F433634

General Info

Members Datasets Scaffolds Average Seq Length
396 282 355 219

Family's Representative Sequence

Representative Sequence 3300053122|Ga0500608_195708|Ga0500608_195708_22_783
Length 253
Sequence MGGWSVHKDHGSQKAAALLHNAGMTASSPTTALPSVLLTGFDPFGDLGPAGLTLNPSWMAVKALQGKRIAGHRVIAAQLPTVFGDSALELKRLLKLHKPALVICVGQAGGRSAISLERVAINVNDARIPDNTGGQPIDTPVVPDGPAAYFGSLPIKAMLQALQTAGVAAEVSQTAGTFVCNHVFYALMHTLATQRGFKRTRGGFIHVPYVPEQVAGQSVPSMALDEIVKGLRLAVATALATGRDIPKGAGAVS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
6 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
7 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
8 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
12 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
13 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
14 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
15 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
16 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
17 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
18 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
19 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
20 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
21 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
22 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
23 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
24 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
25 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
26 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
27 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
28 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
29 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
30 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
31 2932406140 Serratia sp. 2723 Isolate Rhizosphere
32 2937967321 Serratia sp. YC16 Isolate Unclassified
33 2939577877 Serratia sp. 509 Isolate Rhizosphere
34 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
35 2969141011 Bacillus velezensis MH25 Isolate Unclassified
36 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
37 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
38 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
39 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
104 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
191 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
192 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
198 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
245 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
255 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
256 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
257 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
277 640753048 Serratia proteamaculans 568 Isolate Endosphere
278 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
279 8004592986 Serratia sp. S119 Isolate Unclassified
280 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
281 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
282 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.65
Metatranscriptomes 0
Isolates 10.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.97
Nodule 1.26
Rhizoplane 2.27
Rhizosphere 61.36
Stem 0
Stem Tuber 0
Unclassified 13.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_877531 2162886007 Bacteria 2131
2 JGI25155J39150_1000005 3300002704 Bacteria 261712
3 JGI25156J39149_1000006 3300002705 Bacteria 261778
4 JGI25154J39366_1000015 3300002738 Bacteria 261778
5 JGI25157J39369_1000016 3300002741 Bacteria 192349
6 JGI25159J45721_1000065 3300002987 Bacteria 51403
7 JGI25159J45721_1007179 3300002987 Bacteria 3230
8 JGI25151J46595_10006042 3300003187 Bacteria 6162
9 JGI25151J46595_10025299 3300003187 Bacteria 2417
10 JGI25160J50197_1000098 3300003354 Bacteria 87307
11 JGI25160J50197_1012934 3300003354 Bacteria 2868
12 JGI25161J50226_1000037 3300003374 Bacteria 133331
13 Ga0055526_1010162 3300003771 Bacteria 4416
14 Ga0055526_1013647 3300003771 Bacteria 3417
15 Ga0055537_1000463 3300003773 Bacteria 25524
16 Ga0055537_1008480 3300003773 Bacteria 2367
17 Ga0055524_1000261 3300003775 Bacteria 53201
18 Ga0055536_1007864 3300003781 Bacteria 4689
19 Ga0055528_1003200 3300003790 Bacteria 8367
20 Ga0055530_10000190 3300003791 Bacteria 55126
21 Ga0055540_1000187 3300003792 Bacteria 59910
22 Ga0055531_10009363 3300003794 Bacteria 5013
23 Ga0065165_1013411 3300005262 Bacteria 3259
24 Ga0065704_10070427 3300005289 Bacteria 25272
25 Ga0065704_10192307 3300005289 Bacteria 1184
26 Ga0070658_10013790 3300005327 Bacteria 6484
27 Ga0070658_10228050 3300005327 Bacteria 1577
28 Ga0070658_10273160 3300005327 Bacteria 1438
29 Ga0068869_100565322 3300005334 Bacteria 957
30 Ga0068868_100059299 3300005338 Bacteria 3027
31 Ga0070660_100017394 3300005339 Bacteria 5240
32 Ga0070669_100016858 3300005353 Bacteria 5215
33 Ga0070675_100017187 3300005354 Bacteria 5749
34 Ga0070675_100091901 3300005354 Bacteria 2543
35 Ga0070674_100449709 3300005356 Bacteria 1063
36 Ga0070674_100848725 3300005356 Bacteria 792
37 Ga0070688_100004445 3300005365 Bacteria 7299
38 Ga0070688_100569689 3300005365 Bacteria 863
39 Ga0070667_100265142 3300005367 Bacteria 1539
40 Ga0070705_100035835 3300005440 Bacteria 2784
41 Ga0070705_100140020 3300005440 Bacteria 1591
42 Ga0070685_10049040 3300005466 Bacteria 2435
43 Ga0070707_100878567 3300005468 Bacteria 861
44 Ga0070679_100017823 3300005530 Bacteria 6876
45 Ga0070679_100027204 3300005530 Bacteria 5626
46 Ga0068853_100174400 3300005539 Bacteria 1947
47 Ga0070704_100121728 3300005549 Bacteria 2006
48 Ga0068855_100065090 3300005563 Bacteria 4250
49 Ga0068856_100140061 3300005614 Bacteria 2426
50 Ga0068859_100240050 3300005617 Bacteria 1901
51 Ga0075365_10005867 3300006038 Bacteria 6680
52 Ga0075365_10042955 3300006038 Bacteria 2958
53 Ga0075365_10064526 3300006038 Bacteria 2454
54 Ga0075363_100017916 3300006048 Bacteria 3521
55 Ga0075364_10034550 3300006051 Bacteria 3262
56 Ga0075362_10021036 3300006177 Bacteria 2732
57 Ga0075362_10151131 3300006177 Bacteria 1114
58 Ga0075367_10036632 3300006178 Bacteria 2846
59 Ga0075366_10103690 3300006195 Bacteria 1708
60 Ga0075370_10131140 3300006353 Bacteria 1462
61 Ga0075428_100769027 3300006844 Bacteria 1024
62 Ga0075429_100194297 3300006880 Bacteria 1778
63 Ga0097620_100240036 3300006931 Bacteria 1901
64 Ga0079104_1001321 3300006946 Bacteria 17027
65 Ga0079104_1010765 3300006946 Bacteria 2983
66 Ga0099826_10156722 3300006948 Bacteria 1296
67 Ga0105251_10000757 3300009011 Bacteria 29513
68 Ga0105251_10000772 3300009011 Bacteria 29120
69 Ga0105251_10002592 3300009011 Bacteria 14007
70 Ga0105244_10002665 3300009036 Bacteria 13377
71 Ga0105244_10010998 3300009036 Bacteria 5455
72 Ga0105250_10004582 3300009092 Bacteria 6335
73 Ga0105240_10049915 3300009093 Bacteria 5277
74 Ga0111539_10922553 3300009094 Bacteria 1016
75 Ga0105245_10000111 3300009098 Bacteria 79021
76 Ga0105247_10000018 3300009101 Bacteria 259335
77 Ga0105241_10000004 3300009174 Bacteria 803007
78 Ga0105248_10601666 3300009177 Bacteria 1241
79 Ga0105249_10134687 3300009553 Bacteria 2363
80 Ga0105246_10013663 3300011119 Bacteria 5095
81 Ga0157326_1004983 3300012513 Bacteria 1398
82 Ga0157373_10000220 3300013100 Bacteria 46833
83 Ga0157374_11056642 3300013296 Bacteria 832
84 Ga0157377_10066879 3300014745 Unclassified 2067
85 Ga0157376_10007779 3300014969 Bacteria 7682
86 Ga0157376_10034456 3300014969 Bacteria 4088
87 Ga0182007_10067746 3300015262 Bacteria 1169
88 Ga0163161_10000690 3300017792 Bacteria 27001
89 Ga0163161_10391278 3300017792 Bacteria 1113
90 Ga0213874_10063773 3300021377 Bacteria 1160
91 Ga0209435_100010 3300025206 Bacteria 475373
92 Ga0207425_1002387 3300025245 Bacteria 6652
93 Ga0207425_1010873 3300025245 Bacteria 2197
94 Ga0209646_1000001 3300025246 Bacteria 3092932
95 Ga0209026_1000001 3300025250 Bacteria 1228671
96 Ga0209148_1002363 3300025254 Bacteria 6640
97 Ga0209759_1000001 3300025256 Bacteria 2799452
98 Ga0209565_1000102 3300025263 Bacteria 127545
99 Ga0209565_1011608 3300025263 Bacteria 2135
100 Ga0209673_1000189 3300025273 Bacteria 123470
101 Ga0209673_1023553 3300025273 Bacteria 2092
102 Ga0209130_1000141 3300025284 Bacteria 115378
103 Ga0209130_1000423 3300025284 Bacteria 45537
104 Ga0209130_1047531 3300025284 Bacteria 796
105 Ga0209675_1000288 3300025291 Bacteria 47740
106 Ga0209675_1012795 3300025291 Bacteria 2675
107 Ga0209676_1000069 3300025292 Bacteria 312462
108 Ga0209676_1009516 3300025292 Bacteria 4182
109 Ga0209025_1006857 3300025294 Bacteria 8692
110 Ga0209025_1017325 3300025294 Bacteria 4168
111 Ga0209025_1018686 3300025294 Bacteria 3907
112 Ga0209564_1000415 3300025295 Bacteria 75119
113 Ga0209564_1000575 3300025295 Bacteria 58260
114 Ga0209758_1003237 3300025297 Bacteria 15125
115 Ga0209050_1000023 3300025298 Bacteria 537172
116 Ga0209050_1003591 3300025298 Bacteria 11270
117 Ga0209256_1000003 3300025299 Bacteria 1661127
118 Ga0209256_1027311 3300025299 Bacteria 1628
119 Ga0207426_1000145 3300025302 Bacteria 191065
120 Ga0207426_1006411 3300025302 Bacteria 5127
121 Ga0209051_1000017 3300025303 Bacteria 537172
122 Ga0209051_1000928 3300025303 Bacteria 29063
123 Ga0209257_1000041 3300025304 Bacteria 537172
124 Ga0209257_1000096 3300025304 Bacteria 259390
125 Ga0209257_1019350 3300025304 Bacteria 2569
126 Ga0207696_1000001 3300025711 Bacteria 2579611
127 Ga0207655_1000011 3300025728 Bacteria 643321
128 Ga0207713_1000093 3300025735 Bacteria 146199
129 Ga0207713_1000205 3300025735 Bacteria 80817
130 Ga0207710_10000049 3300025900 Bacteria 186492
131 Ga0207705_10028819 3300025909 Bacteria 3957
132 Ga0207705_10460249 3300025909 Bacteria 987
133 Ga0207654_10000006 3300025911 Bacteria 815027
134 Ga0207695_10243105 3300025913 Bacteria 1701
135 Ga0207657_10048150 3300025919 Bacteria 3722
136 Ga0207652_10148321 3300025921 Bacteria 2100
137 Ga0207652_10173725 3300025921 Bacteria 1934
138 Ga0207681_10012201 3300025923 Bacteria 5298
139 Ga0207659_10000402 3300025926 Bacteria 26071
140 Ga0207659_10001350 3300025926 Bacteria 14637
141 Ga0207687_10000295 3300025927 Bacteria 34167
142 Ga0207690_10663821 3300025932 Bacteria 855
143 Ga0207711_10344543 3300025941 Bacteria 1379
144 Ga0207711_10536234 3300025941 Bacteria 1091
145 Ga0207689_10321191 3300025942 Bacteria 1285
146 Ga0207689_10543102 3300025942 Bacteria 976
147 Ga0207667_10191974 3300025949 Bacteria 2096
148 Ga0207658_10305635 3300025986 Bacteria 1372
149 Ga0207677_10006076 3300026023 Bacteria 6589
150 Ga0207702_10075673 3300026078 Bacteria 2909
151 Ga0207674_10316063 3300026116 Bacteria 1511
152 Ga0209281_1000008 3300027111 Bacteria 867470
153 Ga0209281_1007444 3300027111 Bacteria 2748
154 Ga0307515_10000416 3300028794 Bacteria 102535
155 Ga0307515_10002793 3300028794 Bacteria 37196
156 Ga0307515_10015986 3300028794 Bacteria 13777
157 Ga0307512_10075123 3300030522 Bacteria 2475
158 Ga0307512_10105104 3300030522 Bacteria 1891
159 Ga0316177_1019334 3300030731 Bacteria 3759
160 Ga0314311_1027786 3300030733 Bacteria 2162
161 Ga0314311_1112682 3300030733 Bacteria 4611
162 Ga0265330_10019426 3300031235 Bacteria 3114
163 Ga0265331_10035359 3300031250 Bacteria 2458
164 Ga0265316_10234717 3300031344 Bacteria 1350
165 Ga0307513_10000004 3300031456 Bacteria 558931
166 Ga0307513_10000015 3300031456 Bacteria 296183
167 Ga0307509_10140201 3300031507 Bacteria 2355
168 Ga0307509_10503449 3300031507 Bacteria 895
169 Ga0307408_100135523 3300031548 Bacteria 1926
170 Ga0307408_100784088 3300031548 Bacteria 864
171 Ga0307508_10000017 3300031616 Bacteria 203567
172 Ga0307514_10067069 3300031649 Bacteria 2710
173 Ga0265314_10000727 3300031711 Bacteria 39795
174 Ga0265314_10041836 3300031711 Bacteria 3275
175 Ga0265342_10060935 3300031712 Bacteria 2224
176 Ga0307516_10010534 3300031730 Bacteria 10154
177 Ga0307405_10209380 3300031731 Bacteria 1422
178 Ga0307405_10445875 3300031731 Bacteria 1025
179 Ga0307406_10120957 3300031901 Bacteria 1820
180 Ga0307406_10122705 3300031901 Bacteria 1809
181 Ga0307412_10075241 3300031911 Bacteria 2316
182 Ga0307412_10432686 3300031911 Bacteria 1079
183 Ga0307414_10005133 3300032004 Bacteria 7179
184 Ga0307414_10010665 3300032004 Bacteria 5347
185 Ga0307414_10072452 3300032004 Bacteria 2489
186 Ga0307411_10010861 3300032005 Bacteria 4879
187 Ga0307411_10194167 3300032005 Bacteria 1553
188 Ga0307507_10049393 3300033179 Bacteria 4077
189 Ga0395899_0022001 3300037312 Bacteria 4835
190 Ga0395899_0047207 3300037312 Bacteria 3207
191 Ga0395900_0009604 3300037418 Bacteria 9920
192 Ga0395900_0013954 3300037418 Bacteria 8199
193 Ga0395900_0171276 3300037418 Bacteria 2210
194 Ga0395900_0367310 3300037418 Bacteria 1409
195 Ga0395898_0017965 3300037466 Bacteria 7216
196 Ga0395898_0037297 3300037466 Bacteria 4823
197 Ga0395898_0913694 3300037466 Bacteria 816
198 Ga0395905_0000033 3300037471 Bacteria 279363
199 Ga0395905_0016242 3300037471 Bacteria 7072
200 Ga0395905_0033706 3300037471 Bacteria 4809
201 Ga0395905_0051540 3300037471 Bacteria 3855
202 Ga0395905_0062828 3300037471 Bacteria 3473
203 Ga0395905_0133542 3300037471 Bacteria 2334
204 Ga0395905_0212244 3300037471 Bacteria 1813
205 Ga0395901_0029467 3300038443 Bacteria 5652
206 Ga0395901_0042575 3300038443 Bacteria 4708
207 Ga0395901_0084301 3300038443 Bacteria 3322
208 Ga0395901_0298680 3300038443 Bacteria 1670
209 Ga0395901_0539695 3300038443 Bacteria 1183
210 Ga0395901_0853937 3300038443 Bacteria 895
211 Ga0436363_0458703 3300039450 Bacteria 2308
212 Ga0439436_0027327 3300041404 Bacteria 1669
213 Ga0439439_0021843 3300041406 Bacteria 1596
214 Ga0439453_0003774 3300041408 Bacteria 2205
215 Ga0439461_0007219 3300041410 Bacteria 1961
216 Ga0439461_0023438 3300041410 Bacteria 1242
217 Ga0439466_0056022 3300041411 Bacteria 1280
218 Ga0439465_0001209 3300041413 Bacteria 8329
219 Ga0439465_0010148 3300041413 Bacteria 2960
220 Ga0451787_380795 3300041441 Bacteria 1265
221 Ga0451791_0223219 3300041451 Bacteria 1921
222 Ga0451804_1162748 3300041463 Bacteria 1133
223 Ga0451807_1425894 3300041486 Bacteria 1869
224 Ga0451837_0425919 3300041494 Bacteria 2777
225 Ga0451841_0485304 3300041498 Bacteria 1440
226 Ga0451843_0665137 3300041509 Bacteria 1672
227 Ga0451853_2109304 3300041512 Bacteria 1357
228 Ga0451853_2757152 3300041512 Bacteria 1729
229 Ga0451853_3569555 3300041512 Bacteria 1195
230 Ga0439432_006561 3300042006 Bacteria 4150
231 Ga0439432_007763 3300042006 Bacteria 3786
232 Ga0439449_0000018 3300042007 Bacteria 46636
233 Ga0439449_0000464 3300042007 Bacteria 15110
234 Ga0439449_0004713 3300042007 Bacteria 5264
235 Ga0439449_0044551 3300042007 Bacteria 1645
236 Ga0439449_0079223 3300042007 Bacteria 1211
237 Ga0439452_029678 3300042010 Bacteria 1355
238 Ga0439457_059024 3300042014 Bacteria 867
239 Ga0439462_0005223 3300042015 Bacteria 3195
240 Ga0450921_000735 3300042123 Bacteria 1704
241 Ga0450891_007080 3300042129 Bacteria 1029
242 Ga0450892_013746 3300042130 Bacteria 741
243 Ga0450898_009464 3300042134 Bacteria 1559
244 Ga0450898_021556 3300042134 Bacteria 1135
245 Ga0450899_002164 3300042135 Bacteria 2142
246 Ga0439446_0022970 3300042156 Bacteria 1771
247 Ga0439458_0060374 3300042157 Bacteria 946
248 Ga0450909_017725 3300042185 Bacteria 1055
249 Ga0450909_023705 3300042185 Bacteria 920
250 Ga0450893_0000696 3300042532 Bacteria 4871
251 Ga0451577_0033481 3300042876 Bacteria 4632
252 Ga0466969_0001537 3300044656 Bacteria 12389
253 Ga0453683_0003001 3300044673 Bacteria 12644
254 Ga0466965_0188250 3300044683 Bacteria 1091
255 Ga0466966_0000766 3300044684 Bacteria 20373
256 Ga0466961_0024588 3300044693 Bacteria 3875
257 Ga0453684_0329340 3300044712 Bacteria 1727
258 Ga0466957_0355441 3300044842 Bacteria 995
259 Ga0466957_0560042 3300044842 Bacteria 797
260 Ga0466959_0009923 3300045049 Bacteria 6788
261 Ga0451576_0031290 3300045051 Bacteria 5676
262 Ga0451576_0086070 3300045051 Bacteria 3269
263 Ga0451576_0328959 3300045051 Bacteria 1599
264 Ga0495627_000396 3300046453 Bacteria 39486
265 Ga0495650_0000181 3300046471 Bacteria 137791
266 Ga0495650_0086193 3300046471 Bacteria 1202
267 Ga0495610_0028781 3300046512 Bacteria 2934
268 Ga0495620_0115971 3300046515 Bacteria 1059
269 Ga0495632_0008036 3300046519 Bacteria 6546
270 Ga0495632_0087145 3300046519 Bacteria 1484
271 Ga0495637_0036487 3300046520 Bacteria 2141
272 Ga0495643_0000524 3300046522 Bacteria 47789
273 Ga0495654_0001876 3300046530 Bacteria 13973
274 Ga0495665_0062482 3300046531 Bacteria 1966
275 Ga0495586_0011889 3300046535 Bacteria 4626
276 Ga0495633_0112941 3300046558 Bacteria 1260
277 Ga0495656_0007587 3300046615 Bacteria 3841
278 Ga0495625_0002261 3300046660 Bacteria 21166
279 Ga0495661_0047543 3300046665 Bacteria 2612
280 Ga0495613_0273764 3300046689 Bacteria 1174
281 Ga0495649_0245955 3300046694 Bacteria 920
282 Ga0495589_0000002 3300046794 Bacteria 758846
283 Ga0495581_0200831 3300047315 Bacteria 1166
284 Ga0495581_0369589 3300047315 Bacteria 837
285 Ga0495674_0023766 3300047319 Bacteria 5643
286 Ga0495685_097934 3300047447 Bacteria 969
287 Ga0495681_0163604 3300047470 Bacteria 925
288 Ga0495614_0382947 3300048089 Bacteria 659
289 Ga0495626_0018673 3300048091 Bacteria 3476
290 Ga0495626_0104253 3300048091 Bacteria 1233
291 Ga0496102_0016392 3300048905 Bacteria 6472
292 Ga0496103_0040800 3300048906 Bacteria 2852
293 Ga0496107_0577940 3300048910 Bacteria 831
294 Ga0496114_0012295 3300048917 Bacteria 6849
295 Ga0496114_0049472 3300048917 Bacteria 3498
296 Ga0496116_0000031 3300048919 Bacteria 420043
297 Ga0496117_0010688 3300048920 Bacteria 8307
298 Ga0496117_0079930 3300048920 Bacteria 2152
299 Ga0496118_0112792 3300048921 Bacteria 1798
300 Ga0496119_0002128 3300048922 Bacteria 22288
301 Ga0496119_0002133 3300048922 Bacteria 22263
302 Ga0496120_0001694 3300048923 Bacteria 25270
303 Ga0496120_0001697 3300048923 Bacteria 25237
304 Ga0496124_0000039 3300048927 Bacteria 307831
305 Ga0496126_0033874 3300048929 Bacteria 4804
306 Ga0495678_000849 3300049459 Bacteria 27308
307 Ga0495678_005607 3300049459 Bacteria 6872
308 Ga0501290_002250 3300049513 Bacteria 2507
309 Ga0501300_001422 3300049523 Bacteria 3585
310 Ga0501032_0004611 3300049569 Bacteria 10367
311 Ga0501034_0000015 3300049571 Bacteria 296163
312 Ga0501037_0039744 3300049573 Bacteria 3462
313 Ga0501037_0256339 3300049573 Bacteria 1223
314 Ga0501038_0346481 3300049574 Bacteria 1158
315 Ga0501043_0038721 3300049579 Bacteria 3749
316 Ga0501043_0045899 3300049579 Bacteria 3435
317 Ga0501046_0047497 3300049580 Bacteria 3403
318 Ga0501047_0149642 3300049581 Bacteria 2211
319 Ga0501047_0328311 3300049581 Bacteria 1368
320 Ga0501048_0800678 3300049582 Bacteria 677
321 Ga0501207_046759 3300049654 Bacteria 765
322 Ga0501223_040395 3300049663 Bacteria 905
323 Ga0501265_000612 3300049762 Bacteria 3846
324 Ga0501275_000439 3300049772 Bacteria 4698
325 Ga0501035_0190489 3300049822 Bacteria 1763
326 Ga0501044_0113647 3300049823 Bacteria 2714
327 Ga0501044_0149561 3300049823 Bacteria 2318
328 nmdc:mga03683_177987_c1 3300050489 Bacteria 969
329 nmdc:mga03683_36041_c1 3300050489 Bacteria 2010
330 nmdc:mga03683_7145_c2 3300050489 Bacteria 3508
331 nmdc:mga03683_85333_c1 3300050489 Bacteria 1369
332 nmdc:mga03n38_23404_c1 3300050490 Bacteria 2512
333 nmdc:mga00v17_94516_c1 3300050491 Bacteria 1881
334 nmdc:mga0yw44_107276_c1 3300050492 Bacteria 1786
335 nmdc:mga0yw44_28326_c1 3300050492 Bacteria 3221
336 nmdc:mga0k408_268420_c1 3300050493 Bacteria 1019
337 nmdc:mga0k408_34931_c1 3300050493 Bacteria 2881
338 nmdc:mga0k408_484402_c1 3300050493 Bacteria 734
339 nmdc:mga06z11_230836_c1 3300050494 Bacteria 1084
340 nmdc:mga06z11_250971_c1 3300050494 Bacteria 1042
341 nmdc:mga04h51_75906_c1 3300050495 Bacteria 1183
342 nmdc:mga07m45_163119_c1 3300050496 Bacteria 1294
343 nmdc:mga07m45_269968_c1 3300050496 Bacteria 990
344 nmdc:mga07m45_350466_c1 3300050496 Bacteria 858
345 nmdc:mga0qj67_389192_c1 3300050509 Bacteria 1125
346 Ga0500644_0002375 3300053088 Bacteria 4726
347 Ga0500651_0152665 3300053093 Bacteria 1386
348 Ga0500593_002747 3300053117 Bacteria 6523
349 Ga0500608_195708 3300053122 Bacteria 841
350 Ga0500658_0008135 3300053134 Bacteria 3878
351 Ga0500570_059732 3300053724 Bacteria 1855
352 Ga0500645_000805 3300053730 Bacteria 18797
353 Ga0500645_003119 3300053730 Bacteria 6912
354 Ga0500645_023865 3300053730 Bacteria 1873
355 Ga0500587_010315 3300053739 Bacteria 1184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0577940 Ga0496107_0577940_36_608 187
2 3300048089 Ga0495614_0382947 Ga0495614_0382947_15_590 190
3 3300030733 Ga0314311_1027786 Ga0314311_10277862 196
4 3300006844 Ga0075428_100769027 Ga0075428_1007690271 198
5 3300049581 Ga0501047_0149642 Ga0501047_0149642_1470_2111 200
6 3300053739 Ga0500587_010315 Ga0500587_010315_23_634 200
7 3300041441 Ga0451787_380795 Ga0451787_380795_320_973 201
8 3300041512 Ga0451853_3569555 Ga0451853_3569555_45_698 201
9 3300005440 Ga0070705_100140020 Ga0070705_1001400202 202
10 3300005617 Ga0068859_100240050 Ga0068859_1002400503 202
11 3300006931 Ga0097620_100240036 Ga0097620_1002400363 202
12 3300025273 Ga0209673_1023553 Ga0209673_10235532 203
13 3300050509 nmdc:mga0qj67_389192_c1 nmdc:mga0qj67_389192_c1_259_879 203
14 3300037418 Ga0395900_0171276 Ga0395900_0171276_650_1273 204
15 3300037466 Ga0395898_0913694 Ga0395898_0913694_51_674 204
16 3300037471 Ga0395905_0033706 Ga0395905_0033706_1841_2464 204
17 3300037471 Ga0395905_0133542 Ga0395905_0133542_517_1140 204
18 3300038443 Ga0395901_0298680 Ga0395901_0298680_330_953 204
19 3300041408 Ga0439453_0003774 Ga0439453_0003774_1438_2061 204
20 3300041410 Ga0439461_0007219 Ga0439461_0007219_248_871 204
21 3300042010 Ga0439452_029678 Ga0439452_029678_494_1117 204
22 3300042123 Ga0450921_000735 Ga0450921_000735_664_1287 204
23 3300042129 Ga0450891_007080 Ga0450891_007080_307_930 204
24 3300042130 Ga0450892_013746 Ga0450892_013746_21_644 204
25 3300042134 Ga0450898_009464 Ga0450898_009464_281_904 204
26 3300042135 Ga0450899_002164 Ga0450899_002164_956_1579 204
27 3300042156 Ga0439446_0022970 Ga0439446_0022970_1112_1735 204
28 3300042157 Ga0439458_0060374 Ga0439458_0060374_27_650 204
29 3300042185 Ga0450909_017725 Ga0450909_017725_261_884 204
30 3300050492 nmdc:mga0yw44_107276_c1 nmdc:mga0yw44_107276_c1_232_855 204
31 iso_pu_bacteria 2585428062 2587757366 204
32 3300037312 Ga0395899_0022001 Ga0395899_0022001_586_1212 205
33 3300037418 Ga0395900_0013954 Ga0395900_0013954_2281_2907 205
34 3300037418 Ga0395900_0367310 Ga0395900_0367310_268_894 205
35 3300037466 Ga0395898_0037297 Ga0395898_0037297_3022_3648 205
36 3300038443 Ga0395901_0042575 Ga0395901_0042575_3814_4440 205
37 iso_pu_bacteria 8004021418 8004025221 205
38 3300012513 Ga0157326_1004983 Ga0157326_10049832 206
39 3300044656 Ga0466969_0001537 Ga0466969_0001537_11191_11820 206
40 3300044684 Ga0466966_0000766 Ga0466966_0000766_2392_3021 206
41 3300044693 Ga0466961_0024588 Ga0466961_0024588_1964_2593 206
42 3300045049 Ga0466959_0009923 Ga0466959_0009923_1711_2340 206
43 3300049582 Ga0501048_0800678 Ga0501048_0800678_35_664 206
44 iso_pu_bacteria 2846037992 2846042403 206
45 iso_pu_bacteria 2919059106 2919060854 206
46 iso_pu_bacteria 2939647034 2939647886 206
47 3300006353 Ga0075370_10131140 Ga0075370_101311402 207
48 3300028794 Ga0307515_10000416 Ga0307515_1000041633 207
49 3300028794 Ga0307515_10002793 Ga0307515_100027938 207
50 3300028794 Ga0307515_10015986 Ga0307515_100159864 207
51 3300030522 Ga0307512_10075123 Ga0307512_100751231 207
52 3300030522 Ga0307512_10105104 Ga0307512_101051042 207
53 3300031507 Ga0307509_10140201 Ga0307509_101402013 207
54 3300031616 Ga0307508_10000017 Ga0307508_10000017123 207
55 3300031649 Ga0307514_10067069 Ga0307514_100670694 207
56 3300031730 Ga0307516_10010534 Ga0307516_100105349 207
57 3300041463 Ga0451804_1162748 Ga0451804_1162748_174_818 207
58 3300041486 Ga0451807_1425894 Ga0451807_1425894_524_1168 207
59 3300041498 Ga0451841_0485304 Ga0451841_0485304_317_961 207
60 3300041509 Ga0451843_0665137 Ga0451843_0665137_534_1178 207
61 3300041512 Ga0451853_2109304 Ga0451853_2109304_564_1208 207
62 3300046512 Ga0495610_0028781 Ga0495610_0028781_202_846 207
63 3300046515 Ga0495620_0115971 Ga0495620_0115971_176_820 207
64 3300046519 Ga0495632_0008036 Ga0495632_0008036_3045_3689 207
65 3300046519 Ga0495632_0087145 Ga0495632_0087145_383_1027 207
66 3300046660 Ga0495625_0002261 Ga0495625_0002261_8425_9069 207
67 3300046694 Ga0495649_0245955 Ga0495649_0245955_196_840 207
68 3300049654 Ga0501207_046759 Ga0501207_046759_75_707 207
69 3300050493 nmdc:mga0k408_34931_c1 nmdc:mga0k408_34931_c1_1654_2298 207
70 3300050493 nmdc:mga0k408_484402_c1 nmdc:mga0k408_484402_c1_68_712 207
71 3300050496 nmdc:mga07m45_269968_c1 nmdc:mga07m45_269968_c1_261_905 207
72 3300050496 nmdc:mga07m45_350466_c1 nmdc:mga07m45_350466_c1_86_730 207
73 3300053093 Ga0500651_0152665 Ga0500651_0152665_45_689 207
74 3300053134 Ga0500658_0008135 Ga0500658_0008135_2829_3473 207
75 3300053724 Ga0500570_059732 Ga0500570_059732_794_1438 207
76 iso_pu_bacteria 2511231002 2511244036 207
77 3300005367 Ga0070667_100265142 Ga0070667_1002651422 208
78 3300002987 JGI25159J45721_1007179 JGI25159J45721_10071793 209
79 3300003187 JGI25151J46595_10006042 JGI25151J46595_100060425 209
80 3300003354 JGI25160J50197_1012934 JGI25160J50197_10129343 209
81 3300003771 Ga0055526_1010162 Ga0055526_10101624 209
82 3300003773 Ga0055537_1000463 Ga0055537_100046313 209
83 3300003775 Ga0055524_1000261 Ga0055524_100026138 209
84 3300003781 Ga0055536_1007864 Ga0055536_10078646 209
85 3300003790 Ga0055528_1003200 Ga0055528_10032009 209
86 3300003791 Ga0055530_10000190 Ga0055530_1000019037 209
87 3300003792 Ga0055540_1000187 Ga0055540_100018740 209
88 3300003794 Ga0055531_10009363 Ga0055531_100093636 209
89 3300005262 Ga0065165_1013411 Ga0065165_10134114 209
90 3300005327 Ga0070658_10273160 Ga0070658_102731602 209
91 3300005339 Ga0070660_100017394 Ga0070660_1000173946 209
92 3300005530 Ga0070679_100017823 Ga0070679_1000178238 209
93 3300005539 Ga0068853_100174400 Ga0068853_1001744004 209
94 3300009098 Ga0105245_10000111 Ga0105245_1000011148 209
95 3300009177 Ga0105248_10601666 Ga0105248_106016662 209
96 3300013296 Ga0157374_11056642 Ga0157374_110566421 209
97 3300014969 Ga0157376_10007779 Ga0157376_100077794 209
98 3300014969 Ga0157376_10034456 Ga0157376_100344563 209
99 3300025245 Ga0207425_1010873 Ga0207425_10108732 209
100 3300025263 Ga0209565_1000102 Ga0209565_100010249 209
101 3300025273 Ga0209673_1000189 Ga0209673_100018966 209
102 3300025284 Ga0209130_1000423 Ga0209130_100042338 209
103 3300025291 Ga0209675_1000288 Ga0209675_100028817 209
104 3300025292 Ga0209676_1000069 Ga0209676_100006953 209
105 3300025292 Ga0209676_1009516 Ga0209676_10095164 209
106 3300025294 Ga0209025_1006857 Ga0209025_10068578 209
107 3300025295 Ga0209564_1000415 Ga0209564_100041557 209
108 3300025298 Ga0209050_1000023 Ga0209050_1000023228 209
109 3300025299 Ga0209256_1000003 Ga0209256_1000003965 209
110 3300025302 Ga0207426_1006411 Ga0207426_10064114 209
111 3300025303 Ga0209051_1000017 Ga0209051_1000017228 209
112 3300025304 Ga0209257_1000041 Ga0209257_1000041228 209
113 3300025304 Ga0209257_1019350 Ga0209257_10193502 209
114 3300025927 Ga0207687_10000295 Ga0207687_1000029529 209
115 3300025941 Ga0207711_10536234 Ga0207711_105362342 209
116 3300031911 Ga0307412_10432686 Ga0307412_104326862 209
117 3300038443 Ga0395901_0853937 Ga0395901_0853937_22_669 209
118 3300041410 Ga0439461_0023438 Ga0439461_0023438_572_1216 209
119 3300042532 Ga0450893_0000696 Ga0450893_0000696_3508_4155 209
120 3300045051 Ga0451576_0086070 Ga0451576_0086070_504_1151 209
121 3300048905 Ga0496102_0016392 Ga0496102_0016392_3647_4297 209
122 3300050496 nmdc:mga07m45_163119_c1 nmdc:mga07m45_163119_c1_58_711 209
123 iso_pu_bacteria 2881101125 2881102879 209
124 3300002987 JGI25159J45721_1000065 JGI25159J45721_100006534 210
125 3300003354 JGI25160J50197_1000098 JGI25160J50197_100009852 210
126 3300003374 JGI25161J50226_1000037 JGI25161J50226_100003790 210
127 3300009036 Ga0105244_10010998 Ga0105244_100109985 210
128 3300011119 Ga0105246_10013663 Ga0105246_100136632 210
129 3300025284 Ga0209130_1000141 Ga0209130_100014140 210
130 3300025298 Ga0209050_1003591 Ga0209050_100359111 210
131 3300025302 Ga0207426_1000145 Ga0207426_100014537 210
132 3300031901 Ga0307406_10120957 Ga0307406_101209572 210
133 3300037418 Ga0395900_0009604 Ga0395900_0009604_826_1473 210
134 3300037471 Ga0395905_0016242 Ga0395905_0016242_2692_3336 210
135 3300048917 Ga0496114_0049472 Ga0496114_0049472_1385_2032 210
136 3300049569 Ga0501032_0004611 Ga0501032_0004611_3109_3750 210
137 3300049571 Ga0501034_0000015 Ga0501034_0000015_23519_24160 210
138 3300049573 Ga0501037_0039744 Ga0501037_0039744_421_1062 210
139 3300049579 Ga0501043_0038721 Ga0501043_0038721_727_1368 210
140 iso_pu_bacteria 2506520007 2506577285 210
141 iso_pu_bacteria 2506520008 2506582423 210
142 iso_pu_bacteria 2508501071 2508851214 210
143 iso_pu_bacteria 2511231119 2511698148 210
144 iso_pu_bacteria 2545555800 2545558915 210
145 iso_pu_bacteria 2648501850 2651529720 210
146 iso_pu_bacteria 2654587920 2656275206 210
147 iso_pu_bacteria 2671180844 2674420986 210
148 iso_pu_bacteria 2687453601 2689443740 210
149 iso_pu_bacteria 2695420354 2695630060 210
150 iso_pu_bacteria 2772190666 2772437779 210
151 iso_pu_bacteria 2806310673 2807180488 210
152 iso_pu_bacteria 2869551831 2869553143 210
153 iso_pu_bacteria 2877768649 2877768939 210
154 iso_pu_bacteria 2880169592 2880169881 210
155 iso_pu_bacteria 2888366609 2888367769 210
156 iso_pu_bacteria 2897109615 2897109914 210
157 iso_pu_bacteria 2904560550 2904562397 210
158 iso_pu_bacteria 2932406140 2932407162 210
159 iso_pu_bacteria 2937967321 2937969081 210
160 iso_pu_bacteria 2939577877 2939579072 210
161 iso_pu_bacteria 2969141011 2969141311 210
162 iso_pu_bacteria 3006988479 3006991654 210
163 iso_pu_bacteria 640753048 640936787 210
164 iso_pu_bacteria 8004592986 8004595013 210
165 iso_pu_bacteria 8015394850 8015398003 210
166 iso_pu_bacteria 8051952484 8051956046 210
167 iso_pu_bacteria 8052174270 8052177609 210
168 3300003187 JGI25151J46595_10025299 JGI25151J46595_100252994 211
169 3300003771 Ga0055526_1013647 Ga0055526_10136474 211
170 3300003773 Ga0055537_1008480 Ga0055537_10084801 211
171 3300005353 Ga0070669_100016858 Ga0070669_1000168584 211
172 3300005356 Ga0070674_100848725 Ga0070674_1008487251 211
173 3300005468 Ga0070707_100878567 Ga0070707_1008785671 211
174 3300006038 Ga0075365_10064526 Ga0075365_100645262 211
175 3300006051 Ga0075364_10034550 Ga0075364_100345503 211
176 3300006880 Ga0075429_100194297 Ga0075429_1001942972 211
177 3300025245 Ga0207425_1002387 Ga0207425_10023876 211
178 3300025263 Ga0209565_1011608 Ga0209565_10116084 211
179 3300025284 Ga0209130_1047531 Ga0209130_10475311 211
180 3300025291 Ga0209675_1012795 Ga0209675_10127952 211
181 3300025294 Ga0209025_1017325 Ga0209025_10173253 211
182 3300025294 Ga0209025_1018686 Ga0209025_10186862 211
183 3300025295 Ga0209564_1000575 Ga0209564_100057554 211
184 3300025297 Ga0209758_1003237 Ga0209758_10032378 211
185 3300025303 Ga0209051_1000928 Ga0209051_100092819 211
186 3300025304 Ga0209257_1000096 Ga0209257_1000096237 211
187 3300025909 Ga0207705_10460249 Ga0207705_104602492 211
188 3300025923 Ga0207681_10012201 Ga0207681_100122014 211
189 3300031456 Ga0307513_10000004 Ga0307513_10000004117 211
190 3300032005 Ga0307411_10194167 Ga0307411_101941672 211
191 3300041406 Ga0439439_0021843 Ga0439439_0021843_874_1521 211
192 3300041451 Ga0451791_0223219 Ga0451791_0223219_101_829 211
193 3300041512 Ga0451853_2757152 Ga0451853_2757152_436_1116 211
194 3300042007 Ga0439449_0000464 Ga0439449_0000464_12937_13584 211
195 3300042014 Ga0439457_059024 Ga0439457_059024_181_828 211
196 3300042015 Ga0439462_0005223 Ga0439462_0005223_1422_2069 211
197 3300042185 Ga0450909_023705 Ga0450909_023705_221_868 211
198 3300044673 Ga0453683_0003001 Ga0453683_0003001_3494_4162 211
199 3300045051 Ga0451576_0031290 Ga0451576_0031290_3599_4267 211
200 3300046558 Ga0495633_0112941 Ga0495633_0112941_468_1166 211
201 3300046615 Ga0495656_0007587 Ga0495656_0007587_1138_1836 211
202 3300047447 Ga0495685_097934 Ga0495685_097934_46_744 211
203 3300049573 Ga0501037_0256339 Ga0501037_0256339_292_960 211
204 3300049574 Ga0501038_0346481 Ga0501038_0346481_439_1107 211
205 3300049822 Ga0501035_0190489 Ga0501035_0190489_305_973 211
206 3300049823 Ga0501044_0149561 Ga0501044_0149561_777_1445 211
207 3300050489 nmdc:mga03683_7145_c2 nmdc:mga03683_7145_c2_1335_2018 211
208 3300050491 nmdc:mga00v17_94516_c1 nmdc:mga00v17_94516_c1_43_726 211
209 3300053730 Ga0500645_023865 Ga0500645_023865_315_995 211
210 iso_pu_bacteria 2860339153 2860339471 211
211 iso_pu_bacteria 2888373701 2888374540 211
212 3300002704 JGI25155J39150_1000005 JGI25155J39150_100000556 212
213 3300002705 JGI25156J39149_1000006 JGI25156J39149_100000656 212
214 3300002738 JGI25154J39366_1000015 JGI25154J39366_1000015191 212
215 3300002741 JGI25157J39369_1000016 JGI25157J39369_1000016127 212
216 3300005334 Ga0068869_100565322 Ga0068869_1005653221 212
217 3300005338 Ga0068868_100059299 Ga0068868_1000592993 212
218 3300005530 Ga0070679_100027204 Ga0070679_1000272043 212
219 3300005549 Ga0070704_100121728 Ga0070704_1001217282 212
220 3300005563 Ga0068855_100065090 Ga0068855_1000650905 212
221 3300005614 Ga0068856_100140061 Ga0068856_1001400613 212
222 3300006038 Ga0075365_10005867 Ga0075365_100058674 212
223 3300006038 Ga0075365_10042955 Ga0075365_100429552 212
224 3300006048 Ga0075363_100017916 Ga0075363_1000179162 212
225 3300006177 Ga0075362_10021036 Ga0075362_100210362 212
226 3300006178 Ga0075367_10036632 Ga0075367_100366322 212
227 3300006195 Ga0075366_10103690 Ga0075366_101036902 212
228 3300006948 Ga0099826_10156722 Ga0099826_101567222 212
229 3300009093 Ga0105240_10049915 Ga0105240_100499154 212
230 3300015262 Ga0182007_10067746 Ga0182007_100677462 212
231 3300021377 Ga0213874_10063773 Ga0213874_100637732 212
232 3300025206 Ga0209435_100010 Ga0209435_10001067 212
233 3300025246 Ga0209646_1000001 Ga0209646_10000012076 212
234 3300025250 Ga0209026_1000001 Ga0209026_1000001732 212
235 3300025254 Ga0209148_1002363 Ga0209148_10023635 212
236 3300025256 Ga0209759_1000001 Ga0209759_10000011707 212
237 3300025299 Ga0209256_1027311 Ga0209256_10273112 212
238 3300025913 Ga0207695_10243105 Ga0207695_102431052 212
239 3300025919 Ga0207657_10048150 Ga0207657_100481505 212
240 3300025921 Ga0207652_10148321 Ga0207652_101483213 212
241 3300025921 Ga0207652_10173725 Ga0207652_101737252 212
242 3300025932 Ga0207690_10663821 Ga0207690_106638212 212
243 3300025942 Ga0207689_10321191 Ga0207689_103211912 212
244 3300025942 Ga0207689_10543102 Ga0207689_105431021 212
245 3300025949 Ga0207667_10191974 Ga0207667_101919742 212
246 3300026023 Ga0207677_10006076 Ga0207677_100060766 212
247 3300026078 Ga0207702_10075673 Ga0207702_100756733 212
248 3300031235 Ga0265330_10019426 Ga0265330_100194262 212
249 3300031250 Ga0265331_10035359 Ga0265331_100353593 212
250 3300031344 Ga0265316_10234717 Ga0265316_102347172 212
251 3300031548 Ga0307408_100135523 Ga0307408_1001355232 212
252 3300031548 Ga0307408_100784088 Ga0307408_1007840882 212
253 3300031711 Ga0265314_10000727 Ga0265314_1000072711 212
254 3300031711 Ga0265314_10041836 Ga0265314_100418364 212
255 3300031712 Ga0265342_10060935 Ga0265342_100609353 212
256 3300031901 Ga0307406_10122705 Ga0307406_101227051 212
257 3300037312 Ga0395899_0047207 Ga0395899_0047207_1024_1695 212
258 3300037466 Ga0395898_0017965 Ga0395898_0017965_4787_5458 212
259 3300037471 Ga0395905_0000033 Ga0395905_0000033_261297_261968 212
260 3300037471 Ga0395905_0051540 Ga0395905_0051540_1328_2011 212
261 3300037471 Ga0395905_0062828 Ga0395905_0062828_2443_3114 212
262 3300037471 Ga0395905_0212244 Ga0395905_0212244_257_928 212
263 3300038443 Ga0395901_0029467 Ga0395901_0029467_1146_1817 212
264 3300038443 Ga0395901_0084301 Ga0395901_0084301_1713_2384 212
265 3300038443 Ga0395901_0539695 Ga0395901_0539695_235_906 212
266 3300039450 Ga0436363_0458703 Ga0436363_0458703_443_1090 212
267 3300044683 Ga0466965_0188250 Ga0466965_0188250_398_1081 212
268 3300044842 Ga0466957_0355441 Ga0466957_0355441_44_715 212
269 3300044842 Ga0466957_0560042 Ga0466957_0560042_100_771 212
270 3300046471 Ga0495650_0086193 Ga0495650_0086193_18_659 212
271 3300049579 Ga0501043_0045899 Ga0501043_0045899_458_1129 212
272 3300049580 Ga0501046_0047497 Ga0501046_0047497_637_1308 212
273 3300049581 Ga0501047_0328311 Ga0501047_0328311_162_833 212
274 3300049823 Ga0501044_0113647 Ga0501044_0113647_641_1312 212
275 3300050489 nmdc:mga03683_177987_c1 nmdc:mga03683_177987_c1_55_726 212
276 3300050489 nmdc:mga03683_36041_c1 nmdc:mga03683_36041_c1_818_1489 212
277 3300050489 nmdc:mga03683_85333_c1 nmdc:mga03683_85333_c1_25_696 212
278 3300050490 nmdc:mga03n38_23404_c1 nmdc:mga03n38_23404_c1_1428_2099 212
279 3300050492 nmdc:mga0yw44_28326_c1 nmdc:mga0yw44_28326_c1_56_727 212
280 3300050493 nmdc:mga0k408_268420_c1 nmdc:mga0k408_268420_c1_203_874 212
281 3300050494 nmdc:mga06z11_230836_c1 nmdc:mga06z11_230836_c1_353_1024 212
282 3300050494 nmdc:mga06z11_250971_c1 nmdc:mga06z11_250971_c1_39_710 212
283 3300050495 nmdc:mga04h51_75906_c1 nmdc:mga04h51_75906_c1_384_1055 212
284 3300053088 Ga0500644_0002375 Ga0500644_0002375_2135_2866 212
285 3300053117 Ga0500593_002747 Ga0500593_002747_2358_3089 212
286 iso_pu_bacteria 2919704043 2919704095 212
287 3300005327 Ga0070658_10013790 Ga0070658_1001379011 213
288 3300005327 Ga0070658_10228050 Ga0070658_102280501 213
289 3300025909 Ga0207705_10028819 Ga0207705_100288193 213
290 3300045051 Ga0451576_0328959 Ga0451576_0328959_848_1495 213
291 iso_pu_bacteria 2643221581 2643916154 213
292 iso_pu_bacteria 2643221695 2644528871 213
293 3300005289 Ga0065704_10192307 Ga0065704_101923072 214
294 3300006946 Ga0079104_1001321 Ga0079104_100132115 214
295 3300006946 Ga0079104_1010765 Ga0079104_10107652 214
296 3300009011 Ga0105251_10000757 Ga0105251_100007577 214
297 3300009011 Ga0105251_10000772 Ga0105251_1000077225 214
298 3300009011 Ga0105251_10002592 Ga0105251_100025923 214
299 3300009036 Ga0105244_10002665 Ga0105244_100026653 214
300 3300009092 Ga0105250_10004582 Ga0105250_100045823 214
301 3300009101 Ga0105247_10000018 Ga0105247_10000018124 214
302 3300009174 Ga0105241_10000004 Ga0105241_10000004391 214
303 3300013100 Ga0157373_10000220 Ga0157373_1000022031 214
304 3300017792 Ga0163161_10000690 Ga0163161_100006902 214
305 3300025711 Ga0207696_1000001 Ga0207696_100000141 214
306 3300025728 Ga0207655_1000011 Ga0207655_1000011300 214
307 3300025735 Ga0207713_1000093 Ga0207713_100009321 214
308 3300025735 Ga0207713_1000205 Ga0207713_100020541 214
309 3300025900 Ga0207710_10000049 Ga0207710_10000049182 214
310 3300025911 Ga0207654_10000006 Ga0207654_10000006408 214
311 3300027111 Ga0209281_1000008 Ga0209281_1000008390 214
312 3300027111 Ga0209281_1007444 Ga0209281_10074443 214
313 3300030731 Ga0316177_1019334 Ga0316177_10193343 214
314 3300030733 Ga0314311_1112682 Ga0314311_11126822 214
315 3300041411 Ga0439466_0056022 Ga0439466_0056022_283_927 214
316 3300042006 Ga0439432_007763 Ga0439432_007763_2207_2851 214
317 3300042134 Ga0450898_021556 Ga0450898_021556_189_845 214
318 3300046453 Ga0495627_000396 Ga0495627_000396_34693_35337 214
319 3300046471 Ga0495650_0000181 Ga0495650_0000181_70148_70795 214
320 3300046520 Ga0495637_0036487 Ga0495637_0036487_417_1064 214
321 3300046522 Ga0495643_0000524 Ga0495643_0000524_4200_4856 214
322 3300046530 Ga0495654_0001876 Ga0495654_0001876_8884_9528 214
323 3300046531 Ga0495665_0062482 Ga0495665_0062482_830_1477 214
324 3300046535 Ga0495586_0011889 Ga0495586_0011889_3648_4295 214
325 3300046665 Ga0495661_0047543 Ga0495661_0047543_1627_2295 214
326 3300046689 Ga0495613_0273764 Ga0495613_0273764_138_785 214
327 3300046794 Ga0495589_0000002 Ga0495589_0000002_597231_597875 214
328 3300047315 Ga0495581_0200831 Ga0495581_0200831_214_861 214
329 3300047315 Ga0495581_0369589 Ga0495581_0369589_132_779 214
330 3300047319 Ga0495674_0023766 Ga0495674_0023766_3116_3763 214
331 3300047470 Ga0495681_0163604 Ga0495681_0163604_227_874 214
332 3300048091 Ga0495626_0018673 Ga0495626_0018673_146_802 214
333 3300048091 Ga0495626_0104253 Ga0495626_0104253_12_668 214
334 3300048906 Ga0496103_0040800 Ga0496103_0040800_1405_2049 214
335 3300048919 Ga0496116_0000031 Ga0496116_0000031_394056_394700 214
336 3300048920 Ga0496117_0010688 Ga0496117_0010688_7548_8192 214
337 3300048920 Ga0496117_0079930 Ga0496117_0079930_373_1017 214
338 3300048921 Ga0496118_0112792 Ga0496118_0112792_152_796 214
339 3300048922 Ga0496119_0002128 Ga0496119_0002128_20606_21250 214
340 3300048922 Ga0496119_0002133 Ga0496119_0002133_1039_1683 214
341 3300048923 Ga0496120_0001694 Ga0496120_0001694_22533_23177 214
342 3300048923 Ga0496120_0001697 Ga0496120_0001697_2094_2738 214
343 3300048927 Ga0496124_0000039 Ga0496124_0000039_83145_83789 214
344 3300049459 Ga0495678_000849 Ga0495678_000849_19317_19970 214
345 3300049459 Ga0495678_005607 Ga0495678_005607_1493_2140 214
346 3300005354 Ga0070675_100017187 Ga0070675_1000171873 215
347 3300005354 Ga0070675_100091901 Ga0070675_1000919012 215
348 3300005365 Ga0070688_100004445 Ga0070688_1000044453 215
349 3300005365 Ga0070688_100569689 Ga0070688_1005696891 215
350 3300005466 Ga0070685_10049040 Ga0070685_100490401 215
351 3300006177 Ga0075362_10151131 Ga0075362_101511312 215
352 3300009094 Ga0111539_10922553 Ga0111539_109225532 215
353 3300009553 Ga0105249_10134687 Ga0105249_101346873 215
354 3300014745 Ga0157377_10066879 Ga0157377_100668792 215
355 3300025926 Ga0207659_10000402 Ga0207659_1000040210 215
356 3300025926 Ga0207659_10001350 Ga0207659_100013507 215
357 3300025941 Ga0207711_10344543 Ga0207711_103445432 215
358 3300025986 Ga0207658_10305635 Ga0207658_103056352 215
359 3300026116 Ga0207674_10316063 Ga0207674_103160632 215
360 3300031456 Ga0307513_10000015 Ga0307513_10000015206 215
361 3300049513 Ga0501290_002250 Ga0501290_002250_417_1073 215
362 3300049523 Ga0501300_001422 Ga0501300_001422_1358_2014 215
363 3300049762 Ga0501265_000612 Ga0501265_000612_1810_2466 215
364 3300049772 Ga0501275_000439 Ga0501275_000439_641_1297 215
365 3300053122 Ga0500608_195708 Ga0500608_195708_22_783 215
366 3300053730 Ga0500645_000805 Ga0500645_000805_7888_8625 215
367 3300053730 Ga0500645_003119 Ga0500645_003119_863_1555 215
368 iso_pu_bacteria 2894414249 2894415028 215
369 3300031731 Ga0307405_10209380 Ga0307405_102093802 216
370 3300031911 Ga0307412_10075241 Ga0307412_100752412 216
371 3300032005 Ga0307411_10010861 Ga0307411_100108611 216
372 3300042006 Ga0439432_006561 Ga0439432_006561_2674_3327 216
373 3300042007 Ga0439449_0004713 Ga0439449_0004713_4172_4825 216
374 3300042007 Ga0439449_0044551 Ga0439449_0044551_934_1587 216
375 3300042007 Ga0439449_0079223 Ga0439449_0079223_251_904 216
376 3300049663 Ga0501223_040395 Ga0501223_040395_105_761 216
377 2162886007 SwRhRL2b_contig_877531 SwRhRL2b_0638.00006880 217
378 3300005289 Ga0065704_10070427 Ga0065704_1007042721 217
379 3300005356 Ga0070674_100449709 Ga0070674_1004497092 217
380 3300005440 Ga0070705_100035835 Ga0070705_1000358352 217
381 3300017792 Ga0163161_10391278 Ga0163161_103912782 217
382 3300031507 Ga0307509_10503449 Ga0307509_105034492 217
383 3300031731 Ga0307405_10445875 Ga0307405_104458751 217
384 3300032004 Ga0307414_10005133 Ga0307414_100051335 217
385 3300032004 Ga0307414_10010665 Ga0307414_100106652 217
386 3300032004 Ga0307414_10072452 Ga0307414_100724521 217
387 3300033179 Ga0307507_10049393 Ga0307507_100493934 217
388 3300041404 Ga0439436_0027327 Ga0439436_0027327_285_938 217
389 3300041413 Ga0439465_0001209 Ga0439465_0001209_7174_7827 217
390 3300041413 Ga0439465_0010148 Ga0439465_0010148_921_1574 217
391 3300041494 Ga0451837_0425919 Ga0451837_0425919_777_1442 217
392 3300042007 Ga0439449_0000018 Ga0439449_0000018_12067_12720 217
393 3300042876 Ga0451577_0033481 Ga0451577_0033481_1832_2491 217
394 3300044712 Ga0453684_0329340 Ga0453684_0329340_332_991 217
395 3300048917 Ga0496114_0012295 Ga0496114_0012295_682_1335 217
396 3300048929 Ga0496126_0033874 Ga0496126_0033874_3349_4002 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01470

Peptidase_C15

Pyroglutamyl peptidase

34

241

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gxh-assembly1.cif.gz_C crystal structure of a pyrrolidone-carboxylate peptidase 1 (target id nysgrc-012831) from xenorhabdus bovienii ss-2004 0.9862 6 205
3lac-assembly1.cif.gz_A crystal structure of bacillus anthracis pyrrolidone-carboxylate peptidase, pcp 0.9831 6 204
4gxh-assembly1.cif.gz_C crystal structure of a pyrrolidone-carboxylate peptidase 1 (target id nysgrc-012831) from xenorhabdus bovienii ss-2004 0.9717 6 205
5z48-assembly1.cif.gz_B crystal structure of pyrrolidone carboxylate peptidase i from deinococcus radiodurans r1 bound to pyroglutamate 0.9714 6 203
1aug-assembly1.cif.gz_D crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens 0.9709 6 212
ID Description Score Start End Superfamily
3lacB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9773 6 205 3.40.630.20
af_P9WIJ5_2_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9736 6 215 3.40.630.20
3lacB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9628 6 205 3.40.630.20
2ebjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9558 6 200 3.40.630.20
1iu8B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.9532 6 203 3.40.630.20
ID Description Score Start End GO Terms
AF-A0A2J4PCS5-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 1.001 7 106 GO:0005829
GO:0006508
GO:0016920
AF-T1ALJ8-F1-model_v4 pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9981 9 111 GO:0005829
GO:0006508
GO:0016920
AF-A0A7H4LX67-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9977 7 144 GO:0005829
GO:0006508
GO:0016920
AF-T1CET7-F1-model_v4 pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9968 6 131 GO:0005829
GO:0006508
GO:0016920
AF-A0A349W761-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9948 8 116 GO:0005829
GO:0006508
GO:0016920

Feature Viewer

pLDDT pTM Quality
94.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map