metagRoot

F433255

General Info

Members	Datasets	Scaffolds	Average Seq Length
395	248	394	106

Family's Representative Sequence

Representative Sequence	3300031852\|Ga0307410_12086969\|Ga0307410_120869691
Length	122
Sequence	MASRIRKGDKVVVIAGAHKGTEGIVTKVLPEFSQVIVEGVNRVKRHQKPTPRLPEGGIIEKDRPIHVSNVALVDPSTGKATRVRFQTDADGKKSRVAAKSGTVIQAAATGNQDAQSNDAGAV

Samples

	Sample ID	Description	Type	Environment
1	2891633521	Azoarcus rhizosphaerae CC-YHH848	Isolate	Rhizosphere
2	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
3	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
4	3300003579	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
5	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
6	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
7	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
8	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
16	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
17	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
18	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
19	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
22	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
23	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
24	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
25	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
26	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
27	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
28	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
29	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
30	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
31	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
32	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
33	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
34	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
35	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
36	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
37	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
38	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
39	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
40	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
41	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
42	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
43	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
44	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
45	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
46	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
47	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
48	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
49	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
50	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
51	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
52	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
53	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
54	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
57	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
58	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
59	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
61	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
62	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
63	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
65	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
66	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
67	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
68	3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Metagenome	Rhizosphere
69	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
70	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
71	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
72	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
73	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
74	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
75	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
76	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
105	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
106	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
107	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
108	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
109	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
110	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
111	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
112	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
113	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
114	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
115	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
116	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
117	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
118	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
119	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
120	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
121	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
122	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
123	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
124	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
125	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
126	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
127	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
128	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
129	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
130	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
131	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
132	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
133	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
134	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
135	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
136	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
137	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
138	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
139	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
140	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
141	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
142	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
143	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
144	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
145	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
146	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
147	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
148	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
149	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
150	3300041446	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT	Metatranscriptome	Rhizoplane
151	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
152	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
153	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
154	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
155	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
156	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
157	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
158	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
159	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
160	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
161	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
162	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
163	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
164	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
165	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
166	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
167	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
168	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
169	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
170	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
171	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
172	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
173	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
174	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
175	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
176	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
177	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
178	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
179	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
180	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
181	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
182	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
183	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
184	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
185	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
186	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
187	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
188	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
189	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
190	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
191	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
192	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
194	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
195	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
204	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
205	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
206	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
207	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
208	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
209	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
210	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
213	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
215	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
217	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
221	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
222	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
223	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
224	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
225	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
226	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
227	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
228	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
229	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
230	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
231	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
232	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
233	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
234	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
235	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
236	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
237	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
238	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
239	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
240	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
241	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
242	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
243	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
244	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
245	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
246	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
247	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
248	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.46
Metatranscriptomes	3.29
Isolates	0.25

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.87
Nodule	0
Rhizoplane	0.51
Rhizosphere	88.61
Stem	0
Stem Tuber	0
Unclassified	1.01

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24750J21931_1061390	3300002070	Bacteria	601
2	JGI25406J46586_10029995	3300003203	Bacteria	2051
3	Ga0007429J51699_1073170	3300003579	Bacteria	780
4	Ga0058861_12040642	3300004800	Bacteria	2087
5	Ga0065712_10718877	3300005290	Bacteria	540
6	Ga0065707_10013046	3300005295	Bacteria	2002
7	Ga0065707_10307588	3300005295	Bacteria	991
8	Ga0070658_10061874	3300005327	Bacteria	3050
9	Ga0070683_100301870	3300005329	Bacteria	1523
10	Ga0070683_101420950	3300005329	Bacteria	667
11	Ga0070690_100074696	3300005330	Bacteria	2208
12	Ga0070670_101817643	3300005331	Bacteria	561
13	Ga0068869_101555158	3300005334	Bacteria	588
14	Ga0070680_100061453	3300005336	Bacteria	3075
15	Ga0070687_100883528	3300005343	Bacteria	640
16	Ga0070661_100068083	3300005344	Bacteria	2617
17	Ga0070692_10093904	3300005345	Bacteria	1634
18	Ga0070692_10924481	3300005345	Bacteria	605
19	Ga0070688_100161923	3300005365	Bacteria	1538
20	Ga0070703_10038629	3300005406	Bacteria	1476
21	Ga0070714_100047656	3300005435	Bacteria	3641
22	Ga0070713_100193708	3300005436	Bacteria	1833
23	Ga0070701_11349184	3300005438	Bacteria	511
24	Ga0070700_100891384	3300005441	Bacteria	724
25	Ga0070694_100123201	3300005444	Bacteria	1863
26	Ga0070694_100705645	3300005444	Bacteria	821
27	Ga0070694_100739581	3300005444	Bacteria	802
28	Ga0070707_100238841	3300005468	Bacteria	1769
29	Ga0070698_101056049	3300005471	Bacteria	760
30	Ga0070699_100895387	3300005518	Bacteria	813
31	Ga0070679_100738041	3300005530	Bacteria	927
32	Ga0070684_100070941	3300005535	Bacteria	3066
33	Ga0070686_100061505	3300005544	Bacteria	2427
34	Ga0070686_101421483	3300005544	Bacteria	583
35	Ga0070695_100908358	3300005545	Bacteria	711
36	Ga0070695_100952782	3300005545	Bacteria	696
37	Ga0070696_101825259	3300005546	Bacteria	526
38	Ga0070693_100661732	3300005547	Bacteria	761
39	Ga0070704_100644738	3300005549	Bacteria	935
40	Ga0068855_100138919	3300005563	Bacteria	2771
41	Ga0068855_101081352	3300005563	Bacteria	839
42	Ga0068856_101142826	3300005614	Bacteria	796
43	Ga0070702_100503811	3300005615	Bacteria	890
44	Ga0068852_100739196	3300005616	Bacteria	996
45	Ga0068859_100021700	3300005617	Bacteria	6443
46	Ga0068864_100076229	3300005618	Bacteria	2929
47	Ga0068863_100258996	3300005841	Bacteria	1681
48	Ga0068862_102717501	3300005844	Bacteria	507
49	Ga0081539_10010390	3300005985	Bacteria	7569
50	Ga0081539_10161149	3300005985	Bacteria	1069
51	Ga0070717_10361170	3300006028	Bacteria	1300
52	Ga0075365_10208530	3300006038	Bacteria	1370
53	Ga0075368_10003054	3300006042	Bacteria	5542
54	Ga0075363_100000856	3300006048	Bacteria	10631
55	Ga0075364_10015296	3300006051	Bacteria	4757
56	Ga0070712_100691409	3300006175	Bacteria	869
57	Ga0070712_101354128	3300006175	Bacteria	621
58	Ga0075362_10001667	3300006177	Bacteria	7203
59	Ga0075362_10039756	3300006177	Bacteria	2069
60	Ga0075362_10223011	3300006177	Bacteria	922
61	Ga0075367_10001881	3300006178	Bacteria	9288
62	Ga0075369_10003827	3300006186	Bacteria	5518
63	Ga0075366_10029562	3300006195	Bacteria	3219
64	Ga0075366_10072831	3300006195	Bacteria	2048
65	Ga0075366_10394105	3300006195	Bacteria	852
66	Ga0075366_10447849	3300006195	Bacteria	797
67	Ga0075370_10017546	3300006353	Bacteria	3869
68	Ga0075370_10393044	3300006353	Bacteria	831
69	Ga0075370_10583153	3300006353	Bacteria	677
70	Ga0075430_100018107	3300006846	Bacteria	5994
71	Ga0075430_100884368	3300006846	Bacteria	736
72	Ga0075431_100171524	3300006847	Bacteria	2229
73	Ga0075431_100657040	3300006847	Bacteria	1028
74	Ga0075433_10079601	3300006852	Bacteria	2887
75	Ga0075433_10660317	3300006852	Bacteria	917
76	Ga0075434_100208963	3300006871	Bacteria	1972
77	Ga0075436_100069889	3300006914	Bacteria	2426
78	Ga0075436_100465695	3300006914	Bacteria	922
79	Ga0097620_100021700	3300006931	Bacteria	6443
80	Ga0075435_100006049	3300007076	Bacteria	8522
81	Ga0075435_100019527	3300007076	Bacteria	5180
82	Ga0099794_10104294	3300007265	Bacteria	1417
83	Ga0099794_10566299	3300007265	Bacteria	600
84	Ga0105240_10252783	3300009093	Bacteria	2037
85	Ga0111539_10069166	3300009094	Bacteria	4169
86	Ga0105237_10809625	3300009545	Bacteria	944
87	Ga0105238_10087095	3300009551	Bacteria	3110
88	Ga0105239_10215856	3300010375	Bacteria	2151
89	Ga0105246_10632441	3300011119	Bacteria	929
90	Ga0157346_1002281	3300012480	Bacteria	987
91	Ga0157373_11022718	3300013100	Bacteria	617
92	Ga0157370_10090984	3300013104	Bacteria	2865
93	Ga0157369_10229169	3300013105	Bacteria	1943
94	Ga0157378_11085783	3300013297	Bacteria	837
95	Ga0157372_10202803	3300013307	Bacteria	2298
96	Ga0206356_11323055	3300020070	Bacteria	1702
97	Ga0209026_1018764	3300025250	Bacteria	1091
98	Ga0207656_10344335	3300025321	Bacteria	743
99	Ga0207653_10109702	3300025885	Bacteria	984
100	Ga0207684_10221976	3300025910	Bacteria	1631
101	Ga0207707_11021102	3300025912	Bacteria	678
102	Ga0207695_10045231	3300025913	Bacteria	4675
103	Ga0207662_10573849	3300025918	Bacteria	783
104	Ga0207649_10101163	3300025920	Bacteria	1908
105	Ga0207652_11311116	3300025921	Bacteria	627
106	Ga0207646_10205220	3300025922	Bacteria	1780
107	Ga0207694_10007098	3300025924	Bacteria	8511
108	Ga0207650_10152420	3300025925	Bacteria	1825
109	Ga0207664_10192610	3300025929	Bacteria	1756
110	Ga0207664_11032378	3300025929	Bacteria	736
111	Ga0207709_10971527	3300025935	Bacteria	693
112	Ga0207670_10038917	3300025936	Bacteria	3110
113	Ga0207665_10862383	3300025939	Bacteria	717
114	Ga0207691_11712497	3300025940	Bacteria	508
115	Ga0207689_10850412	3300025942	Bacteria	770
116	Ga0207661_10242302	3300025944	Bacteria	1600
117	Ga0207667_10019150	3300025949	Bacteria	7654
118	Ga0207667_10223167	3300025949	Bacteria	1931
119	Ga0207712_11642397	3300025961	Bacteria	576
120	Ga0207708_10479958	3300026075	Bacteria	1039
121	Ga0207702_10140039	3300026078	Bacteria	2188
122	Ga0207641_12486549	3300026088	Bacteria	516
123	Ga0207698_10939980	3300026142	Bacteria	873
124	Ga0209996_1017678	3300027395	Bacteria	986
125	Ga0210000_1023199	3300027462	Bacteria	955
126	Ga0209971_1075735	3300027682	Bacteria	818
127	Ga0209813_10001024	3300027866	Bacteria	6287
128	Ga0207428_10449573	3300027907	Bacteria	939
129	Ga0265319_1275611	3300028563	Bacteria	512
130	Ga0307515_10203755	3300028794	Bacteria	1846
131	Ga0307511_10000653	3300030521	Bacteria	37038
132	Ga0265331_10292709	3300031250	Bacteria	729
133	Ga0265327_10131623	3300031251	Bacteria	1176
134	Ga0316575_10000771	3300031665	Bacteria	9685
135	Ga0316575_10003983	3300031665	Bacteria	5170
136	Ga0316575_10251508	3300031665	Bacteria	741
137	Ga0316579_10000952	3300031691	Bacteria	10118
138	Ga0316578_10701883	3300031728	Unclassified	589
139	Ga0307410_12086969	3300031852	Bacteria	507
140	Ga0307416_101035144	3300032002	Bacteria	925
141	Ga0316583_10002208	3300032133	Bacteria	6709
142	Ga0316583_10007463	3300032133	Bacteria	3936
143	Ga0316583_10008555	3300032133	Bacteria	3690
144	Ga0316583_10068131	3300032133	Bacteria	1245
145	Ga0316585_10143487	3300032137	Unclassified	788
146	Ga0316580_10090579	3300032139	Bacteria	936
147	Ga0316593_10000192	3300032168	Bacteria	9387
148	Ga0316593_10002233	3300032168	Bacteria	4536
149	Ga0316593_10238377	3300032168	Bacteria	678
150	Ga0307507_10032678	3300033179	Bacteria	5425
151	Ga0316586_1026237	3300033527	Bacteria	983
152	Ga0316586_1030302	3300033527	Bacteria	924
153	Ga0316596_1000154	3300033541	Bacteria	9581
154	Ga0316596_1003277	3300033541	Bacteria	3527
155	Ga0373930_0074285	3300034816	Bacteria	777
156	Ga0373948_0077689	3300034817	Bacteria	753
157	Ga0373959_0064232	3300034820	Bacteria	818
158	Ga0373959_0137091	3300034820	Bacteria	610
159	Ga0373938_0060798	3300034957	Bacteria	883
160	Ga0373926_0005302	3300035083	Bacteria	4243
161	Ga0373928_0168036	3300035084	Bacteria	617
162	Ga0373944_0011229	3300035089	Bacteria	2450
163	Ga0373952_0000366	3300035092	Bacteria	7677
164	Ga0373952_0024981	3300035092	Bacteria	1287
165	Ga0373936_0020227	3300035113	Bacteria	2584
166	Ga0373939_0234584	3300035114	Bacteria	708
167	Ga0373939_0250851	3300035114	Bacteria	689
168	Ga0373939_0320046	3300035114	Bacteria	623
169	Ga0373941_0013805	3300035115	Bacteria	2144
170	Ga0373941_0321593	3300035115	Bacteria	622
171	Ga0373954_0294714	3300035118	Bacteria	800
172	Ga0373960_0028386	3300035121	Bacteria	1544
173	Ga0373960_0035512	3300035121	Bacteria	1415
174	Ga0373960_0134525	3300035121	Bacteria	832
175	Ga0373960_0165858	3300035121	Bacteria	763
176	Ga0373943_0036624	3300035170	Bacteria	2350
177	Ga0373943_0954970	3300035170	Bacteria	513
178	Ga0373946_0049130	3300035171	Bacteria	1758
179	Ga0373946_0095412	3300035171	Bacteria	1325
180	Ga0373961_0010397	3300035241	Bacteria	2292
181	Ga0373962_0102169	3300035242	Bacteria	895
182	Ga0316574_0203373	3300035398	Bacteria	1272
183	Ga0316574_0208020	3300035398	Bacteria	1256
184	Ga0373924_0026912	3300035410	Bacteria	2284
185	Ga0373931_0002669	3300035691	Bacteria	7930
186	Ga0373931_0203983	3300035691	Bacteria	1183
187	Ga0373931_1073477	3300035691	Bacteria	547
188	Ga0373935_0034613	3300035692	Bacteria	3149
189	Ga0373935_0255183	3300035692	Bacteria	1228
190	Ga0373927_0036300	3300035695	Bacteria	3205
191	Ga0373947_0136207	3300035725	Bacteria	1571
192	Ga0373937_0065847	3300036401	Bacteria	3336
193	Ga0316582_0002553	3300036647	Bacteria	8612
194	Ga0316582_0004346	3300036647	Bacteria	7138
195	Ga0316582_0008752	3300036647	Bacteria	5453
196	Ga0316584_0006254	3300036712	Bacteria	8068
197	Ga0316584_0167539	3300036712	Bacteria	1631
198	Ga0373925_0007409	3300037068	Bacteria	8006
199	Ga0316581_0001079	3300037588	Bacteria	5893
200	Ga0451794_10550	3300041446	Bacteria	649
201	Ga0439441_003617	3300042001	Bacteria	2290
202	Ga0439441_060985	3300042001	Bacteria	794
203	Ga0439443_000264	3300042003	Bacteria	4196
204	Ga0439451_002659	3300042009	Bacteria	3625
205	Ga0439434_0032682	3300042435	Bacteria	1584
206	Ga0439434_0359885	3300042435	Bacteria	509
207	Ga0439435_0004015	3300042436	Bacteria	3130
208	Ga0439460_0002792	3300042461	Bacteria	4203
209	Ga0439460_0072199	3300042461	Bacteria	1071
210	Ga0451577_0000013	3300042876	Bacteria	550689
211	Ga0451577_0101172	3300042876	Bacteria	2575
212	Ga0451577_0200639	3300042876	Bacteria	1801
213	Ga0451577_0454646	3300042876	Bacteria	1163
214	Ga0453683_0000059	3300044673	Bacteria	187158
215	Ga0453683_0009125	3300044673	Bacteria	6624
216	Ga0453683_0030079	3300044673	Bacteria	3434
217	Ga0453683_0247322	3300044673	Bacteria	1136
218	Ga0453683_0424396	3300044673	Bacteria	858
219	Ga0466963_0283213	3300044694	Bacteria	1165
220	Ga0466964_0020860	3300044706	Bacteria	2527
221	Ga0453684_0000585	3300044712	Bacteria	135647
222	Ga0453684_0000989	3300044712	Bacteria	92793
223	Ga0453684_0020632	3300044712	Bacteria	9917
224	Ga0453684_0098007	3300044712	Bacteria	3596
225	Ga0453684_0205823	3300044712	Bacteria	2290
226	Ga0453684_0674870	3300044712	Bacteria	1125
227	Ga0453684_0780306	3300044712	Bacteria	1032
228	Ga0466957_0152111	3300044842	Bacteria	1497
229	Ga0451576_0000013	3300045051	Bacteria	665120
230	Ga0451576_0000018	3300045051	Bacteria	550689
231	Ga0451576_0184196	3300045051	Bacteria	2180
232	Ga0451576_0235909	3300045051	Bacteria	1910
233	Ga0451576_0239449	3300045051	Bacteria	1895
234	Ga0451576_0405589	3300045051	Bacteria	1429
235	Ga0451576_1489920	3300045051	Bacteria	703
236	Ga0466967_0016890	3300045976	Bacteria	5771
237	Ga0495603_0022916	3300046455	Bacteria	3779
238	Ga0495629_0062948	3300046459	Bacteria	2591
239	Ga0495650_0007879	3300046471	Bacteria	6324
240	Ga0495580_0004729	3300046472	Bacteria	11405
241	Ga0495582_0022900	3300046473	Bacteria	3417
242	Ga0495594_0815542	3300046499	Bacteria	526
243	Ga0495663_0118720	3300046525	Bacteria	884
244	Ga0495666_0042539	3300046526	Bacteria	2196
245	Ga0495666_0045650	3300046526	Bacteria	2113
246	Ga0495665_0067989	3300046531	Bacteria	1879
247	Ga0495586_0012832	3300046535	Bacteria	4441
248	Ga0495586_0051053	3300046535	Bacteria	2238
249	Ga0495598_0329516	3300046537	Bacteria	583
250	Ga0495621_0008009	3300046539	Bacteria	3150
251	Ga0495621_0197696	3300046539	Bacteria	808
252	Ga0495621_0211786	3300046539	Bacteria	782
253	Ga0495588_0023940	3300046674	Bacteria	3029
254	Ga0495657_0372718	3300046675	Bacteria	843
255	Ga0495647_0001629	3300046681	Bacteria	6939
256	Ga0495647_0056319	3300046681	Bacteria	1541
257	Ga0495658_0025293	3300046683	Bacteria	3171
258	Ga0495581_0574986	3300047315	Bacteria	653
259	Ga0495676_0091846	3300047321	Bacteria	2267
260	Ga0495593_0297968	3300047673	Bacteria	806
261	Ga0496108_1724654	3300048911	Bacteria	515
262	Ga0501305_057274	3300049161	Bacteria	665
263	Ga0501292_078776	3300049515	Bacteria	624
264	Ga0501298_194201	3300049521	Bacteria	513
265	Ga0501031_0089009	3300049568	Bacteria	2013
266	Ga0501031_0122019	3300049568	Bacteria	1702
267	Ga0501032_0091873	3300049569	Bacteria	2013
268	Ga0501032_0769578	3300049569	Bacteria	609
269	Ga0501033_0004098	3300049570	Bacteria	11751
270	Ga0501034_0043134	3300049571	Bacteria	4566
271	Ga0501036_0006553	3300049572	Bacteria	9458
272	Ga0501036_0034324	3300049572	Bacteria	4291
273	Ga0501037_0005636	3300049573	Bacteria	9129
274	Ga0501037_0148517	3300049573	Bacteria	1676
275	Ga0501037_0311987	3300049573	Bacteria	1090
276	Ga0501037_0521904	3300049573	Bacteria	804
277	Ga0501037_0978367	3300049573	Bacteria	552
278	Ga0501038_0000891	3300049574	Bacteria	26448
279	Ga0501038_0542607	3300049574	Bacteria	885
280	Ga0501039_0005177	3300049575	Bacteria	9877
281	Ga0501039_0065773	3300049575	Bacteria	2813
282	Ga0501039_0252162	3300049575	Bacteria	1387
283	Ga0501039_0415136	3300049575	Bacteria	1057
284	Ga0501039_0419135	3300049575	Bacteria	1052
285	Ga0501039_0955700	3300049575	Bacteria	666
286	Ga0501040_0003846	3300049576	Bacteria	9734
287	Ga0501040_0067749	3300049576	Bacteria	2460
288	Ga0501040_0170862	3300049576	Bacteria	1539
289	Ga0501041_0000815	3300049577	Bacteria	16702
290	Ga0501041_0003344	3300049577	Bacteria	9229
291	Ga0501041_0022479	3300049577	Bacteria	3776
292	Ga0501041_0344804	3300049577	Bacteria	941
293	Ga0501042_0009869	3300049578	Bacteria	6379
294	Ga0501042_0012358	3300049578	Bacteria	5781
295	Ga0501042_0083145	3300049578	Bacteria	2295
296	Ga0501043_0006848	3300049579	Bacteria	9099
297	Ga0501043_0273161	3300049579	Bacteria	1297
298	Ga0501043_0952010	3300049579	Bacteria	613
299	Ga0501043_1043587	3300049579	Bacteria	580
300	Ga0501046_0004387	3300049580	Bacteria	12824
301	Ga0501047_0447682	3300049581	Bacteria	1121
302	Ga0501048_0005618	3300049582	Bacteria	9536
303	Ga0501048_0049929	3300049582	Bacteria	2980
304	Ga0501069_0030284	3300049585	Bacteria	2972
305	Ga0501070_0021717	3300049586	Bacteria	5382
306	Ga0501071_0005936	3300049587	Bacteria	7901
307	Ga0501071_0058963	3300049587	Bacteria	2776
308	Ga0501071_0114002	3300049587	Bacteria	1999
309	Ga0501071_0209267	3300049587	Bacteria	1466
310	Ga0501071_0545569	3300049587	Bacteria	890
311	Ga0501072_0000447	3300049588	Bacteria	29642
312	Ga0501072_0018930	3300049588	Bacteria	5314
313	Ga0501072_0082224	3300049588	Bacteria	2553
314	Ga0501073_0008056	3300049589	Bacteria	7819
315	Ga0501073_0108715	3300049589	Bacteria	1924
316	Ga0501073_0168115	3300049589	Bacteria	1518
317	Ga0501074_0005165	3300049590	Bacteria	9387
318	Ga0501074_0098233	3300049590	Bacteria	2096
319	Ga0501074_0819335	3300049590	Bacteria	656
320	Ga0501075_0003793	3300049591	Bacteria	10167
321	Ga0501075_0009583	3300049591	Bacteria	6780
322	Ga0501075_0024398	3300049591	Bacteria	4434
323	Ga0501075_0251037	3300049591	Bacteria	1348
324	Ga0501076_0000663	3300049592	Bacteria	22052
325	Ga0501076_0006205	3300049592	Bacteria	8650
326	Ga0501076_0047645	3300049592	Bacteria	3389
327	Ga0501077_0000810	3300049593	Bacteria	18971
328	Ga0501077_0049998	3300049593	Bacteria	2657
329	Ga0501079_0004844	3300049741	Bacteria	9972
330	Ga0501079_0015785	3300049741	Bacteria	5770
331	Ga0501079_0039556	3300049741	Bacteria	3637
332	Ga0501079_0039713	3300049741	Bacteria	3630
333	Ga0501080_0001428	3300049742	Bacteria	20060
334	Ga0501080_0005999	3300049742	Bacteria	10889
335	Ga0501080_0088780	3300049742	Bacteria	2872
336	Ga0501081_0000747	3300049743	Bacteria	19029
337	Ga0501081_0014826	3300049743	Bacteria	5143
338	Ga0501081_0031168	3300049743	Bacteria	3613
339	Ga0501081_0691130	3300049743	Bacteria	766
340	Ga0501083_0159295	3300049744	Bacteria	1477
341	Ga0501279_027112	3300049775	Bacteria	838
342	Ga0501035_0010710	3300049822	Bacteria	8490
343	Ga0501044_0091955	3300049823	Bacteria	3060
344	Ga0501045_0002784	3300049824	Bacteria	11951
345	Ga0501045_0003651	3300049824	Bacteria	10578
346	Ga0501045_0276452	3300049824	Bacteria	1250
347	Ga0501045_1126349	3300049824	Bacteria	574
348	nmdc:mga03683_13626_c1	3300050489	Bacteria	2997
349	nmdc:mga03n38_4317_c1	3300050490	Bacteria	4691
350	nmdc:mga00v17_13392_c1	3300050491	Bacteria	4553
351	nmdc:mga0yw44_1035393_c1	3300050492	Bacteria	555
352	nmdc:mga0yw44_22084_c1	3300050492	Bacteria	3562
353	nmdc:mga0k408_13979_c1	3300050493	Bacteria	4412
354	nmdc:mga0k408_4092_c1	3300050493	Bacteria	5935
355	nmdc:mga0k408_49492_c1	3300050493	Bacteria	2432
356	nmdc:mga0k408_81119_c1	3300050493	Bacteria	1899
357	nmdc:mga06z11_1936_c1	3300050494	Bacteria	7811
358	nmdc:mga04h51_1577_c1	3300050495	Bacteria	5306
359	nmdc:mga07m45_6867_c1	3300050496	Bacteria	5791
360	nmdc:mga09592_521261_c1	3300050508	Bacteria	1022
361	nmdc:mga0qj67_48066_c1	3300050509	Bacteria	3371
362	nmdc:mga0qj67_689026_c1	3300050509	Bacteria	813
363	nmdc:mga06r32_19068_c1	3300050510	Bacteria	6291
364	nmdc:mga06r32_541056_c1	3300050510	Bacteria	1139
365	nmdc:mga08y16_72548_c1	3300050511	Bacteria	3587
366	nmdc:mga0n895_129139_c1	3300050512	Bacteria	2552
367	nmdc:mga0rr50_7934_c1	3300050513	Bacteria	6586
368	nmdc:mga0rr50_84504_c1	3300050513	Bacteria	2458
369	nmdc:mga08x19_240811_c1	3300050514	Bacteria	1247
370	nmdc:mga08x19_395522_c1	3300050514	Bacteria	969
371	nmdc:mga0a205_16068_c1	3300050515	Bacteria	7006
372	nmdc:mga0a205_630597_c1	3300050515	Bacteria	924
373	nmdc:mga0sz30_7140_c1	3300050516	Bacteria	4180
374	Ga0500644_0467712	3300053088	Bacteria	553
375	Ga0500644_0557996	3300053088	Bacteria	506
376	Ga0500646_0004768	3300053090	Bacteria	3432
377	Ga0500651_0435178	3300053093	Bacteria	732
378	Ga0500555_059434	3300053103	Bacteria	1031
379	Ga0500655_051593	3300053133	Bacteria	820
380	Ga0500568_0199261	3300053139	Bacteria	733
381	Ga0500588_0090947	3300053146	Bacteria	1037
382	Ga0500604_0000352	3300053151	Bacteria	12731
383	Ga0501084_0006534	3300054114	Bacteria	9581
384	Ga0501084_0018257	3300054114	Bacteria	5841
385	Ga0501084_0465926	3300054114	Bacteria	1068
386	Ga0587071_137359	3300060344	Bacteria	598
387	Ga0501082_0008910	3300060353	Bacteria	8656
388	Ga0501082_0659821	3300060353	Bacteria	915
389	Ga0501082_1127184	3300060353	Bacteria	686
390	Ga0530510_0005052	3300061734	Bacteria	9103
391	Ga0530510_0006785	3300061734	Bacteria	7977
392	Ga0530510_0243851	3300061734	Bacteria	1338
393	Ga0530510_1349035	3300061734	Bacteria	547
394	Ga0530510_1541995	3300061734	Bacteria	510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025910	Ga0207684_10221976	Ga0207684_102219762	94
2	3300060353	Ga0501082_0659821	Ga0501082_0659821_15_299	94
3	3300049161	Ga0501305_057274	Ga0501305_057274_152_439	95
4	iso_pu_bacteria	2891633521	2891635734	101
5	3300005844	Ga0068862_102717501	Ga0068862_1027175012	102
6	3300006846	Ga0075430_100884368	Ga0075430_1008843681	103
7	3300042876	Ga0451577_0000013	Ga0451577_0000013_420804_421115	103
8	3300042876	Ga0451577_0101172	Ga0451577_0101172_1864_2184	103
9	3300044673	Ga0453683_0000059	Ga0453683_0000059_57273_57584	103
10	3300044673	Ga0453683_0030079	Ga0453683_0030079_2742_3053	103
11	3300044673	Ga0453683_0247322	Ga0453683_0247322_765_1085	103
12	3300044673	Ga0453683_0424396	Ga0453683_0424396_417_737	103
13	3300044712	Ga0453684_0000585	Ga0453684_0000585_5762_6073	103
14	3300044712	Ga0453684_0000989	Ga0453684_0000989_86746_87057	103
15	3300044712	Ga0453684_0020632	Ga0453684_0020632_8981_9292	103
16	3300044712	Ga0453684_0098007	Ga0453684_0098007_799_1110	103
17	3300045051	Ga0451576_0000018	Ga0451576_0000018_129575_129886	103
18	3300045051	Ga0451576_0184196	Ga0451576_0184196_251_571	103
19	3300045051	Ga0451576_0235909	Ga0451576_0235909_100_420	103
20	3300045051	Ga0451576_0239449	Ga0451576_0239449_1488_1808	103
21	3300045051	Ga0451576_0405589	Ga0451576_0405589_381_692	103
22	3300003579	Ga0007429J51699_1073170	Ga0007429J51699_10731702	104
23	3300004800	Ga0058861_12040642	Ga0058861_120406423	104
24	3300005444	Ga0070694_100739581	Ga0070694_1007395812	104
25	3300005530	Ga0070679_100738041	Ga0070679_1007380412	104
26	3300005563	Ga0068855_101081352	Ga0068855_1010813522	104
27	3300006038	Ga0075365_10208530	Ga0075365_102085302	104
28	3300006042	Ga0075368_10003054	Ga0075368_1000305410	104
29	3300006048	Ga0075363_100000856	Ga0075363_10000085611	104
30	3300006051	Ga0075364_10015296	Ga0075364_100152962	104
31	3300006177	Ga0075362_10001667	Ga0075362_100016672	104
32	3300006178	Ga0075367_10001881	Ga0075367_1000188111	104
33	3300006186	Ga0075369_10003827	Ga0075369_1000382710	104
34	3300006195	Ga0075366_10029562	Ga0075366_100295627	104
35	3300006195	Ga0075366_10447849	Ga0075366_104478492	104
36	3300006353	Ga0075370_10017546	Ga0075370_100175462	104
37	3300006353	Ga0075370_10393044	Ga0075370_103930442	104
38	3300006846	Ga0075430_100018107	Ga0075430_1000181079	104
39	3300006847	Ga0075431_100171524	Ga0075431_1001715244	104
40	3300013100	Ga0157373_11022718	Ga0157373_110227182	104
41	3300013104	Ga0157370_10090984	Ga0157370_100909842	104
42	3300025250	Ga0209026_1018764	Ga0209026_10187641	104
43	3300025921	Ga0207652_11311116	Ga0207652_113111162	104
44	3300025929	Ga0207664_10192610	Ga0207664_101926102	104
45	3300025939	Ga0207665_10862383	Ga0207665_108623832	104
46	3300025949	Ga0207667_10019150	Ga0207667_1001915010	104
47	3300027866	Ga0209813_10001024	Ga0209813_1000102410	104
48	3300028563	Ga0265319_1275611	Ga0265319_12756111	104
49	3300030521	Ga0307511_10000653	Ga0307511_1000065314	104
50	3300031250	Ga0265331_10292709	Ga0265331_102927091	104
51	3300031251	Ga0265327_10131623	Ga0265327_101316232	104
52	3300031665	Ga0316575_10000771	Ga0316575_1000077119	104
53	3300031665	Ga0316575_10251508	Ga0316575_102515082	104
54	3300031728	Ga0316578_10701883	Ga0316578_107018832	104
55	3300031852	Ga0307410_12086969	Ga0307410_120869691	104
56	3300032133	Ga0316583_10008555	Ga0316583_100085553	104
57	3300032133	Ga0316583_10068131	Ga0316583_100681312	104
58	3300032137	Ga0316585_10143487	Ga0316585_101434871	104
59	3300032168	Ga0316593_10002233	Ga0316593_100022339	104
60	3300033179	Ga0307507_10032678	Ga0307507_1003267810	104
61	3300033541	Ga0316596_1003277	Ga0316596_10032776	104
62	3300036647	Ga0316582_0004346	Ga0316582_0004346_3190_3504	104
63	3300036712	Ga0316584_0167539	Ga0316584_0167539_627_941	104
64	3300042876	Ga0451577_0200639	Ga0451577_0200639_1302_1622	104
65	3300044673	Ga0453683_0009125	Ga0453683_0009125_4478_4792	104
66	3300044712	Ga0453684_0205823	Ga0453684_0205823_645_965	104
67	3300045051	Ga0451576_0000013	Ga0451576_0000013_543229_543543	104
68	3300046525	Ga0495663_0118720	Ga0495663_0118720_48_362	104
69	3300046535	Ga0495586_0051053	Ga0495586_0051053_1571_1888	104
70	3300047673	Ga0495593_0297968	Ga0495593_0297968_403_720	104
71	3300048911	Ga0496108_1724654	Ga0496108_1724654_136_477	104
72	3300049573	Ga0501037_0978367	Ga0501037_0978367_98_418	104
73	3300049575	Ga0501039_0419135	Ga0501039_0419135_313_633	104
74	3300049575	Ga0501039_0955700	Ga0501039_0955700_295_615	104
75	3300049579	Ga0501043_1043587	Ga0501043_1043587_55_375	104
76	3300049824	Ga0501045_0276452	Ga0501045_0276452_899_1219	104
77	3300050489	nmdc:mga03683_13626_c1	nmdc:mga03683_13626_c1_2288_2605	104
78	3300050490	nmdc:mga03n38_4317_c1	nmdc:mga03n38_4317_c1_546_863	104
79	3300050491	nmdc:mga00v17_13392_c1	nmdc:mga00v17_13392_c1_1413_1730	104
80	3300050492	nmdc:mga0yw44_1035393_c1	nmdc:mga0yw44_1035393_c1_62_379	104
81	3300050492	nmdc:mga0yw44_22084_c1	nmdc:mga0yw44_22084_c1_422_739	104
82	3300050493	nmdc:mga0k408_13979_c1	nmdc:mga0k408_13979_c1_2968_3285	104
83	3300050493	nmdc:mga0k408_81119_c1	nmdc:mga0k408_81119_c1_298_615	104
84	3300050494	nmdc:mga06z11_1936_c1	nmdc:mga06z11_1936_c1_2648_2965	104
85	3300050495	nmdc:mga04h51_1577_c1	nmdc:mga04h51_1577_c1_4537_4854	104
86	3300050496	nmdc:mga07m45_6867_c1	nmdc:mga07m45_6867_c1_483_800	104
87	3300050508	nmdc:mga09592_521261_c1	nmdc:mga09592_521261_c1_80_400	104
88	3300050509	nmdc:mga0qj67_48066_c1	nmdc:mga0qj67_48066_c1_2307_2621	104
89	3300050510	nmdc:mga06r32_541056_c1	nmdc:mga06r32_541056_c1_394_708	104
90	3300050516	nmdc:mga0sz30_7140_c1	nmdc:mga0sz30_7140_c1_3090_3407	104
91	3300053088	Ga0500644_0467712	Ga0500644_0467712_63_380	104
92	3300053088	Ga0500644_0557996	Ga0500644_0557996_78_395	104
93	3300053090	Ga0500646_0004768	Ga0500646_0004768_1037_1354	104
94	3300053093	Ga0500651_0435178	Ga0500651_0435178_184_501	104
95	3300053103	Ga0500555_059434	Ga0500555_059434_151_468	104
96	3300053133	Ga0500655_051593	Ga0500655_051593_102_419	104
97	3300053139	Ga0500568_0199261	Ga0500568_0199261_304_621	104
98	3300053146	Ga0500588_0090947	Ga0500588_0090947_285_602	104
99	3300053151	Ga0500604_0000352	Ga0500604_0000352_6014_6331	104
100	3300061734	Ga0530510_1541995	Ga0530510_1541995_27_353	104
101	3300002070	JGI24750J21931_1061390	JGI24750J21931_10613902	105
102	3300003203	JGI25406J46586_10029995	JGI25406J46586_100299952	105
103	3300005290	Ga0065712_10718877	Ga0065712_107188771	105
104	3300005295	Ga0065707_10013046	Ga0065707_100130462	105
105	3300005295	Ga0065707_10307588	Ga0065707_103075882	105
106	3300005327	Ga0070658_10061874	Ga0070658_100618741	105
107	3300005329	Ga0070683_100301870	Ga0070683_1003018702	105
108	3300005329	Ga0070683_101420950	Ga0070683_1014209502	105
109	3300005330	Ga0070690_100074696	Ga0070690_1000746962	105
110	3300005331	Ga0070670_101817643	Ga0070670_1018176431	105
111	3300005334	Ga0068869_101555158	Ga0068869_1015551582	105
112	3300005336	Ga0070680_100061453	Ga0070680_1000614537	105
113	3300005343	Ga0070687_100883528	Ga0070687_1008835281	105
114	3300005344	Ga0070661_100068083	Ga0070661_1000680835	105
115	3300005345	Ga0070692_10093904	Ga0070692_100939043	105
116	3300005345	Ga0070692_10924481	Ga0070692_109244812	105
117	3300005365	Ga0070688_100161923	Ga0070688_1001619234	105
118	3300005406	Ga0070703_10038629	Ga0070703_100386294	105
119	3300005435	Ga0070714_100047656	Ga0070714_1000476562	105
120	3300005436	Ga0070713_100193708	Ga0070713_1001937084	105
121	3300005438	Ga0070701_11349184	Ga0070701_113491841	105
122	3300005441	Ga0070700_100891384	Ga0070700_1008913842	105
123	3300005444	Ga0070694_100123201	Ga0070694_1001232012	105
124	3300005444	Ga0070694_100705645	Ga0070694_1007056452	105
125	3300005468	Ga0070707_100238841	Ga0070707_1002388412	105
126	3300005471	Ga0070698_101056049	Ga0070698_1010560491	105
127	3300005518	Ga0070699_100895387	Ga0070699_1008953872	105
128	3300005535	Ga0070684_100070941	Ga0070684_1000709416	105
129	3300005544	Ga0070686_100061505	Ga0070686_1000615056	105
130	3300005544	Ga0070686_101421483	Ga0070686_1014214831	105
131	3300005545	Ga0070695_100908358	Ga0070695_1009083582	105
132	3300005545	Ga0070695_100952782	Ga0070695_1009527822	105
133	3300005546	Ga0070696_101825259	Ga0070696_1018252591	105
134	3300005547	Ga0070693_100661732	Ga0070693_1006617322	105
135	3300005549	Ga0070704_100644738	Ga0070704_1006447382	105
136	3300005563	Ga0068855_100138919	Ga0068855_1001389191	105
137	3300005614	Ga0068856_101142826	Ga0068856_1011428262	105
138	3300005615	Ga0070702_100503811	Ga0070702_1005038111	105
139	3300005616	Ga0068852_100739196	Ga0068852_1007391962	105
140	3300005617	Ga0068859_100021700	Ga0068859_1000217006	105
141	3300005618	Ga0068864_100076229	Ga0068864_1000762295	105
142	3300005841	Ga0068863_100258996	Ga0068863_1002589965	105
143	3300005985	Ga0081539_10010390	Ga0081539_100103904	105
144	3300005985	Ga0081539_10161149	Ga0081539_101611492	105
145	3300006028	Ga0070717_10361170	Ga0070717_103611702	105
146	3300006175	Ga0070712_100691409	Ga0070712_1006914092	105
147	3300006175	Ga0070712_101354128	Ga0070712_1013541282	105
148	3300006177	Ga0075362_10039756	Ga0075362_100397563	105
149	3300006177	Ga0075362_10223011	Ga0075362_102230112	105
150	3300006195	Ga0075366_10072831	Ga0075366_100728313	105
151	3300006195	Ga0075366_10394105	Ga0075366_103941052	105
152	3300006353	Ga0075370_10583153	Ga0075370_105831532	105
153	3300006847	Ga0075431_100657040	Ga0075431_1006570402	105
154	3300006852	Ga0075433_10079601	Ga0075433_100796013	105
155	3300006852	Ga0075433_10660317	Ga0075433_106603172	105
156	3300006871	Ga0075434_100208963	Ga0075434_1002089633	105
157	3300006914	Ga0075436_100069889	Ga0075436_1000698895	105
158	3300006914	Ga0075436_100465695	Ga0075436_1004656952	105
159	3300006931	Ga0097620_100021700	Ga0097620_10002170010	105
160	3300007076	Ga0075435_100006049	Ga0075435_1000060499	105
161	3300007076	Ga0075435_100019527	Ga0075435_1000195276	105
162	3300007265	Ga0099794_10104294	Ga0099794_101042943	105
163	3300007265	Ga0099794_10566299	Ga0099794_105662992	105
164	3300009093	Ga0105240_10252783	Ga0105240_102527832	105
165	3300009094	Ga0111539_10069166	Ga0111539_100691662	105
166	3300009545	Ga0105237_10809625	Ga0105237_108096252	105
167	3300009551	Ga0105238_10087095	Ga0105238_100870952	105
168	3300010375	Ga0105239_10215856	Ga0105239_102158562	105
169	3300011119	Ga0105246_10632441	Ga0105246_106324412	105
170	3300012480	Ga0157346_1002281	Ga0157346_10022812	105
171	3300013105	Ga0157369_10229169	Ga0157369_102291692	105
172	3300013297	Ga0157378_11085783	Ga0157378_110857832	105
173	3300013307	Ga0157372_10202803	Ga0157372_102028035	105
174	3300020070	Ga0206356_11323055	Ga0206356_113230551	105
175	3300025321	Ga0207656_10344335	Ga0207656_103443351	105
176	3300025885	Ga0207653_10109702	Ga0207653_101097022	105
177	3300025912	Ga0207707_11021102	Ga0207707_110211022	105
178	3300025913	Ga0207695_10045231	Ga0207695_100452318	105
179	3300025918	Ga0207662_10573849	Ga0207662_105738492	105
180	3300025920	Ga0207649_10101163	Ga0207649_101011632	105
181	3300025922	Ga0207646_10205220	Ga0207646_102052204	105
182	3300025924	Ga0207694_10007098	Ga0207694_1000709812	105
183	3300025925	Ga0207650_10152420	Ga0207650_101524202	105
184	3300025929	Ga0207664_11032378	Ga0207664_110323782	105
185	3300025935	Ga0207709_10971527	Ga0207709_109715272	105
186	3300025936	Ga0207670_10038917	Ga0207670_100389174	105
187	3300025940	Ga0207691_11712497	Ga0207691_117124972	105
188	3300025942	Ga0207689_10850412	Ga0207689_108504122	105
189	3300025944	Ga0207661_10242302	Ga0207661_102423022	105
190	3300025949	Ga0207667_10223167	Ga0207667_102231672	105
191	3300025961	Ga0207712_11642397	Ga0207712_116423972	105
192	3300026075	Ga0207708_10479958	Ga0207708_104799582	105
193	3300026078	Ga0207702_10140039	Ga0207702_101400395	105
194	3300026088	Ga0207641_12486549	Ga0207641_124865492	105
195	3300026142	Ga0207698_10939980	Ga0207698_109399802	105
196	3300027395	Ga0209996_1017678	Ga0209996_10176781	105
197	3300027462	Ga0210000_1023199	Ga0210000_10231992	105
198	3300027682	Ga0209971_1075735	Ga0209971_10757352	105
199	3300027907	Ga0207428_10449573	Ga0207428_104495732	105
200	3300028794	Ga0307515_10203755	Ga0307515_102037552	105
201	3300031665	Ga0316575_10003983	Ga0316575_100039833	105
202	3300031691	Ga0316579_10000952	Ga0316579_1000095210	105
203	3300032002	Ga0307416_101035144	Ga0307416_1010351442	105
204	3300032133	Ga0316583_10002208	Ga0316583_100022082	105
205	3300032133	Ga0316583_10007463	Ga0316583_100074639	105
206	3300032139	Ga0316580_10090579	Ga0316580_100905791	105
207	3300032168	Ga0316593_10000192	Ga0316593_1000019216	105
208	3300032168	Ga0316593_10238377	Ga0316593_102383771	105
209	3300033527	Ga0316586_1026237	Ga0316586_10262372	105
210	3300033527	Ga0316586_1030302	Ga0316586_10303022	105
211	3300033541	Ga0316596_1000154	Ga0316596_100015413	105
212	3300034816	Ga0373930_0074285	Ga0373930_0074285_329_646	105
213	3300034817	Ga0373948_0077689	Ga0373948_0077689_386_706	105
214	3300034820	Ga0373959_0064232	Ga0373959_0064232_454_771	105
215	3300034820	Ga0373959_0137091	Ga0373959_0137091_192_509	105
216	3300034957	Ga0373938_0060798	Ga0373938_0060798_171_488	105
217	3300035083	Ga0373926_0005302	Ga0373926_0005302_3883_4200	105
218	3300035084	Ga0373928_0168036	Ga0373928_0168036_282_599	105
219	3300035089	Ga0373944_0011229	Ga0373944_0011229_672_989	105
220	3300035092	Ga0373952_0000366	Ga0373952_0000366_2606_2929	105
221	3300035092	Ga0373952_0024981	Ga0373952_0024981_423_740	105
222	3300035113	Ga0373936_0020227	Ga0373936_0020227_2150_2467	105
223	3300035114	Ga0373939_0234584	Ga0373939_0234584_144_461	105
224	3300035114	Ga0373939_0250851	Ga0373939_0250851_67_384	105
225	3300035114	Ga0373939_0320046	Ga0373939_0320046_289_606	105
226	3300035115	Ga0373941_0013805	Ga0373941_0013805_1191_1508	105
227	3300035115	Ga0373941_0321593	Ga0373941_0321593_121_438	105
228	3300035118	Ga0373954_0294714	Ga0373954_0294714_33_350	105
229	3300035121	Ga0373960_0028386	Ga0373960_0028386_301_618	105
230	3300035121	Ga0373960_0035512	Ga0373960_0035512_483_800	105
231	3300035121	Ga0373960_0134525	Ga0373960_0134525_363_680	105
232	3300035121	Ga0373960_0165858	Ga0373960_0165858_298_630	105
233	3300035170	Ga0373943_0036624	Ga0373943_0036624_1585_1902	105
234	3300035170	Ga0373943_0954970	Ga0373943_0954970_81_401	105
235	3300035171	Ga0373946_0049130	Ga0373946_0049130_23_340	105
236	3300035171	Ga0373946_0095412	Ga0373946_0095412_521_841	105
237	3300035241	Ga0373961_0010397	Ga0373961_0010397_1954_2271	105
238	3300035242	Ga0373962_0102169	Ga0373962_0102169_117_434	105
239	3300035398	Ga0316574_0203373	Ga0316574_0203373_902_1219	105
240	3300035398	Ga0316574_0208020	Ga0316574_0208020_894_1211	105
241	3300035410	Ga0373924_0026912	Ga0373924_0026912_101_418	105
242	3300035691	Ga0373931_0002669	Ga0373931_0002669_6709_7029	105
243	3300035691	Ga0373931_0203983	Ga0373931_0203983_662_979	105
244	3300035691	Ga0373931_1073477	Ga0373931_1073477_82_399	105
245	3300035692	Ga0373935_0034613	Ga0373935_0034613_2173_2490	105
246	3300035692	Ga0373935_0255183	Ga0373935_0255183_153_473	105
247	3300035695	Ga0373927_0036300	Ga0373927_0036300_865_1182	105
248	3300035725	Ga0373947_0136207	Ga0373947_0136207_595_912	105
249	3300036401	Ga0373937_0065847	Ga0373937_0065847_2361_2678	105
250	3300036647	Ga0316582_0002553	Ga0316582_0002553_2250_2567	105
251	3300036647	Ga0316582_0008752	Ga0316582_0008752_1693_2010	105
252	3300036712	Ga0316584_0006254	Ga0316584_0006254_5625_5942	105
253	3300037068	Ga0373925_0007409	Ga0373925_0007409_3966_4283	105
254	3300037588	Ga0316581_0001079	Ga0316581_0001079_1509_1826	105
255	3300041446	Ga0451794_10550	Ga0451794_10550_26_346	105
256	3300042001	Ga0439441_003617	Ga0439441_003617_1037_1354	105
257	3300042001	Ga0439441_060985	Ga0439441_060985_132_449	105
258	3300042003	Ga0439443_000264	Ga0439443_000264_3646_3963	105
259	3300042009	Ga0439451_002659	Ga0439451_002659_129_446	105
260	3300042435	Ga0439434_0032682	Ga0439434_0032682_180_497	105
261	3300042435	Ga0439434_0359885	Ga0439434_0359885_107_424	105
262	3300042436	Ga0439435_0004015	Ga0439435_0004015_1040_1357	105
263	3300042461	Ga0439460_0002792	Ga0439460_0002792_3178_3495	105
264	3300042461	Ga0439460_0072199	Ga0439460_0072199_372_692	105
265	3300042876	Ga0451577_0454646	Ga0451577_0454646_122_439	105
266	3300044694	Ga0466963_0283213	Ga0466963_0283213_581_913	105
267	3300044706	Ga0466964_0020860	Ga0466964_0020860_1609_1926	105
268	3300044712	Ga0453684_0674870	Ga0453684_0674870_748_1065	105
269	3300044712	Ga0453684_0780306	Ga0453684_0780306_626_943	105
270	3300044842	Ga0466957_0152111	Ga0466957_0152111_21_338	105
271	3300045051	Ga0451576_1489920	Ga0451576_1489920_368_685	105
272	3300045976	Ga0466967_0016890	Ga0466967_0016890_4346_4663	105
273	3300046455	Ga0495603_0022916	Ga0495603_0022916_3224_3541	105
274	3300046459	Ga0495629_0062948	Ga0495629_0062948_2135_2467	105
275	3300046471	Ga0495650_0007879	Ga0495650_0007879_3299_3616	105
276	3300046472	Ga0495580_0004729	Ga0495580_0004729_6123_6440	105
277	3300046473	Ga0495582_0022900	Ga0495582_0022900_2930_3247	105
278	3300046499	Ga0495594_0815542	Ga0495594_0815542_112_429	105
279	3300046526	Ga0495666_0042539	Ga0495666_0042539_1527_1844	105
280	3300046526	Ga0495666_0045650	Ga0495666_0045650_164_481	105
281	3300046531	Ga0495665_0067989	Ga0495665_0067989_1392_1709	105
282	3300046535	Ga0495586_0012832	Ga0495586_0012832_1104_1421	105
283	3300046537	Ga0495598_0329516	Ga0495598_0329516_146_463	105
284	3300046539	Ga0495621_0008009	Ga0495621_0008009_1018_1335	105
285	3300046539	Ga0495621_0197696	Ga0495621_0197696_208_525	105
286	3300046539	Ga0495621_0211786	Ga0495621_0211786_27_344	105
287	3300046674	Ga0495588_0023940	Ga0495588_0023940_1249_1566	105
288	3300046675	Ga0495657_0372718	Ga0495657_0372718_196_513	105
289	3300046681	Ga0495647_0001629	Ga0495647_0001629_3482_3799	105
290	3300046681	Ga0495647_0056319	Ga0495647_0056319_788_1105	105
291	3300046683	Ga0495658_0025293	Ga0495658_0025293_2456_2773	105
292	3300047315	Ga0495581_0574986	Ga0495581_0574986_259_576	105
293	3300047321	Ga0495676_0091846	Ga0495676_0091846_192_509	105
294	3300049515	Ga0501292_078776	Ga0501292_078776_288_605	105
295	3300049521	Ga0501298_194201	Ga0501298_194201_28_345	105
296	3300049568	Ga0501031_0089009	Ga0501031_0089009_1653_1970	105
297	3300049568	Ga0501031_0122019	Ga0501031_0122019_787_1104	105
298	3300049569	Ga0501032_0091873	Ga0501032_0091873_106_423	105
299	3300049569	Ga0501032_0769578	Ga0501032_0769578_166_483	105
300	3300049570	Ga0501033_0004098	Ga0501033_0004098_3720_4037	105
301	3300049571	Ga0501034_0043134	Ga0501034_0043134_3394_3711	105
302	3300049572	Ga0501036_0006553	Ga0501036_0006553_7394_7711	105
303	3300049572	Ga0501036_0034324	Ga0501036_0034324_1780_2097	105
304	3300049573	Ga0501037_0005636	Ga0501037_0005636_1161_1478	105
305	3300049573	Ga0501037_0148517	Ga0501037_0148517_1266_1583	105
306	3300049573	Ga0501037_0311987	Ga0501037_0311987_183_500	105
307	3300049573	Ga0501037_0521904	Ga0501037_0521904_362_679	105
308	3300049574	Ga0501038_0000891	Ga0501038_0000891_22286_22603	105
309	3300049574	Ga0501038_0542607	Ga0501038_0542607_300_617	105
310	3300049575	Ga0501039_0005177	Ga0501039_0005177_7796_8113	105
311	3300049575	Ga0501039_0065773	Ga0501039_0065773_647_964	105
312	3300049575	Ga0501039_0252162	Ga0501039_0252162_263_580	105
313	3300049575	Ga0501039_0415136	Ga0501039_0415136_488_805	105
314	3300049576	Ga0501040_0003846	Ga0501040_0003846_5944_6261	105
315	3300049576	Ga0501040_0067749	Ga0501040_0067749_1184_1501	105
316	3300049576	Ga0501040_0170862	Ga0501040_0170862_284_601	105
317	3300049577	Ga0501041_0000815	Ga0501041_0000815_14893_15210	105
318	3300049577	Ga0501041_0003344	Ga0501041_0003344_4248_4565	105
319	3300049577	Ga0501041_0022479	Ga0501041_0022479_1971_2288	105
320	3300049577	Ga0501041_0344804	Ga0501041_0344804_332_649	105
321	3300049578	Ga0501042_0009869	Ga0501042_0009869_4124_4441	105
322	3300049578	Ga0501042_0012358	Ga0501042_0012358_3485_3802	105
323	3300049578	Ga0501042_0083145	Ga0501042_0083145_1304_1621	105
324	3300049579	Ga0501043_0006848	Ga0501043_0006848_2846_3163	105
325	3300049579	Ga0501043_0273161	Ga0501043_0273161_167_484	105
326	3300049579	Ga0501043_0952010	Ga0501043_0952010_98_415	105
327	3300049580	Ga0501046_0004387	Ga0501046_0004387_7507_7824	105
328	3300049581	Ga0501047_0447682	Ga0501047_0447682_705_1022	105
329	3300049582	Ga0501048_0005618	Ga0501048_0005618_7476_7793	105
330	3300049582	Ga0501048_0049929	Ga0501048_0049929_2603_2920	105
331	3300049585	Ga0501069_0030284	Ga0501069_0030284_2543_2860	105
332	3300049586	Ga0501070_0021717	Ga0501070_0021717_4947_5264	105
333	3300049587	Ga0501071_0005936	Ga0501071_0005936_5966_6283	105
334	3300049587	Ga0501071_0058963	Ga0501071_0058963_662_979	105
335	3300049587	Ga0501071_0114002	Ga0501071_0114002_1249_1566	105
336	3300049587	Ga0501071_0209267	Ga0501071_0209267_529_846	105
337	3300049587	Ga0501071_0545569	Ga0501071_0545569_268_585	105
338	3300049588	Ga0501072_0000447	Ga0501072_0000447_5944_6261	105
339	3300049588	Ga0501072_0018930	Ga0501072_0018930_636_953	105
340	3300049588	Ga0501072_0082224	Ga0501072_0082224_660_977	105
341	3300049589	Ga0501073_0008056	Ga0501073_0008056_5867_6184	105
342	3300049589	Ga0501073_0108715	Ga0501073_0108715_856_1173	105
343	3300049589	Ga0501073_0168115	Ga0501073_0168115_675_992	105
344	3300049590	Ga0501074_0005165	Ga0501074_0005165_8987_9304	105
345	3300049590	Ga0501074_0098233	Ga0501074_0098233_1237_1554	105
346	3300049590	Ga0501074_0819335	Ga0501074_0819335_196_513	105
347	3300049591	Ga0501075_0003793	Ga0501075_0003793_4443_4760	105
348	3300049591	Ga0501075_0009583	Ga0501075_0009583_520_837	105
349	3300049591	Ga0501075_0024398	Ga0501075_0024398_1599_1916	105
350	3300049591	Ga0501075_0251037	Ga0501075_0251037_269_586	105
351	3300049592	Ga0501076_0000663	Ga0501076_0000663_8372_8689	105
352	3300049592	Ga0501076_0006205	Ga0501076_0006205_5944_6261	105
353	3300049592	Ga0501076_0047645	Ga0501076_0047645_521_838	105
354	3300049593	Ga0501077_0000810	Ga0501077_0000810_4454_4771	105
355	3300049593	Ga0501077_0049998	Ga0501077_0049998_1395_1712	105
356	3300049741	Ga0501079_0004844	Ga0501079_0004844_5944_6261	105
357	3300049741	Ga0501079_0015785	Ga0501079_0015785_2317_2634	105
358	3300049741	Ga0501079_0039556	Ga0501079_0039556_1063_1380	105
359	3300049741	Ga0501079_0039713	Ga0501079_0039713_1545_1862	105
360	3300049742	Ga0501080_0001428	Ga0501080_0001428_17224_17541	105
361	3300049742	Ga0501080_0005999	Ga0501080_0005999_8164_8481	105
362	3300049742	Ga0501080_0088780	Ga0501080_0088780_1981_2298	105
363	3300049743	Ga0501081_0000747	Ga0501081_0000747_16518_16835	105
364	3300049743	Ga0501081_0014826	Ga0501081_0014826_423_740	105
365	3300049743	Ga0501081_0031168	Ga0501081_0031168_715_1032	105
366	3300049743	Ga0501081_0691130	Ga0501081_0691130_261_578	105
367	3300049744	Ga0501083_0159295	Ga0501083_0159295_396_713	105
368	3300049775	Ga0501279_027112	Ga0501279_027112_140_457	105
369	3300049822	Ga0501035_0010710	Ga0501035_0010710_3161_3478	105
370	3300049823	Ga0501044_0091955	Ga0501044_0091955_2386_2703	105
371	3300049824	Ga0501045_0002784	Ga0501045_0002784_5944_6261	105
372	3300049824	Ga0501045_0003651	Ga0501045_0003651_4174_4491	105
373	3300049824	Ga0501045_1126349	Ga0501045_1126349_187_504	105
374	3300050493	nmdc:mga0k408_4092_c1	nmdc:mga0k408_4092_c1_967_1287	105
375	3300050493	nmdc:mga0k408_49492_c1	nmdc:mga0k408_49492_c1_591_908	105
376	3300050509	nmdc:mga0qj67_689026_c1	nmdc:mga0qj67_689026_c1_162_479	105
377	3300050510	nmdc:mga06r32_19068_c1	nmdc:mga06r32_19068_c1_243_560	105
378	3300050511	nmdc:mga08y16_72548_c1	nmdc:mga08y16_72548_c1_3133_3450	105
379	3300050512	nmdc:mga0n895_129139_c1	nmdc:mga0n895_129139_c1_524_841	105
380	3300050513	nmdc:mga0rr50_7934_c1	nmdc:mga0rr50_7934_c1_3578_3895	105
381	3300050513	nmdc:mga0rr50_84504_c1	nmdc:mga0rr50_84504_c1_39_356	105
382	3300050514	nmdc:mga08x19_240811_c1	nmdc:mga08x19_240811_c1_687_1004	105
383	3300050514	nmdc:mga08x19_395522_c1	nmdc:mga08x19_395522_c1_241_558	105
384	3300050515	nmdc:mga0a205_16068_c1	nmdc:mga0a205_16068_c1_6663_6980	105
385	3300050515	nmdc:mga0a205_630597_c1	nmdc:mga0a205_630597_c1_450_767	105
386	3300054114	Ga0501084_0006534	Ga0501084_0006534_1170_1487	105
387	3300054114	Ga0501084_0018257	Ga0501084_0018257_3102_3419	105
388	3300054114	Ga0501084_0465926	Ga0501084_0465926_166_483	105
389	3300060344	Ga0587071_137359	Ga0587071_137359_91_423	105
390	3300060353	Ga0501082_0008910	Ga0501082_0008910_334_651	105
391	3300060353	Ga0501082_1127184	Ga0501082_1127184_278_595	105
392	3300061734	Ga0530510_0005052	Ga0530510_0005052_2843_3160	105
393	3300061734	Ga0530510_0006785	Ga0530510_0006785_6100_6417	105
394	3300061734	Ga0530510_0243851	Ga0530510_0243851_630_947	105
395	3300061734	Ga0530510_1349035	Ga0530510_1349035_39_356	105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

104

0.98 PF00467

KOW

KOW motif

7

38

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8cgv-assembly1.cif.gz_t	tiamulin bound to the 50s subunit	0.9615	3	103
8cam-assembly1.cif.gz_t	evernimicin bound to the 50s subunit	0.9534	3	103
7nwt-assembly1.cif.gz_U	initiated 70s ribosome in complex with 2a protein from encephalomyocarditis virus (emcv)	0.9508	3	104
6vwl-assembly1.cif.gz_S	70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation)	0.9508	3	103
6vwn-assembly1.cif.gz_S	70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii)	0.9494	3	103

ID	Description	Score	Start	End	Superfamily
af_C6SX56_4_111_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.9128	3	100	2.30.30.30
af_C6KSP8_36_136_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.9098	1	100	2.30.30.30
af_Q55DJ4_14_116_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.8978	4	101	2.30.30.30
af_P9WHB7_1_104_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.8839	3	101	2.30.30.30
af_Q96A35_47_153_2.30.30.30	Mainly Beta;Roll;SH3 type barrels.;	0.8758	4	101	2.30.30.30

ID	Description	Score	Start	End	GO Terms
AF-A0A2S8H2I7-F1-model_v4	deleted	0.9878	1	105
AF-A0A7C3GS56-F1-model_v4	Large ribosomal subunit protein uL24 (50S ribosomal protein L24)	0.9858	1	66	GO:0003723 GO:0003735 GO:0005840 GO:0006412 GO:1990904
AF-A0A836S9C2-F1-model_v4	Large ribosomal subunit protein uL24	0.9834	1	105	GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904
AF-A0A2V3VNT6-F1-model_v4	Large ribosomal subunit protein uL24	0.9803	1	104	GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904
AF-A0A352Q4Q8-F1-model_v4	Large ribosomal subunit protein uL24 (50S ribosomal protein L24)	0.9787	1	82	GO:0003723 GO:0003735 GO:0005840 GO:0006412 GO:1990904

Feature Viewer

pLDDT	pTM	Quality
90.47	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F433255

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

104

0.98

PF00467

KOW

KOW motif

7

38

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map