F433265

General Info

Members Datasets Scaffolds Average Seq Length
395 250 790 117

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0276474|Ga0395905_0276474_93_503
Length 136
Sequence MERIPILRLGDCLLVTIQVDMHDRLAMNLQDDLTEKIAQTGARGVLIDISALEMVDSFIGRMLAAIASMSRVLDAQTVVVGMQPAVAITLVELGLSLDGIPTALNVERGMDLLRASMGSTSVEMASQEFDRDCFED

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
68 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
237 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 12.91
Rhizosphere 82.28
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0276474 3300037471 Bacteria 1565
2 JGI24749J21850_1072059 3300002076 Bacteria 535
3 Ga0065704_10678315 3300005289 Bacteria 570
4 Ga0065707_10117266 3300005295 Bacteria 2216
5 Ga0065707_10401676 3300005295 Bacteria 852
6 Ga0070658_10331018 3300005327 Bacteria 1301
7 Ga0070658_10345657 3300005327 Bacteria 1273
8 Ga0070676_10163224 3300005328 Bacteria 1435
9 Ga0070683_100958234 3300005329 Bacteria 821
10 Ga0070690_100101442 3300005330 Bacteria 1909
11 Ga0070670_100072631 3300005331 Bacteria 2955
12 Ga0070670_100132163 3300005331 Bacteria 2156
13 Ga0070670_100169877 3300005331 Bacteria 1891
14 Ga0070677_10107874 3300005333 Bacteria 1238
15 Ga0070666_10879362 3300005335 Bacteria 662
16 Ga0068868_100973635 3300005338 Bacteria 775
17 Ga0070660_100105910 3300005339 Bacteria 2233
18 Ga0070660_101281823 3300005339 Bacteria 622
19 Ga0070689_100329343 3300005340 Bacteria 1277
20 Ga0070661_100055172 3300005344 Bacteria 2910
21 Ga0070661_101354440 3300005344 Bacteria 598
22 Ga0070661_101499282 3300005344 Bacteria 569
23 Ga0070668_100216814 3300005347 Bacteria 1576
24 Ga0070668_100521475 3300005347 Bacteria 1031
25 Ga0070669_101240881 3300005353 Bacteria 644
26 Ga0070675_100018083 3300005354 Bacteria 5609
27 Ga0070671_100096150 3300005355 Bacteria 2483
28 Ga0070674_100232599 3300005356 Bacteria 1439
29 Ga0070673_100037590 3300005364 Bacteria 3690
30 Ga0070673_100117388 3300005364 Bacteria 2214
31 Ga0070688_100055986 3300005365 Bacteria 2475
32 Ga0070659_100288219 3300005366 Bacteria 1367
33 Ga0070667_100559869 3300005367 Bacteria 1051
34 Ga0070713_101230058 3300005436 Bacteria 725
35 Ga0070705_100254077 3300005440 Bacteria 1235
36 Ga0070700_100744122 3300005441 Bacteria 784
37 Ga0070694_100035704 3300005444 Bacteria 3288
38 Ga0070694_100869097 3300005444 Bacteria 743
39 Ga0070694_101554115 3300005444 Bacteria 561
40 Ga0070708_100092117 3300005445 Bacteria 2761
41 Ga0070678_100347298 3300005456 Bacteria 1275
42 Ga0070678_101124065 3300005456 Bacteria 726
43 Ga0070662_100121064 3300005457 Bacteria 2006
44 Ga0068867_100156754 3300005459 Bacteria 1793
45 Ga0068867_100249535 3300005459 Bacteria 1443
46 Ga0068867_101682002 3300005459 Bacteria 595
47 Ga0070697_100263851 3300005536 Bacteria 1475
48 Ga0070697_101256901 3300005536 Bacteria 660
49 Ga0070672_100007842 3300005543 Bacteria 7285
50 Ga0070672_101599296 3300005543 Bacteria 585
51 Ga0070696_100804372 3300005546 Bacteria 774
52 Ga0070665_100053360 3300005548 Unclassified 4054
53 Ga0070704_101578282 3300005549 Bacteria 605
54 Ga0070664_100035595 3300005564 Bacteria 4180
55 Ga0070664_100440460 3300005564 Bacteria 1195
56 Ga0068859_101147755 3300005617 Bacteria 855
57 Ga0068864_101122390 3300005618 Bacteria 783
58 Ga0068851_10130301 3300005834 Bacteria 1359
59 Ga0068863_100286691 3300005841 Bacteria 1596
60 Ga0068863_102461233 3300005841 Bacteria 530
61 Ga0068860_100000800 3300005843 Bacteria 35309
62 Ga0068860_100911792 3300005843 Bacteria 895
63 Ga0081455_10189402 3300005937 Bacteria 1550
64 Ga0081455_10580814 3300005937 Bacteria 734
65 Ga0070716_100107013 3300006173 Bacteria 1726
66 Ga0097621_100012846 3300006237 Bacteria 6221
67 Ga0068871_100053637 3300006358 Bacteria 3269
68 Ga0068871_100367646 3300006358 Bacteria 1275
69 Ga0075431_100613233 3300006847 Bacteria 1071
70 Ga0075433_10176399 3300006852 Bacteria 1902
71 Ga0075433_10190945 3300006852 Bacteria 1822
72 Ga0075433_11193219 3300006852 Bacteria 661
73 Ga0075433_11422048 3300006852 Bacteria 600
74 Ga0075434_100189289 3300006871 Bacteria 2078
75 Ga0075434_100192427 3300006871 Bacteria 2060
76 Ga0075434_100472784 3300006871 Bacteria 1275
77 Ga0075434_100827418 3300006871 Bacteria 942
78 Ga0075429_100502942 3300006880 Bacteria 1062
79 Ga0068865_100052410 3300006881 Bacteria 2828
80 Ga0068865_101485817 3300006881 Bacteria 607
81 Ga0075436_100250870 3300006914 Bacteria 1260
82 Ga0075436_100601938 3300006914 Bacteria 810
83 Ga0097620_101147870 3300006931 Bacteria 855
84 Ga0105251_10000785 3300009011 Bacteria 28819
85 Ga0105240_10036649 3300009093 Bacteria 6307
86 Ga0105240_10131308 3300009093 Bacteria 3004
87 Ga0105240_11027817 3300009093 Bacteria 880
88 Ga0111539_10002385 3300009094 Bacteria 24945
89 Ga0111539_10518048 3300009094 Bacteria 1389
90 Ga0111539_10534734 3300009094 Bacteria 1365
91 Ga0105245_10626389 3300009098 Bacteria 1104
92 Ga0105247_10521766 3300009101 Bacteria 869
93 Ga0114129_10244528 3300009147 Bacteria 2411
94 Ga0114129_11058244 3300009147 Bacteria 1018
95 Ga0105241_10505195 3300009174 Bacteria 1079
96 Ga0105242_11239469 3300009176 Bacteria 767
97 Ga0105242_11542051 3300009176 Bacteria 696
98 Ga0105242_11734902 3300009176 Bacteria 661
99 Ga0105248_11878745 3300009177 Bacteria 679
100 Ga0105248_13049015 3300009177 Bacteria 533
101 Ga0105238_10358144 3300009551 Bacteria 1448
102 Ga0105239_13123415 3300010375 Bacteria 539
103 Ga0105246_11082249 3300011119 Bacteria 731
104 Ga0157320_1028848 3300012481 Bacteria 549
105 Ga0157337_1002025 3300012483 Bacteria 1112
106 Ga0157371_10268947 3300013102 Bacteria 1230
107 Ga0157370_11294938 3300013104 Bacteria 657
108 Ga0157369_10135862 3300013105 Bacteria 2604
109 Ga0157374_10125272 3300013296 Bacteria 2483
110 Ga0157374_10147157 3300013296 Bacteria 2288
111 Ga0157374_10276522 3300013296 Bacteria 1657
112 Ga0157378_10112684 3300013297 Bacteria 2496
113 Ga0157378_10676142 3300013297 Bacteria 1050
114 Ga0157378_12553771 3300013297 Bacteria 563
115 Ga0163162_10231257 3300013306 Bacteria 1979
116 Ga0163162_11416174 3300013306 Bacteria 791
117 Ga0163162_12646667 3300013306 Bacteria 577
118 Ga0157372_10758399 3300013307 Bacteria 1128
119 Ga0157375_10003832 3300013308 Bacteria 13044
120 Ga0157375_13347343 3300013308 Bacteria 534
121 Ga0163163_10090857 3300014325 Bacteria 3067
122 Ga0163163_10485898 3300014325 Bacteria 1296
123 Ga0157380_10120681 3300014326 Unclassified 2220
124 Ga0157380_10130155 3300014326 Bacteria 2145
125 Ga0157380_10171730 3300014326 Bacteria 1895
126 Ga0157379_10212334 3300014968 Bacteria 1752
127 Ga0157376_10567436 3300014969 Bacteria 1125
128 Ga0163161_10162909 3300017792 Bacteria 1701
129 Ga0207426_1000982 3300025302 Bacteria 28021
130 Ga0207697_10010532 3300025315 Bacteria 3949
131 Ga0207713_1004823 3300025735 Bacteria 8656
132 Ga0207710_10506215 3300025900 Bacteria 627
133 Ga0207680_10130091 3300025903 Bacteria 1658
134 Ga0207685_10072954 3300025905 Bacteria 1397
135 Ga0207699_10098438 3300025906 Bacteria 1850
136 Ga0207699_11188524 3300025906 Bacteria 565
137 Ga0207645_10061704 3300025907 Bacteria 2395
138 Ga0207705_10513038 3300025909 Bacteria 931
139 Ga0207695_11417186 3300025913 Archaea 575
140 Ga0207693_10917151 3300025915 Bacteria 672
141 Ga0207657_10213507 3300025919 Bacteria 1548
142 Ga0207649_10100566 3300025920 Bacteria 1913
143 Ga0207649_10921461 3300025920 Bacteria 686
144 Ga0207681_10779318 3300025923 Bacteria 798
145 Ga0207681_11140628 3300025923 Bacteria 655
146 Ga0207694_10220059 3300025924 Bacteria 1548
147 Ga0207650_10022733 3300025925 Bacteria 4442
148 Ga0207650_10150589 3300025925 Bacteria 1836
149 Ga0207659_10057294 3300025926 Bacteria 2793
150 Ga0207659_11560319 3300025926 Bacteria 564
151 Ga0207644_10144454 3300025931 Bacteria 1835
152 Ga0207644_10187655 3300025931 Bacteria 1624
153 Ga0207644_10729829 3300025931 Bacteria 827
154 Ga0207706_10051436 3300025933 Bacteria 3638
155 Ga0207706_10909260 3300025933 Bacteria 743
156 Ga0207706_11102022 3300025933 Bacteria 663
157 Ga0207669_10030552 3300025937 Bacteria 2995
158 Ga0207669_10859740 3300025937 Unclassified 755
159 Ga0207665_10090988 3300025939 Bacteria 2115
160 Ga0207691_10000340 3300025940 Bacteria 46954
161 Ga0207691_11294134 3300025940 Bacteria 602
162 Ga0207661_11228596 3300025944 Unclassified 689
163 Ga0207679_10004827 3300025945 Bacteria 8405
164 Ga0207679_10374355 3300025945 Bacteria 1247
165 Ga0207651_10006540 3300025960 Bacteria 6115
166 Ga0207651_10166325 3300025960 Bacteria 1734
167 Ga0207668_10147709 3300025972 Bacteria 1816
168 Ga0207668_11003638 3300025972 Bacteria 746
169 Ga0207658_10136338 3300025986 Bacteria 1980
170 Ga0207639_11226120 3300026041 Bacteria 704
171 Ga0207708_10594130 3300026075 Bacteria 937
172 Ga0207676_10200810 3300026095 Bacteria 1762
173 Ga0207675_100158400 3300026118 Bacteria 2158
174 Ga0207683_10000928 3300026121 Bacteria 26962
175 Ga0207683_10433976 3300026121 Bacteria 1210
176 Ga0207683_10478069 3300026121 Bacteria 1150
177 Ga0207698_10383666 3300026142 Bacteria 1338
178 Ga0207428_10002451 3300027907 Bacteria 18533
179 Ga0268266_10258832 3300028379 Bacteria 1612
180 Ga0268266_10651902 3300028379 Bacteria 1013
181 Ga0307408_100418327 3300031548 Bacteria 1155
182 Ga0307408_101394807 3300031548 Bacteria 659
183 Ga0307405_10860049 3300031731 Bacteria 764
184 Ga0307413_10277304 3300031824 Bacteria 1259
185 Ga0307410_10058717 3300031852 Bacteria 2624
186 Ga0307406_10139806 3300031901 Bacteria 1712
187 Ga0307407_10042502 3300031903 Bacteria 2549
188 Ga0307412_10053516 3300031911 Bacteria 2676
189 Ga0307412_10226065 3300031911 Bacteria 1438
190 Ga0307416_100013397 3300032002 Bacteria 5572
191 Ga0307416_100020823 3300032002 Bacteria 4691
192 Ga0307416_100074170 3300032002 Bacteria 2841
193 Ga0307416_100291437 3300032002 Bacteria 1616
194 Ga0307416_100333615 3300032002 Bacteria 1525
195 Ga0307416_100936671 3300032002 Bacteria 968
196 Ga0307414_10527491 3300032004 Bacteria 1049
197 Ga0307411_10050655 3300032005 Bacteria 2705
198 Ga0307411_10101042 3300032005 Bacteria 2040
199 Ga0307411_10245288 3300032005 Bacteria 1405
200 Ga0307415_100162330 3300032126 Bacteria 1733
201 Ga0307415_100563742 3300032126 Bacteria 1007
202 Ga0373954_0064202 3300035118 Bacteria 1736
203 Ga0373942_0033363 3300035207 Bacteria 1372
204 Ga0373961_0439510 3300035241 Bacteria 507
205 Ga0373935_0730958 3300035692 Bacteria 729
206 Ga0373927_0328036 3300035695 Bacteria 1008
207 Ga0373933_0318256 3300035724 Bacteria 1009
208 Ga0373937_0240142 3300036401 Bacteria 1707
209 Ga0373937_0634081 3300036401 Bacteria 1014
210 Ga0373937_1386503 3300036401 Bacteria 651
211 Ga0372808_000526 3300036459 Bacteria 3108
212 Ga0373925_0483996 3300037068 Bacteria 1015
213 Ga0395900_0028715 3300037418 Bacteria 5702
214 Ga0395900_0665280 3300037418 Bacteria 977
215 Ga0395905_0000460 3300037471 Bacteria 56900
216 Ga0436364_0584684 3300037853 Bacteria 5807
217 Ga0395901_0321439 3300038443 Bacteria 1601
218 Ga0436363_0786048 3300039450 Bacteria 1326
219 Ga0450899_011208 3300042135 Bacteria 999
220 Ga0466965_0077922 3300044683 Bacteria 1674
221 Ga0466966_0056777 3300044684 Bacteria 2476
222 Ga0466961_0021108 3300044693 Bacteria 4192
223 Ga0453684_0934999 3300044712 Bacteria 926
224 Ga0466970_0234928 3300044765 Bacteria 1025
225 Ga0466957_0025485 3300044842 Bacteria 3506
226 Ga0466957_0789379 3300044842 Bacteria 674
227 Ga0466960_0005392 3300044901 Bacteria 5065
228 Ga0466958_0994835 3300045836 Bacteria 547
229 Ga0466967_0103856 3300045976 Bacteria 2601
230 Ga0495592_0575707 3300046454 Bacteria 689
231 Ga0495590_0001920 3300046457 Bacteria 8802
232 Ga0495629_0097624 3300046459 Bacteria 2049
233 Ga0495651_0827924 3300046462 Bacteria 570
234 Ga0495653_0002714 3300046463 Bacteria 14102
235 Ga0495580_0175027 3300046472 Bacteria 1483
236 Ga0495580_0611528 3300046472 Bacteria 719
237 Ga0495639_0515815 3300046475 Bacteria 611
238 Ga0495664_0930464 3300046477 Bacteria 508
239 Ga0495584_0196818 3300046491 Bacteria 1024
240 Ga0495596_0018730 3300046500 Bacteria 2852
241 Ga0495606_0040784 3300046507 Bacteria 3118
242 Ga0495608_0869931 3300046511 Bacteria 529
243 Ga0495628_0050255 3300046516 Bacteria 3298
244 Ga0495630_0006517 3300046517 Bacteria 8313
245 Ga0495644_0152552 3300046523 Bacteria 884
246 Ga0495652_0013165 3300046529 Bacteria 7448
247 Ga0495652_1065357 3300046529 Unclassified 526
248 Ga0495665_0003904 3300046531 Bacteria 8067
249 Ga0495586_0759199 3300046535 Bacteria 560
250 Ga0495609_0143327 3300046538 Bacteria 1019
251 Ga0495597_0001163 3300046542 Bacteria 19763
252 Ga0495645_0055241 3300046543 Bacteria 2883
253 Ga0495659_0016144 3300046664 Bacteria 2461
254 Ga0495661_0579035 3300046665 Bacteria 529
255 Ga0495623_0000735 3300046679 Bacteria 21966
256 Ga0495623_0072963 3300046679 Bacteria 2134
257 Ga0495646_0229297 3300046680 Bacteria 1002
258 Ga0495646_0235038 3300046680 Bacteria 986
259 Ga0495646_0360737 3300046680 Bacteria 760
260 Ga0495624_0002662 3300046690 Bacteria 13468
261 Ga0495670_0552258 3300046691 Unclassified 627
262 Ga0495649_0026102 3300046694 Bacteria 3252
263 Ga0495649_0269219 3300046694 Bacteria 872
264 Ga0495600_0097513 3300046809 Bacteria 1916
265 Ga0495660_0136038 3300046810 Bacteria 1228
266 Ga0495604_0001690 3300047317 Bacteria 18145
267 Ga0495636_0063785 3300047318 Bacteria 1562
268 Ga0495674_0010073 3300047319 Bacteria 8960
269 Ga0495674_0127847 3300047319 Bacteria 2142
270 Ga0495674_0136156 3300047319 Bacteria 2066
271 Ga0495674_0809449 3300047319 Bacteria 728
272 Ga0495672_0023796 3300047320 Bacteria 3957
273 Ga0495672_0282309 3300047320 Bacteria 793
274 Ga0495680_0019402 3300047322 Bacteria 5739
275 Ga0495683_0002608 3300047323 Bacteria 10820
276 Ga0495683_0034755 3300047323 Bacteria 2563
277 Ga0495687_000021 3300047443 Bacteria 334681
278 Ga0495687_085626 3300047443 Bacteria 1221
279 Ga0495675_0158288 3300047444 Bacteria 1396
280 Ga0495673_0248495 3300047469 Bacteria 650
281 Ga0495686_0000248 3300047472 Bacteria 97017
282 Ga0495686_0041291 3300047472 Bacteria 2937
283 Ga0495593_0014764 3300047673 Bacteria 4438
284 Ga0495602_0050495 3300048088 Bacteria 3715
285 Ga0495626_0138420 3300048091 Bacteria 1034
286 Ga0496100_0004635 3300048903 Bacteria 7314
287 Ga0496100_0065252 3300048903 Bacteria 2411
288 Ga0496100_0161608 3300048903 Bacteria 1606
289 Ga0496100_0192033 3300048903 Bacteria 1483
290 Ga0496101_0020392 3300048904 Bacteria 4536
291 Ga0496101_0024687 3300048904 Bacteria 4163
292 Ga0496101_0691735 3300048904 Bacteria 805
293 Ga0496102_0044413 3300048905 Bacteria 4032
294 Ga0496102_0191634 3300048905 Bacteria 1927
295 Ga0496102_0399350 3300048905 Bacteria 1292
296 Ga0496103_0003494 3300048906 Bacteria 9613
297 Ga0496103_0273733 3300048906 Bacteria 1086
298 Ga0496104_0004617 3300048907 Bacteria 12004
299 Ga0496104_0098972 3300048907 Bacteria 2792
300 Ga0496104_0392410 3300048907 Bacteria 1300
301 Ga0496104_0608660 3300048907 Bacteria 1003
302 Ga0496104_0627099 3300048907 Bacteria 984
303 Ga0496105_0013253 3300048908 Bacteria 6542
304 Ga0496105_0054165 3300048908 Bacteria 3312
305 Ga0496105_0329013 3300048908 Bacteria 1223
306 Ga0496105_0925684 3300048908 Bacteria 656
307 Ga0496106_0036469 3300048909 Bacteria 3678
308 Ga0496106_0130025 3300048909 Bacteria 1974
309 Ga0496106_0155945 3300048909 Bacteria 1803
310 Ga0496106_0492252 3300048909 Bacteria 985
311 Ga0496107_0002435 3300048910 Bacteria 12061
312 Ga0496107_0111154 3300048910 Bacteria 2014
313 Ga0496107_0145325 3300048910 Bacteria 1754
314 Ga0496108_0001702 3300048911 Bacteria 17444
315 Ga0496108_0566033 3300048911 Bacteria 991
316 Ga0496109_0001320 3300048912 Bacteria 20440
317 Ga0496109_1217646 3300048912 Bacteria 689
318 Ga0496110_0002591 3300048913 Bacteria 13603
319 Ga0496110_0040263 3300048913 Bacteria 4072
320 Ga0496110_0122394 3300048913 Bacteria 2345
321 Ga0496111_0011390 3300048914 Bacteria 5988
322 Ga0496111_0018186 3300048914 Bacteria 4866
323 Ga0496111_0444125 3300048914 Bacteria 957
324 Ga0496112_0014097 3300048915 Bacteria 7401
325 Ga0496112_0070504 3300048915 Bacteria 3455
326 Ga0496112_0120501 3300048915 Bacteria 2593
327 Ga0496112_0296974 3300048915 Bacteria 1561
328 Ga0496112_1295535 3300048915 Bacteria 644
329 Ga0496113_0008627 3300048916 Bacteria 6648
330 Ga0496113_0013065 3300048916 Bacteria 5607
331 Ga0496113_0604397 3300048916 Bacteria 878
332 Ga0496113_0722384 3300048916 Bacteria 794
333 Ga0496114_0080353 3300048917 Bacteria 2753
334 Ga0496115_0049898 3300048918 Bacteria 3351
335 Ga0496115_0108853 3300048918 Bacteria 2275
336 Ga0496115_0679524 3300048918 Bacteria 811
337 Ga0496116_0012897 3300048919 Bacteria 6785
338 Ga0496117_0018716 3300048920 Bacteria 5721
339 Ga0496118_0042852 3300048921 Bacteria 3565
340 Ga0496121_0003313 3300048924 Bacteria 23134
341 Ga0496122_0034215 3300048925 Bacteria 4162
342 Ga0496123_0069143 3300048926 Bacteria 2219
343 Ga0496124_0047043 3300048927 Bacteria 3692
344 Ga0496124_0106816 3300048927 Bacteria 2259
345 Ga0496124_0933563 3300048927 Unclassified 523
346 Ga0496125_0042861 3300048928 Bacteria 3848
347 Ga0496125_0253999 3300048928 Bacteria 1107
348 Ga0496126_0068755 3300048929 Bacteria 3161
349 Ga0501031_0092363 3300049568 Bacteria 1975
350 Ga0501036_0758205 3300049572 Bacteria 800
351 Ga0501038_0880950 3300049574 Bacteria 662
352 Ga0501039_0900079 3300049575 Bacteria 689
353 Ga0501040_0358237 3300049576 Bacteria 1045
354 Ga0501040_0442743 3300049576 Bacteria 935
355 Ga0501041_0721437 3300049577 Bacteria 638
356 Ga0501048_0179619 3300049582 Bacteria 1500
357 Ga0501069_0559454 3300049585 Bacteria 685
358 Ga0501070_0345540 3300049586 Bacteria 1208
359 Ga0501071_0163000 3300049587 Bacteria 1667
360 Ga0501071_0552285 3300049587 Bacteria 885
361 Ga0501072_0527271 3300049588 Bacteria 933
362 Ga0501075_0401598 3300049591 Bacteria 1045
363 Ga0501075_1440372 3300049591 Bacteria 521
364 Ga0501076_0038115 3300049592 Bacteria 3773
365 Ga0501077_0030008 3300049593 Bacteria 3459
366 Ga0501077_0513392 3300049593 Bacteria 768
367 Ga0501257_138324 3300049686 Bacteria 663
368 Ga0501079_0189643 3300049741 Bacteria 1604
369 Ga0501079_0666595 3300049741 Bacteria 819
370 Ga0501081_0237960 3300049743 Bacteria 1327
371 Ga0501081_1568430 3300049743 Bacteria 500
372 Ga0501271_055349 3300049768 Bacteria 546
373 Ga0501273_023917 3300049770 Bacteria 841
374 Ga0501035_0094335 3300049822 Bacteria 2632
375 Ga0501226_009250 3300049853 Bacteria 1098
376 nmdc:mga05p37_1082407_c1 3300050507 Bacteria 842
377 nmdc:mga05p37_376228_c1 3300050507 Bacteria 1665
378 nmdc:mga09592_732573_c1 3300050508 Bacteria 840
379 nmdc:mga06r32_820536_c1 3300050510 Bacteria 890
380 nmdc:mga08y16_2441_c1 3300050511 Bacteria 19097
381 nmdc:mga08y16_433179_c1 3300050511 Bacteria 1343
382 nmdc:mga08y16_90986_c1 3300050511 Bacteria 3180
383 nmdc:mga0n895_339515_c1 3300050512 Bacteria 1521
384 nmdc:mga0n895_519782_c1 3300050512 Bacteria 1198
385 nmdc:mga08x19_1078396_c1 3300050514 Bacteria 570
386 nmdc:mga0a205_1407380_c1 3300050515 Bacteria 545
387 nmdc:mga0a205_191150_c1 3300050515 Bacteria 1939
388 nmdc:mga0a205_263804_c1 3300050515 Bacteria 1600
389 Ga0500622_0000802 3300053156 Bacteria 27018
390 Ga0500622_0002172 3300053156 Bacteria 14534
391 Ga0501084_0020097 3300054114 Bacteria 5569
392 Ga0501084_0695748 3300054114 Bacteria 857
393 Ga0530510_0649377 3300061734 Bacteria 803
394 Ga0530510_1122622 3300061734 Bacteria 602
395 3006328337 3006321560 Bacteria 8247479
396 Ga0395905_0276474
397 JGI24749J21850_1072059
398 Ga0065704_10678315
399 Ga0065707_10117266
400 Ga0065707_10401676
401 Ga0070658_10331018
402 Ga0070658_10345657
403 Ga0070676_10163224
404 Ga0070683_100958234
405 Ga0070690_100101442
406 Ga0070670_100072631
407 Ga0070670_100132163
408 Ga0070670_100169877
409 Ga0070677_10107874
410 Ga0070666_10879362
411 Ga0068868_100973635
412 Ga0070660_100105910
413 Ga0070660_101281823
414 Ga0070689_100329343
415 Ga0070661_100055172
416 Ga0070661_101354440
417 Ga0070661_101499282
418 Ga0070668_100216814
419 Ga0070668_100521475
420 Ga0070669_101240881
421 Ga0070675_100018083
422 Ga0070671_100096150
423 Ga0070674_100232599
424 Ga0070673_100037590
425 Ga0070673_100117388
426 Ga0070688_100055986
427 Ga0070659_100288219
428 Ga0070667_100559869
429 Ga0070713_101230058
430 Ga0070705_100254077
431 Ga0070700_100744122
432 Ga0070694_100035704
433 Ga0070694_100869097
434 Ga0070694_101554115
435 Ga0070708_100092117
436 Ga0070678_100347298
437 Ga0070678_101124065
438 Ga0070662_100121064
439 Ga0068867_100156754
440 Ga0068867_100249535
441 Ga0068867_101682002
442 Ga0070697_100263851
443 Ga0070697_101256901
444 Ga0070672_100007842
445 Ga0070672_101599296
446 Ga0070696_100804372
447 Ga0070665_100053360
448 Ga0070704_101578282
449 Ga0070664_100035595
450 Ga0070664_100440460
451 Ga0068859_101147755
452 Ga0068864_101122390
453 Ga0068851_10130301
454 Ga0068863_100286691
455 Ga0068863_102461233
456 Ga0068860_100000800
457 Ga0068860_100911792
458 Ga0081455_10189402
459 Ga0081455_10580814
460 Ga0070716_100107013
461 Ga0097621_100012846
462 Ga0068871_100053637
463 Ga0068871_100367646
464 Ga0075431_100613233
465 Ga0075433_10176399
466 Ga0075433_10190945
467 Ga0075433_11193219
468 Ga0075433_11422048
469 Ga0075434_100189289
470 Ga0075434_100192427
471 Ga0075434_100472784
472 Ga0075434_100827418
473 Ga0075429_100502942
474 Ga0068865_100052410
475 Ga0068865_101485817
476 Ga0075436_100250870
477 Ga0075436_100601938
478 Ga0097620_101147870
479 Ga0105251_10000785
480 Ga0105240_10036649
481 Ga0105240_10131308
482 Ga0105240_11027817
483 Ga0111539_10002385
484 Ga0111539_10518048
485 Ga0111539_10534734
486 Ga0105245_10626389
487 Ga0105247_10521766
488 Ga0114129_10244528
489 Ga0114129_11058244
490 Ga0105241_10505195
491 Ga0105242_11239469
492 Ga0105242_11542051
493 Ga0105242_11734902
494 Ga0105248_11878745
495 Ga0105248_13049015
496 Ga0105238_10358144
497 Ga0105239_13123415
498 Ga0105246_11082249
499 Ga0157320_1028848
500 Ga0157337_1002025
501 Ga0157371_10268947
502 Ga0157370_11294938
503 Ga0157369_10135862
504 Ga0157374_10125272
505 Ga0157374_10147157
506 Ga0157374_10276522
507 Ga0157378_10112684
508 Ga0157378_10676142
509 Ga0157378_12553771
510 Ga0163162_10231257
511 Ga0163162_11416174
512 Ga0163162_12646667
513 Ga0157372_10758399
514 Ga0157375_10003832
515 Ga0157375_13347343
516 Ga0163163_10090857
517 Ga0163163_10485898
518 Ga0157380_10120681
519 Ga0157380_10130155
520 Ga0157380_10171730
521 Ga0157379_10212334
522 Ga0157376_10567436
523 Ga0163161_10162909
524 Ga0207426_1000982
525 Ga0207697_10010532
526 Ga0207713_1004823
527 Ga0207710_10506215
528 Ga0207680_10130091
529 Ga0207685_10072954
530 Ga0207699_10098438
531 Ga0207699_11188524
532 Ga0207645_10061704
533 Ga0207705_10513038
534 Ga0207695_11417186
535 Ga0207693_10917151
536 Ga0207657_10213507
537 Ga0207649_10100566
538 Ga0207649_10921461
539 Ga0207681_10779318
540 Ga0207681_11140628
541 Ga0207694_10220059
542 Ga0207650_10022733
543 Ga0207650_10150589
544 Ga0207659_10057294
545 Ga0207659_11560319
546 Ga0207644_10144454
547 Ga0207644_10187655
548 Ga0207644_10729829
549 Ga0207706_10051436
550 Ga0207706_10909260
551 Ga0207706_11102022
552 Ga0207669_10030552
553 Ga0207669_10859740
554 Ga0207665_10090988
555 Ga0207691_10000340
556 Ga0207691_11294134
557 Ga0207661_11228596
558 Ga0207679_10004827
559 Ga0207679_10374355
560 Ga0207651_10006540
561 Ga0207651_10166325
562 Ga0207668_10147709
563 Ga0207668_11003638
564 Ga0207658_10136338
565 Ga0207639_11226120
566 Ga0207708_10594130
567 Ga0207676_10200810
568 Ga0207675_100158400
569 Ga0207683_10000928
570 Ga0207683_10433976
571 Ga0207683_10478069
572 Ga0207698_10383666
573 Ga0207428_10002451
574 Ga0268266_10258832
575 Ga0268266_10651902
576 Ga0307408_100418327
577 Ga0307408_101394807
578 Ga0307405_10860049
579 Ga0307413_10277304
580 Ga0307410_10058717
581 Ga0307406_10139806
582 Ga0307407_10042502
583 Ga0307412_10053516
584 Ga0307412_10226065
585 Ga0307416_100013397
586 Ga0307416_100020823
587 Ga0307416_100074170
588 Ga0307416_100291437
589 Ga0307416_100333615
590 Ga0307416_100936671
591 Ga0307414_10527491
592 Ga0307411_10050655
593 Ga0307411_10101042
594 Ga0307411_10245288
595 Ga0307415_100162330
596 Ga0307415_100563742
597 Ga0373954_0064202
598 Ga0373942_0033363
599 Ga0373961_0439510
600 Ga0373935_0730958
601 Ga0373927_0328036
602 Ga0373933_0318256
603 Ga0373937_0240142
604 Ga0373937_0634081
605 Ga0373937_1386503
606 Ga0372808_000526
607 Ga0373925_0483996
608 Ga0395900_0028715
609 Ga0395900_0665280
610 Ga0395905_0000460
611 Ga0436364_0584684
612 Ga0395901_0321439
613 Ga0436363_0786048
614 Ga0450899_011208
615 Ga0466965_0077922
616 Ga0466966_0056777
617 Ga0466961_0021108
618 Ga0453684_0934999
619 Ga0466970_0234928
620 Ga0466957_0025485
621 Ga0466957_0789379
622 Ga0466960_0005392
623 Ga0466958_0994835
624 Ga0466967_0103856
625 Ga0495592_0575707
626 Ga0495590_0001920
627 Ga0495629_0097624
628 Ga0495651_0827924
629 Ga0495653_0002714
630 Ga0495580_0175027
631 Ga0495580_0611528
632 Ga0495639_0515815
633 Ga0495664_0930464
634 Ga0495584_0196818
635 Ga0495596_0018730
636 Ga0495606_0040784
637 Ga0495608_0869931
638 Ga0495628_0050255
639 Ga0495630_0006517
640 Ga0495644_0152552
641 Ga0495652_0013165
642 Ga0495652_1065357
643 Ga0495665_0003904
644 Ga0495586_0759199
645 Ga0495609_0143327
646 Ga0495597_0001163
647 Ga0495645_0055241
648 Ga0495659_0016144
649 Ga0495661_0579035
650 Ga0495623_0000735
651 Ga0495623_0072963
652 Ga0495646_0229297
653 Ga0495646_0235038
654 Ga0495646_0360737
655 Ga0495624_0002662
656 Ga0495670_0552258
657 Ga0495649_0026102
658 Ga0495649_0269219
659 Ga0495600_0097513
660 Ga0495660_0136038
661 Ga0495604_0001690
662 Ga0495636_0063785
663 Ga0495674_0010073
664 Ga0495674_0127847
665 Ga0495674_0136156
666 Ga0495674_0809449
667 Ga0495672_0023796
668 Ga0495672_0282309
669 Ga0495680_0019402
670 Ga0495683_0002608
671 Ga0495683_0034755
672 Ga0495687_000021
673 Ga0495687_085626
674 Ga0495675_0158288
675 Ga0495673_0248495
676 Ga0495686_0000248
677 Ga0495686_0041291
678 Ga0495593_0014764
679 Ga0495602_0050495
680 Ga0495626_0138420
681 Ga0496100_0004635
682 Ga0496100_0065252
683 Ga0496100_0161608
684 Ga0496100_0192033
685 Ga0496101_0020392
686 Ga0496101_0024687
687 Ga0496101_0691735
688 Ga0496102_0044413
689 Ga0496102_0191634
690 Ga0496102_0399350
691 Ga0496103_0003494
692 Ga0496103_0273733
693 Ga0496104_0004617
694 Ga0496104_0098972
695 Ga0496104_0392410
696 Ga0496104_0608660
697 Ga0496104_0627099
698 Ga0496105_0013253
699 Ga0496105_0054165
700 Ga0496105_0329013
701 Ga0496105_0925684
702 Ga0496106_0036469
703 Ga0496106_0130025
704 Ga0496106_0155945
705 Ga0496106_0492252
706 Ga0496107_0002435
707 Ga0496107_0111154
708 Ga0496107_0145325
709 Ga0496108_0001702
710 Ga0496108_0566033
711 Ga0496109_0001320
712 Ga0496109_1217646
713 Ga0496110_0002591
714 Ga0496110_0040263
715 Ga0496110_0122394
716 Ga0496111_0011390
717 Ga0496111_0018186
718 Ga0496111_0444125
719 Ga0496112_0014097
720 Ga0496112_0070504
721 Ga0496112_0120501
722 Ga0496112_0296974
723 Ga0496112_1295535
724 Ga0496113_0008627
725 Ga0496113_0013065
726 Ga0496113_0604397
727 Ga0496113_0722384
728 Ga0496114_0080353
729 Ga0496115_0049898
730 Ga0496115_0108853
731 Ga0496115_0679524
732 Ga0496116_0012897
733 Ga0496117_0018716
734 Ga0496118_0042852
735 Ga0496121_0003313
736 Ga0496122_0034215
737 Ga0496123_0069143
738 Ga0496124_0047043
739 Ga0496124_0106816
740 Ga0496124_0933563
741 Ga0496125_0042861
742 Ga0496125_0253999
743 Ga0496126_0068755
744 Ga0501031_0092363
745 Ga0501036_0758205
746 Ga0501038_0880950
747 Ga0501039_0900079
748 Ga0501040_0358237
749 Ga0501040_0442743
750 Ga0501041_0721437
751 Ga0501048_0179619
752 Ga0501069_0559454
753 Ga0501070_0345540
754 Ga0501071_0163000
755 Ga0501071_0552285
756 Ga0501072_0527271
757 Ga0501075_0401598
758 Ga0501075_1440372
759 Ga0501076_0038115
760 Ga0501077_0030008
761 Ga0501077_0513392
762 Ga0501257_138324
763 Ga0501079_0189643
764 Ga0501079_0666595
765 Ga0501081_0237960
766 Ga0501081_1568430
767 Ga0501271_055349
768 Ga0501273_023917
769 Ga0501035_0094335
770 Ga0501226_009250
771 nmdc:mga05p37_1082407_c1
772 nmdc:mga05p37_376228_c1
773 nmdc:mga09592_732573_c1
774 nmdc:mga06r32_820536_c1
775 nmdc:mga08y16_2441_c1
776 nmdc:mga08y16_433179_c1
777 nmdc:mga08y16_90986_c1
778 nmdc:mga0n895_339515_c1
779 nmdc:mga0n895_519782_c1
780 nmdc:mga08x19_1078396_c1
781 nmdc:mga0a205_1407380_c1
782 nmdc:mga0a205_191150_c1
783 nmdc:mga0a205_263804_c1
784 Ga0500622_0000802
785 Ga0500622_0002172
786 Ga0501084_0020097
787 Ga0501084_0695748
788 Ga0530510_0649377
789 Ga0530510_1122622
790 3006328337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

3

109

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ezb-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9113 30 101
2xmo-assembly2.cif.gz_B the crystal structure of lmo2642 0.8951 41 67
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.8765 33 101
4hyl-assembly1.cif.gz_A the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 0.8728 33 100
7v75-assembly1.cif.gz_A thermostabilized human prestin in complex with salicylate 0.8696 30 108
ID Description Score Start End Superfamily
af_G5EDS5_481_631_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.886 31 102 3.30.750.24
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.876 31 102 3.30.750.24
af_P64602_10_96_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8416 32 83 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8226 33 101 3.30.750.24
af_Q10427_16_385_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8133 47 67 3.20.20.80
ID Description Score Start End GO Terms
AF-F3Z4Q0-F1-model_v4 Putative anti-sigma factor antagonist 0.9952 29 103
AF-Q1YEZ4-F1-model_v4 Anti-anti-sigma regulatory factor 0.9927 29 100
AF-A0A6G3VQK4-F1-model_v4 deleted 0.9873 34 100
AF-A0A645JFX1-F1-model_v4 RsbT antagonist protein RsbS 0.9862 32 106
AF-A0A7C0ZRA0-F1-model_v4 STAS domain-containing protein 0.9752 31 108

Map