 Ga0207428_10010243
694 Ga0207428_10099679
695 Ga0268265_10253160
696 Ga0268265_11727453
697 Ga0268264_10073128
698 Ga0268264_10096212
699 Ga0268264_10375603
700 Ga0268264_10582396
701 Ga0307408_100139545
702 Ga0307408_100283583
703 Ga0307405_10027425
704 Ga0307410_10181166
705 Ga0307406_10114693
706 Ga0307407_10108836
707 Ga0307412_10014594
708 Ga0307416_100020057
709 Ga0307414_10017661
710 Ga0307414_10356985
711 Ga0307411_10095854
712 Ga0307411_11292016
713 Ga0307415_100006743
714 Ga0373940_0044689
715 Ga0373951_0010028
716 Ga0373939_0045049
717 Ga0373942_0149450
718 Ga0395901_0239377
719 Ga0395901_0555627
720 Ga0439435_0075373
721 Ga0451576_0168902
722 Ga0496106_0803058
723 Ga0496108_0866323
724 Ga0496109_0908269
725 Ga0496110_0108541
726 Ga0496110_0672383
727 Ga0496111_0981239
728 Ga0496112_0113563
729 Ga0496113_1342628
730 Ga0501291_001541
731 Ga0501292_078959
732 Ga0501293_016196
733 Ga0501296_003155
734 Ga0501074_0143628
735 Ga0501076_0419671
736 Ga0501198_010710
737 Ga0501202_027893
738 Ga0501206_059834
739 Ga0501209_003670
740 Ga0501209_025637
741 Ga0501216_000138
742 Ga0501216_002737
743 Ga0501217_001040
744 Ga0501217_213550
745 Ga0501223_000999
746 Ga0501223_008710
747 Ga0501227_000375
748 Ga0501227_037394
749 Ga0501228_006349
750 Ga0501233_005331
751 Ga0501235_001489
752 Ga0501239_016680
753 Ga0501247_000931
754 Ga0501248_017498
755 Ga0501249_003555
756 Ga0501250_009647
757 Ga0501250_051766
758 Ga0501253_037742
759 Ga0501257_006335
760 Ga0501257_150487
761 Ga0501258_027326
762 Ga0501259_029078
763 Ga0501261_020700
764 Ga0501219_001912
765 Ga0501221_036035
766 Ga0501225_0012986
767 Ga0501225_0034999
768 Ga0501229_002522
769 Ga0501234_004795
770 Ga0501232_094480
771 Ga0501241_105645
772 Ga0501268_018946
773 Ga0501273_009825
774 Ga0501273_016481
775 Ga0501283_003279
776 Ga0501204_007259
777 Ga0501212_083281
778 nmdc:mga05p37_35161_c1
779 nmdc:mga05p37_429058_c1
780 nmdc:mga05p37_492920_c1
781 nmdc:mga05p37_832412_c1
782 nmdc:mga05p37_97021_c1
783 nmdc:mga09592_897582_c1
784 nmdc:mga0qj67_276599_c1
785 nmdc:mga06r32_1302217_c1
786 nmdc:mga08y16_59715_c1
787 nmdc:mga0n895_1637877_c1
788 nmdc:mga0n895_67503_c1
789 nmdc:mga0a205_317886_c1
790 nmdc:mga0a205_405686_c1
791 nmdc:mga0a205_53299_c1
792 nmdc:mga0a205_58864_c1
793 nmdc:mga0a205_83415_c1
794 Ga0501084_0126258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

14

110

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6g-assembly1.cif.gz_A pilz domain with c-di-gmp of ycgr from escherichia coli 0.8471 4 100
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.8371 10 100
5y4r-assembly1.cif.gz_D structure of a methyltransferase complex 0.8232 4 98
5y6f-assembly1.cif.gz_A crystal structure of ycgr in complex with c-di-gmp from escherichia coli 0.8218 5 100
4xrn-assembly2.cif.gz_B pilz domain with c-di-gmp of a protein from pseudomonas aeruginosa 0.82 10 100
ID Description Score Start End Superfamily
4xrnD00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8792 10 100 2.40.10.220
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8298 14 100 2.40.10.220
5y4rC00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8281 4 98 2.40.10.220
5kedC02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8148 15 99 2.40.10.220
5ejzA03 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8124 12 94 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A7W0NUT1-F1-model_v4 PilZ domain-containing protein 0.955 9 100 GO:0035438
AF-A0A3B9LTZ2-F1-model_v4 PilZ domain-containing protein 0.9536 4 100 GO:0035438
AF-A0A2V8NVR3-F1-model_v4 PilZ domain-containing protein 0.9469 4 100 GO:0035438
AF-A0A534NKQ8-F1-model_v4 PilZ domain-containing protein 0.9427 5 99 GO:0035438
AF-A0A2V8NF68-F1-model_v4 PilZ domain-containing protein 0.9404 7 99 GO:0035438

Map