F433246

General Info

Members Datasets Scaffolds Average Seq Length
395 219 790 103

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10062871|Ga0265331_100628712
Length 117
Sequence LTSGLATLNAGRMTDEPETAANAVPPADPAADVPPDHLAINPRSPHFDADTLQRGIGIRFKGAVRTNVEEYCISEGWIRVQAGKTMDRKGQPLTLKLNGPVEAWYEDLGENPPVAKA

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
132 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
205 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
206 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
209 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
210 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
211 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
212 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
213 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
214 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
215 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
216 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
217 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
218 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
219 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0
Isolates 3.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.25
Nodule 1.01
Rhizoplane 6.84
Rhizosphere 62.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10062871 3300031250 Bacteria 1750
2 SwRhRL2b_contig_976014 2162886007 Bacteria 4695
3 JGI24034J26672_10001945 3300002239 Bacteria 2796
4 JGI24751J29686_10000243 3300002459 Bacteria 21745
5 Ga0065704_10072046 3300005289 Bacteria 9301
6 Ga0065704_10091004 3300005289 Bacteria 2748
7 Ga0065704_10107013 3300005289 Bacteria 2067
8 Ga0065704_10156035 3300005289 Bacteria 1390
9 Ga0065707_10652200 3300005295 Bacteria 656
10 Ga0070658_10001006 3300005327 Bacteria 24131
11 Ga0070658_10021829 3300005327 Bacteria 5131
12 Ga0070658_10076287 3300005327 Bacteria 2749
13 Ga0070658_10201060 3300005327 Bacteria 1681
14 Ga0070658_11519601 3300005327 Bacteria 581
15 Ga0070676_10878947 3300005328 Bacteria 666
16 Ga0070683_100751916 3300005329 Bacteria 934
17 Ga0070670_100134957 3300005331 Bacteria 2132
18 Ga0070670_100412284 3300005331 Bacteria 1194
19 Ga0070670_101925118 3300005331 Bacteria 545
20 Ga0070666_10017243 3300005335 Bacteria 4628
21 Ga0070680_100873040 3300005336 Bacteria 776
22 Ga0070660_100131725 3300005339 Bacteria 2001
23 Ga0070689_101187130 3300005340 Bacteria 685
24 Ga0070661_100192921 3300005344 Bacteria 1554
25 Ga0070692_10696350 3300005345 Bacteria 683
26 Ga0070668_100016329 3300005347 Bacteria 5551
27 Ga0070668_100050218 3300005347 Bacteria 3211
28 Ga0070668_100128381 3300005347 Bacteria 2032
29 Ga0070669_100000302 3300005353 Bacteria 38805
30 Ga0070669_100000394 3300005353 Bacteria 33428
31 Ga0070669_101915767 3300005353 Bacteria 518
32 Ga0070675_101967486 3300005354 Bacteria 539
33 Ga0070671_100000089 3300005355 Bacteria 58283
34 Ga0070671_100024528 3300005355 Bacteria 4938
35 Ga0070671_100062385 3300005355 Bacteria 3104
36 Ga0070671_100311042 3300005355 Bacteria 1342
37 Ga0070659_100005678 3300005366 Bacteria 8973
38 Ga0070667_100000079 3300005367 Bacteria 119348
39 Ga0070667_100000984 3300005367 Bacteria 26179
40 Ga0070667_100174421 3300005367 Bacteria 1899
41 Ga0070667_101801944 3300005367 Bacteria 576
42 Ga0070700_101389494 3300005441 Bacteria 593
43 Ga0070708_100332764 3300005445 Bacteria 1431
44 Ga0070663_100031685 3300005455 Bacteria 3636
45 Ga0070663_100323052 3300005455 Bacteria 1242
46 Ga0070663_101815746 3300005455 Bacteria 547
47 Ga0070662_100010690 3300005457 Bacteria 6040
48 Ga0070681_10910674 3300005458 Bacteria 798
49 Ga0070707_100233305 3300005468 Bacteria 1791
50 Ga0070707_102036444 3300005468 Bacteria 542
51 Ga0070679_100192467 3300005530 Bacteria 2008
52 Ga0070679_100213748 3300005530 Bacteria 1891
53 Ga0070679_100674079 3300005530 Bacteria 977
54 Ga0068853_101394973 3300005539 Bacteria 677
55 Ga0070686_100049772 3300005544 Bacteria 2660
56 Ga0070665_100008802 3300005548 Bacteria 10218
57 Ga0070665_100180066 3300005548 Bacteria 2115
58 Ga0070665_100361958 3300005548 Bacteria 1457
59 Ga0068855_100147446 3300005563 Bacteria 2678
60 Ga0068855_100204408 3300005563 Bacteria 2222
61 Ga0068855_100416302 3300005563 Bacteria 1470
62 Ga0068855_100657591 3300005563 Bacteria 1125
63 Ga0070664_100027744 3300005564 Bacteria 4707
64 Ga0068857_101622745 3300005577 Bacteria 631
65 Ga0068854_100005555 3300005578 Bacteria 7968
66 Ga0068854_100403338 3300005578 Bacteria 1132
67 Ga0068854_101836612 3300005578 Bacteria 556
68 Ga0068856_100119059 3300005614 Bacteria 2641
69 Ga0068856_100739711 3300005614 Bacteria 1003
70 Ga0068852_101085233 3300005616 Bacteria 820
71 Ga0068859_100373053 3300005617 Bacteria 1522
72 Ga0068859_100514941 3300005617 Bacteria 1291
73 Ga0068859_102576311 3300005617 Bacteria 560
74 Ga0068864_100002064 3300005618 Bacteria 16599
75 Ga0068864_100327324 3300005618 Bacteria 1440
76 Ga0068851_10916259 3300005834 Bacteria 550
77 Ga0068863_100000005 3300005841 Bacteria 269757
78 Ga0068863_100102087 3300005841 Bacteria 2727
79 Ga0068863_100118549 3300005841 Bacteria 2523
80 Ga0068863_100370952 3300005841 Bacteria 1397
81 Ga0068863_101873854 3300005841 Bacteria 610
82 Ga0068858_100030484 3300005842 Bacteria 5007
83 Ga0068858_100692195 3300005842 Bacteria 992
84 Ga0068860_100025775 3300005843 Bacteria 5672
85 Ga0068860_100030371 3300005843 Bacteria 5197
86 Ga0068860_100073655 3300005843 Bacteria 3247
87 Ga0068860_100245375 3300005843 Bacteria 1742
88 Ga0068860_100912621 3300005843 Bacteria 895
89 Ga0068860_101849534 3300005843 Bacteria 625
90 Ga0068862_100091459 3300005844 Bacteria 2650
91 Ga0075368_10000929 3300006042 Bacteria 9115
92 Ga0075363_100002101 3300006048 Bacteria 7987
93 Ga0075363_100101503 3300006048 Bacteria 1592
94 Ga0075364_10139110 3300006051 Bacteria 1632
95 Ga0075364_10163764 3300006051 Bacteria 1502
96 Ga0075364_10692706 3300006051 Bacteria 695
97 Ga0075432_10001396 3300006058 Bacteria 7853
98 Ga0075362_10000961 3300006177 Bacteria 8815
99 Ga0075362_10002646 3300006177 Bacteria 6076
100 Ga0075367_10035552 3300006178 Bacteria 2884
101 Ga0075369_10019862 3300006186 Bacteria 2746
102 Ga0075369_10023073 3300006186 Bacteria 2570
103 Ga0075369_10238804 3300006186 Bacteria 843
104 Ga0075366_10000629 3300006195 Bacteria 16580
105 Ga0075366_10112425 3300006195 Bacteria 1639
106 Ga0075366_10166035 3300006195 Bacteria 1339
107 Ga0075366_10171948 3300006195 Bacteria 1315
108 Ga0075366_10236884 3300006195 Bacteria 1112
109 Ga0075366_10309621 3300006195 Bacteria 967
110 Ga0075370_10000016 3300006353 Bacteria 60608
111 Ga0075370_10002694 3300006353 Bacteria 8311
112 Ga0075370_10003280 3300006353 Bacteria 7677
113 Ga0075370_10149756 3300006353 Bacteria 1367
114 Ga0075370_10440433 3300006353 Bacteria 784
115 Ga0075370_10673149 3300006353 Bacteria 629
116 Ga0097620_100373042 3300006931 Bacteria 1522
117 Ga0097620_100514950 3300006931 Bacteria 1291
118 Ga0097620_102576114 3300006931 Bacteria 560
119 Ga0079104_1018521 3300006946 Bacteria 1971
120 Ga0079104_1019107 3300006946 Bacteria 1924
121 Ga0079104_1059200 3300006946 Bacteria 830
122 Ga0075435_100471553 3300007076 Bacteria 1084
123 Ga0105251_10073090 3300009011 Bacteria 1594
124 Ga0105250_10321833 3300009092 Bacteria 672
125 Ga0105240_10020470 3300009093 Bacteria 8823
126 Ga0105240_10177416 3300009093 Bacteria 2518
127 Ga0111539_10131403 3300009094 Bacteria 2931
128 Ga0105247_10210851 3300009101 Bacteria 1310
129 Ga0105241_11325903 3300009174 Bacteria 686
130 Ga0105241_12437278 3300009174 Bacteria 523
131 Ga0105248_10009115 3300009177 Bacteria 10916
132 Ga0105248_10019327 3300009177 Bacteria 7537
133 Ga0105248_10049232 3300009177 Bacteria 4726
134 Ga0105248_10213048 3300009177 Bacteria 2177
135 Ga0105248_10246032 3300009177 Bacteria 2013
136 Ga0105248_10309691 3300009177 Bacteria 1778
137 Ga0105248_11351125 3300009177 Bacteria 806
138 Ga0105237_10748393 3300009545 Bacteria 984
139 Ga0105238_10479956 3300009551 Bacteria 1242
140 Ga0105249_10079055 3300009553 Bacteria 3053
141 Ga0157371_11261741 3300013102 Bacteria 571
142 Ga0157370_10402540 3300013104 Bacteria 1260
143 Ga0163162_10013344 3300013306 Bacteria 8024
144 Ga0163162_10014793 3300013306 Bacteria 7622
145 Ga0163162_10112533 3300013306 Bacteria 2820
146 Ga0157379_10513329 3300014968 Bacteria 1112
147 Ga0163161_10660399 3300017792 Bacteria 867
148 Ga0207697_10081813 3300025315 Bacteria 1361
149 Ga0207696_1001159 3300025711 Bacteria 15129
150 Ga0207647_10112902 3300025904 Bacteria 1606
151 Ga0207645_10744846 3300025907 Bacteria 666
152 Ga0207705_10000009 3300025909 Bacteria 576128
153 Ga0207705_10001354 3300025909 Bacteria 19563
154 Ga0207705_10011717 3300025909 Bacteria 6335
155 Ga0207705_10156805 3300025909 Bacteria 1708
156 Ga0207654_11332262 3300025911 Bacteria 523
157 Ga0207695_10011666 3300025913 Bacteria 10620
158 Ga0207660_10883029 3300025917 Bacteria 730
159 Ga0207657_10030844 3300025919 Bacteria 4859
160 Ga0207657_10053497 3300025919 Bacteria 3497
161 Ga0207649_10440586 3300025920 Bacteria 981
162 Ga0207652_10015706 3300025921 Bacteria 6167
163 Ga0207652_10168485 3300025921 Bacteria 1965
164 Ga0207652_10198312 3300025921 Bacteria 1806
165 Ga0207646_11479333 3300025922 Bacteria 589
166 Ga0207681_10000164 3300025923 Bacteria 54644
167 Ga0207681_10001084 3300025923 Bacteria 17651
168 Ga0207650_10368138 3300025925 Bacteria 1185
169 Ga0207659_11877035 3300025926 Bacteria 508
170 Ga0207644_10000005 3300025931 Bacteria 441948
171 Ga0207644_10003445 3300025931 Bacteria 10224
172 Ga0207644_10024933 3300025931 Bacteria 4109
173 Ga0207644_10087390 3300025931 Bacteria 2317
174 Ga0207690_10276780 3300025932 Bacteria 1306
175 Ga0207706_10005923 3300025933 Bacteria 11369
176 Ga0207711_10002690 3300025941 Bacteria 15714
177 Ga0207711_10226376 3300025941 Bacteria 1712
178 Ga0207711_10308896 3300025941 Bacteria 1460
179 Ga0207711_10511375 3300025941 Bacteria 1120
180 Ga0207711_10898679 3300025941 Bacteria 823
181 Ga0207667_10051660 3300025949 Bacteria 4332
182 Ga0207667_10098225 3300025949 Bacteria 3022
183 Ga0207667_10367022 3300025949 Bacteria 1468
184 Ga0207667_10545840 3300025949 Bacteria 1173
185 Ga0207712_10046367 3300025961 Bacteria 3013
186 Ga0207668_10004393 3300025972 Bacteria 8283
187 Ga0207668_10075725 3300025972 Bacteria 2420
188 Ga0207668_10228964 3300025972 Bacteria 1497
189 Ga0207640_10770422 3300025981 Bacteria 831
190 Ga0207640_11556927 3300025981 Bacteria 595
191 Ga0207658_10000366 3300025986 Bacteria 44437
192 Ga0207658_10000370 3300025986 Bacteria 44204
193 Ga0207658_10093454 3300025986 Bacteria 2338
194 Ga0207703_10001007 3300026035 Bacteria 27061
195 Ga0207703_10266618 3300026035 Bacteria 1550
196 Ga0207639_11474034 3300026041 Bacteria 639
197 Ga0207678_10010061 3300026067 Bacteria 8299
198 Ga0207678_10336545 3300026067 Bacteria 1300
199 Ga0207678_10615654 3300026067 Bacteria 952
200 Ga0207708_11347143 3300026075 Bacteria 626
201 Ga0207702_10178882 3300026078 Bacteria 1952
202 Ga0207702_10227457 3300026078 Bacteria 1741
203 Ga0207702_10508340 3300026078 Bacteria 1175
204 Ga0207641_10000326 3300026088 Bacteria 58336
205 Ga0207641_10166092 3300026088 Bacteria 2010
206 Ga0207641_10900666 3300026088 Bacteria 878
207 Ga0207641_10986999 3300026088 Bacteria 838
208 Ga0207676_10002874 3300026095 Bacteria 12273
209 Ga0207698_10085940 3300026142 Bacteria 2556
210 Ga0207698_10248504 3300026142 Bacteria 1626
211 Ga0207698_10333318 3300026142 Bacteria 1426
212 Ga0207698_11053698 3300026142 Bacteria 825
213 Ga0207698_11447627 3300026142 Bacteria 702
214 Ga0209281_1023624 3300027111 Bacteria 1163
215 Ga0209813_10000030 3300027866 Bacteria 65385
216 Ga0209974_10028791 3300027876 Bacteria 1839
217 Ga0207428_10123504 3300027907 Bacteria 1984
218 Ga0207428_10302612 3300027907 Bacteria 1183
219 Ga0268266_10005813 3300028379 Bacteria 11418
220 Ga0268266_10073686 3300028379 Bacteria 2964
221 Ga0268266_10314732 3300028379 Bacteria 1463
222 Ga0268265_10013355 3300028380 Bacteria 5579
223 Ga0268264_10001613 3300028381 Bacteria 20842
224 Ga0268264_10045318 3300028381 Bacteria 3650
225 Ga0268264_10069356 3300028381 Bacteria 2982
226 Ga0268264_10098039 3300028381 Bacteria 2541
227 Ga0268264_10324592 3300028381 Bacteria 1457
228 Ga0268264_10361471 3300028381 Bacteria 1385
229 Ga0265327_10069403 3300031251 Bacteria 1769
230 Ga0307408_100065879 3300031548 Bacteria 2658
231 Ga0307408_100230986 3300031548 Bacteria 1515
232 Ga0307508_10006912 3300031616 Bacteria 10605
233 Ga0307405_10074921 3300031731 Bacteria 2190
234 Ga0307405_10168392 3300031731 Bacteria 1560
235 Ga0307405_10184410 3300031731 Bacteria 1501
236 Ga0307413_10001572 3300031824 Bacteria 8788
237 Ga0307410_10004427 3300031852 Bacteria 7260
238 Ga0307410_10603496 3300031852 Bacteria 916
239 Ga0307406_10062496 3300031901 Bacteria 2409
240 Ga0307406_12122803 3300031901 Bacteria 504
241 Ga0307407_10033444 3300031903 Bacteria 2805
242 Ga0307412_10037890 3300031911 Bacteria 3100
243 Ga0307409_100007562 3300031995 Bacteria 6511
244 Ga0307416_100004873 3300032002 Bacteria 8171
245 Ga0307416_101767601 3300032002 Bacteria 722
246 Ga0307414_11720285 3300032004 Bacteria 585
247 Ga0307411_10179745 3300032005 Bacteria 1604
248 Ga0307411_10545789 3300032005 Bacteria 988
249 Ga0307411_10624821 3300032005 Bacteria 929
250 Ga0307415_100010849 3300032126 Bacteria 5179
251 Ga0307415_100923945 3300032126 Bacteria 806
252 Ga0307415_101056452 3300032126 Bacteria 758
253 Ga0307415_101846838 3300032126 Bacteria 586
254 Ga0373960_0064361 3300035121 Bacteria 1119
255 Ga0373962_0018982 3300035242 Bacteria 1795
256 Ga0373931_0261272 3300035691 Bacteria 1056
257 Ga0451791_1095618 3300041451 Bacteria 530
258 Ga0451791_1716803 3300041451 Bacteria 676
259 Ga0451802_2036591 3300041460 Bacteria 679
260 Ga0451847_0926299 3300041503 Bacteria 798
261 Ga0451851_1223778 3300041507 Bacteria 547
262 Ga0451843_1638888 3300041509 Bacteria 597
263 Ga0451577_0220607 3300042876 Bacteria 1714
264 Ga0453683_0483567 3300044673 Bacteria 803
265 Ga0453684_0146206 3300044712 Bacteria 2815
266 Ga0453684_1439395 3300044712 Bacteria 713
267 Ga0495638_0049873 3300046460 Bacteria 2616
268 Ga0495596_0001164 3300046500 Bacteria 15422
269 Ga0495610_0293170 3300046512 Bacteria 630
270 Ga0495631_0220789 3300046518 Bacteria 809
271 Ga0495643_0054026 3300046522 Bacteria 2152
272 Ga0495654_0167230 3300046530 Bacteria 961
273 Ga0495625_0076435 3300046660 Bacteria 2341
274 Ga0495687_197493 3300047443 Bacteria 642
275 Ga0495626_0001087 3300048091 Bacteria 23122
276 Ga0496100_0070809 3300048903 Bacteria 2326
277 Ga0496101_0078874 3300048904 Bacteria 2430
278 Ga0496102_0000510 3300048905 Bacteria 42494
279 Ga0496102_0631211 3300048905 Bacteria 994
280 Ga0496103_0000487 3300048906 Bacteria 32998
281 Ga0496104_0000095 3300048907 Bacteria 86844
282 Ga0496104_0022609 3300048907 Bacteria 5774
283 Ga0496104_0078567 3300048907 Bacteria 3145
284 Ga0496105_0002387 3300048908 Bacteria 13605
285 Ga0496105_0183311 3300048908 Bacteria 1713
286 Ga0496105_0648808 3300048908 Bacteria 815
287 Ga0496106_0031848 3300048909 Bacteria 3929
288 Ga0496107_0000564 3300048910 Bacteria 20716
289 Ga0496107_0095595 3300048910 Bacteria 2174
290 Ga0496108_0484768 3300048911 Bacteria 1080
291 Ga0496109_0417891 3300048912 Bacteria 1267
292 Ga0496110_0449381 3300048913 Bacteria 1174
293 Ga0496111_0011407 3300048914 Bacteria 5983
294 Ga0496111_0050701 3300048914 Bacteria 2995
295 Ga0496111_0780397 3300048914 Bacteria 692
296 Ga0496112_0270827 3300048915 Bacteria 1646
297 Ga0496113_0000228 3300048916 Bacteria 26391
298 Ga0496113_1201164 3300048916 Bacteria 592
299 Ga0496114_0044300 3300048917 Bacteria 3691
300 Ga0496117_0002509 3300048920 Bacteria 23017
301 Ga0496118_0004102 3300048921 Bacteria 17648
302 Ga0496119_0005889 3300048922 Bacteria 11565
303 Ga0496120_0004560 3300048923 Bacteria 11546
304 Ga0496121_0000022 3300048924 Bacteria 472849
305 Ga0496121_0000243 3300048924 Bacteria 116698
306 Ga0496121_0004944 3300048924 Bacteria 17487
307 Ga0496121_0012020 3300048924 Bacteria 9512
308 Ga0496121_0333249 3300048924 Bacteria 1017
309 Ga0496122_0003405 3300048925 Bacteria 20924
310 Ga0496123_0002568 3300048926 Bacteria 22101
311 Ga0496123_0004517 3300048926 Bacteria 14544
312 Ga0496124_0002639 3300048927 Bacteria 23062
313 Ga0496124_0070521 3300048927 Bacteria 2898
314 Ga0496124_0453341 3300048927 Bacteria 874
315 Ga0496124_0520599 3300048927 Bacteria 792
316 Ga0496125_0016558 3300048928 Bacteria 7072
317 Ga0496125_0265654 3300048928 Bacteria 1072
318 Ga0496126_0000903 3300048929 Bacteria 51581
319 Ga0496126_0005423 3300048929 Bacteria 14549
320 Ga0496126_0016005 3300048929 Bacteria 7519
321 Ga0496126_0029763 3300048929 Bacteria 5184
322 Ga0496126_0756200 3300048929 Bacteria 750
323 Ga0501224_012497 3300049664 Bacteria 1251
324 Ga0501249_037548 3300049679 Bacteria 1093
325 Ga0501253_148991 3300049683 Bacteria 589
326 Ga0501044_0835928 3300049823 Bacteria 798
327 nmdc:mga03683_129_c1 3300050489 Bacteria 25227
328 nmdc:mga03683_17_c1 3300050489 Bacteria 91111
329 nmdc:mga03n38_11369_c1 3300050490 Bacteria 3314
330 nmdc:mga03n38_14999_c1 3300050490 Bacteria 2985
331 nmdc:mga00v17_15744_c1 3300050491 Bacteria 4251
332 nmdc:mga00v17_21437_c1 3300050491 Bacteria 3714
333 nmdc:mga00v17_2484_c1 3300050491 Bacteria 9425
334 nmdc:mga00v17_389305_c1 3300050491 Bacteria 906
335 nmdc:mga0yw44_50239_c1 3300050492 Bacteria 2206
336 nmdc:mga0k408_103759_c1 3300050493 Bacteria 1677
337 nmdc:mga0k408_12_c1 3300050493 Bacteria 125427
338 nmdc:mga0k408_148766_c1 3300050493 Bacteria 1394
339 nmdc:mga0k408_173413_c1 3300050493 Bacteria 1286
340 nmdc:mga0k408_296578_c1 3300050493 Bacteria 965
341 nmdc:mga0k408_54305_c1 3300050493 Bacteria 2322
342 nmdc:mga06z11_122_c1 3300050494 Bacteria 32025
343 nmdc:mga06z11_76152_c1 3300050494 Bacteria 1788
344 nmdc:mga04h51_231_c1 3300050495 Bacteria 14772
345 nmdc:mga07m45_103199_c1 3300050496 Bacteria 1638
346 nmdc:mga07m45_1104_c1 3300050496 Bacteria 12054
347 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
348 nmdc:mga07m45_32_c1 3300050496 Bacteria 78063
349 nmdc:mga07m45_43258_c1 3300050496 Bacteria 2525
350 nmdc:mga07m45_4934_c1 3300050496 Bacteria 6574
351 nmdc:mga05p37_358728_c1 3300050507 Bacteria 1714
352 nmdc:mga08y16_258387_c1 3300050511 Bacteria 1799
353 nmdc:mga0sz30_1089_c1 3300050516 Bacteria 9764
354 nmdc:mga0sz30_4583_c1 3300050516 Bacteria 5007
355 nmdc:mga0sz30_6357_c1 3300050516 Bacteria 3144
356 Ga0500643_037377 3300053087 Bacteria 1446
357 Ga0500566_0167697 3300053094 Bacteria 1138
358 Ga0500641_0043589 3300053096 Bacteria 1822
359 Ga0500555_167993 3300053103 Bacteria 533
360 Ga0500562_030083 3300053108 Bacteria 1430
361 Ga0500572_280558 3300053111 Bacteria 539
362 Ga0500594_0021424 3300053118 Bacteria 1621
363 Ga0500595_069077 3300053119 Bacteria 1051
364 Ga0500607_000007 3300053121 Bacteria 134097
365 Ga0500607_002827 3300053121 Bacteria 13432
366 Ga0500608_000042 3300053122 Bacteria 56626
367 Ga0500608_079112 3300053122 Bacteria 1554
368 Ga0500614_011267 3300053123 Bacteria 1933
369 Ga0500559_0001214 3300053136 Bacteria 15283
370 Ga0500559_0036242 3300053136 Bacteria 2132
371 Ga0500559_0036593 3300053136 Bacteria 2124
372 Ga0500564_035075 3300053138 Bacteria 2315
373 Ga0500573_0048517 3300053140 Bacteria 2444
374 Ga0500590_012959 3300053148 Bacteria 4269
375 Ga0500590_087603 3300053148 Bacteria 1517
376 Ga0500604_0047703 3300053151 Bacteria 1314
377 Ga0500616_0003561 3300053153 Bacteria 11799
378 Ga0500622_0000167 3300053156 Bacteria 70349
379 Ga0500637_0015618 3300053178 Bacteria 4029
380 Ga0500567_005388 3300053723 Bacteria 5901
381 Ga0500625_000001 3300053729 Bacteria 395993
382 Ga0500645_004049 3300053730 Bacteria 5749
383 Ga0500645_013291 3300053730 Bacteria 2645
384 2738712323 2738541275 Bacteria 4830863
385 2738850748 2738541301 Bacteria 4834102
386 2738866477 2738541304 Bacteria 4833665
387 2739298995 2738543022 Bacteria 4835059
388 2739360673 2738543033 Bacteria 4833336
389 2739649025 2739367664 Bacteria 4114334
390 2740027498 2739367865 Bacteria 4114482
391 2848297648 2848297114 Bacteria 3608511
392 2896186712 2896184354 Bacteria 3258548
393 2928103350 2928100450 Bacteria 4837635
394 2928962568 2928959182 Bacteria 4725774
395 3000866686 3000865235 Bacteria 3106258
396 Ga0265331_10062871
397 SwRhRL2b_contig_976014
398 JGI24034J26672_10001945
399 JGI24751J29686_10000243
400 Ga0065704_10072046
401 Ga0065704_10091004
402 Ga0065704_10107013
403 Ga0065704_10156035
404 Ga0065707_10652200
405 Ga0070658_10001006
406 Ga0070658_10021829
407 Ga0070658_10076287
408 Ga0070658_10201060
409 Ga0070658_11519601
410 Ga0070676_10878947
411 Ga0070683_100751916
412 Ga0070670_100134957
413 Ga0070670_100412284
414 Ga0070670_101925118
415 Ga0070666_10017243
416 Ga0070680_100873040
417 Ga0070660_100131725
418 Ga0070689_101187130
419 Ga0070661_100192921
420 Ga0070692_10696350
421 Ga0070668_100016329
422 Ga0070668_100050218
423 Ga0070668_100128381
424 Ga0070669_100000302
425 Ga0070669_100000394
426 Ga0070669_101915767
427 Ga0070675_101967486
428 Ga0070671_100000089
429 Ga0070671_100024528
430 Ga0070671_100062385
431 Ga0070671_100311042
432 Ga0070659_100005678
433 Ga0070667_100000079
434 Ga0070667_100000984
435 Ga0070667_100174421
436 Ga0070667_101801944
437 Ga0070700_101389494
438 Ga0070708_100332764
439 Ga0070663_100031685
440 Ga0070663_100323052
441 Ga0070663_101815746
442 Ga0070662_100010690
443 Ga0070681_10910674
444 Ga0070707_100233305
445 Ga0070707_102036444
446 Ga0070679_100192467
447 Ga0070679_100213748
448 Ga0070679_100674079
449 Ga0068853_101394973
450 Ga0070686_100049772
451 Ga0070665_100008802
452 Ga0070665_100180066
453 Ga0070665_100361958
454 Ga0068855_100147446
455 Ga0068855_100204408
456 Ga0068855_100416302
457 Ga0068855_100657591
458 Ga0070664_100027744
459 Ga0068857_101622745
460 Ga0068854_100005555
461 Ga0068854_100403338
462 Ga0068854_101836612
463 Ga0068856_100119059
464 Ga0068856_100739711
465 Ga0068852_101085233
466 Ga0068859_100373053
467 Ga0068859_100514941
468 Ga0068859_102576311
469 Ga0068864_100002064
470 Ga0068864_100327324
471 Ga0068851_10916259
472 Ga0068863_100000005
473 Ga0068863_100102087
474 Ga0068863_100118549
475 Ga0068863_100370952
476 Ga0068863_101873854
477 Ga0068858_100030484
478 Ga0068858_100692195
479 Ga0068860_100025775
480 Ga0068860_100030371
481 Ga0068860_100073655
482 Ga0068860_100245375
483 Ga0068860_100912621
484 Ga0068860_101849534
485 Ga0068862_100091459
486 Ga0075368_10000929
487 Ga0075363_100002101
488 Ga0075363_100101503
489 Ga0075364_10139110
490 Ga0075364_10163764
491 Ga0075364_10692706
492 Ga0075432_10001396
493 Ga0075362_10000961
494 Ga0075362_10002646
495 Ga0075367_10035552
496 Ga0075369_10019862
497 Ga0075369_10023073
498 Ga0075369_10238804
499 Ga0075366_10000629
500 Ga0075366_10112425
501 Ga0075366_10166035
502 Ga0075366_10171948
503 Ga0075366_10236884
504 Ga0075366_10309621
505 Ga0075370_10000016
506 Ga0075370_10002694
507 Ga0075370_10003280
508 Ga0075370_10149756
509 Ga0075370_10440433
510 Ga0075370_10673149
511 Ga0097620_100373042
512 Ga0097620_100514950
513 Ga0097620_102576114
514 Ga0079104_1018521
515 Ga0079104_1019107
516 Ga0079104_1059200
517 Ga0075435_100471553
518 Ga0105251_10073090
519 Ga0105250_10321833
520 Ga0105240_10020470
521 Ga0105240_10177416
522 Ga0111539_10131403
523 Ga0105247_10210851
524 Ga0105241_11325903
525 Ga0105241_12437278
526 Ga0105248_10009115
527 Ga0105248_10019327
528 Ga0105248_10049232
529 Ga0105248_10213048
530 Ga0105248_10246032
531 Ga0105248_10309691
532 Ga0105248_11351125
533 Ga0105237_10748393
534 Ga0105238_10479956
535 Ga0105249_10079055
536 Ga0157371_11261741
537 Ga0157370_10402540
538 Ga0163162_10013344
539 Ga0163162_10014793
540 Ga0163162_10112533
541 Ga0157379_10513329
542 Ga0163161_10660399
543 Ga0207697_10081813
544 Ga0207696_1001159
545 Ga0207647_10112902
546 Ga0207645_10744846
547 Ga0207705_10000009
548 Ga0207705_10001354
549 Ga0207705_10011717
550 Ga0207705_10156805
551 Ga0207654_11332262
552 Ga0207695_10011666
553 Ga0207660_10883029
554 Ga0207657_10030844
555 Ga0207657_10053497
556 Ga0207649_10440586
557 Ga0207652_10015706
558 Ga0207652_10168485
559 Ga0207652_10198312
560 Ga0207646_11479333
561 Ga0207681_10000164
562 Ga0207681_10001084
563 Ga0207650_10368138
564 Ga0207659_11877035
565 Ga0207644_10000005
566 Ga0207644_10003445
567 Ga0207644_10024933
568 Ga0207644_10087390
569 Ga0207690_10276780
570 Ga0207706_10005923
571 Ga0207711_10002690
572 Ga0207711_10226376
573 Ga0207711_10308896
574 Ga0207711_10511375
575 Ga0207711_10898679
576 Ga0207667_10051660
577 Ga0207667_10098225
578 Ga0207667_10367022
579 Ga0207667_10545840
580 Ga0207712_10046367
581 Ga0207668_10004393
582 Ga0207668_10075725
583 Ga0207668_10228964
584 Ga0207640_10770422
585 Ga0207640_11556927
586 Ga0207658_10000366
587 Ga0207658_10000370
588 Ga0207658_10093454
589 Ga0207703_10001007
590 Ga0207703_10266618
591 Ga0207639_11474034
592 Ga0207678_10010061
593 Ga0207678_10336545
594 Ga0207678_10615654
595 Ga0207708_11347143
596 Ga0207702_10178882
597 Ga0207702_10227457
598 Ga0207702_10508340
599 Ga0207641_10000326
600 Ga0207641_10166092
601 Ga0207641_10900666
602 Ga0207641_10986999
603 Ga0207676_10002874
604 Ga0207698_10085940
605 Ga0207698_10248504
606 Ga0207698_10333318
607 Ga0207698_11053698
608 Ga0207698_11447627
609 Ga0209281_1023624
610 Ga0209813_10000030
611 Ga0209974_10028791
612 Ga0207428_10123504
613 Ga0207428_10302612
614 Ga0268266_10005813
615 Ga0268266_10073686
616 Ga0268266_10314732
617 Ga0268265_10013355
618 Ga0268264_10001613
619 Ga0268264_10045318
620 Ga0268264_10069356
621 Ga0268264_10098039
622 Ga0268264_10324592
623 Ga0268264_10361471
624 Ga0265327_10069403
625 Ga0307408_100065879
626 Ga0307408_100230986
627 Ga0307508_10006912
628 Ga0307405_10074921
629 Ga0307405_10168392
630 Ga0307405_10184410
631 Ga0307413_10001572
632 Ga0307410_10004427
633 Ga0307410_10603496
634 Ga0307406_10062496
635 Ga0307406_12122803
636 Ga0307407_10033444
637 Ga0307412_10037890
638 Ga0307409_100007562
639 Ga0307416_100004873
640 Ga0307416_101767601
641 Ga0307414_11720285
642 Ga0307411_10179745
643 Ga0307411_10545789
644 Ga0307411_10624821
645 Ga0307415_100010849
646 Ga0307415_100923945
647 Ga0307415_101056452
648 Ga0307415_101846838
649 Ga0373960_0064361
650 Ga0373962_0018982
651 Ga0373931_0261272
652 Ga0451791_1095618
653 Ga0451791_1716803
654 Ga0451802_2036591
655 Ga0451847_0926299
656 Ga0451851_1223778
657 Ga0451843_1638888
658 Ga0451577_0220607
659 Ga0453683_0483567
660 Ga0453684_0146206
661 Ga0453684_1439395
662 Ga0495638_0049873
663 Ga0495596_0001164
664 Ga0495610_0293170
665 Ga0495631_0220789
666 Ga0495643_0054026
667 Ga0495654_0167230
668 Ga0495625_0076435
669 Ga0495687_197493
670 Ga0495626_0001087
671 Ga0496100_0070809
672 Ga0496101_0078874
673 Ga0496102_0000510
674 Ga0496102_0631211
675 Ga0496103_0000487
676 Ga0496104_0000095
677 Ga0496104_0022609
678 Ga0496104_0078567
679 Ga0496105_0002387
680 Ga0496105_0183311
681 Ga0496105_0648808
682 Ga0496106_0031848
683 Ga0496107_0000564
684 Ga0496107_0095595
685 Ga0496108_0484768
686 Ga0496109_0417891
687 Ga0496110_0449381
688 Ga0496111_0011407
689 Ga0496111_0050701
690 Ga0496111_0780397
691 Ga0496112_0270827
692 Ga0496113_0000228
693 Ga0496113_1201164
694 Ga0496114_0044300
695 Ga0496117_0002509
696 Ga0496118_0004102
697 Ga0496119_0005889
698 Ga0496120_0004560
699 Ga0496121_0000022
700 Ga0496121_0000243
701 Ga0496121_0004944
702 Ga0496121_0012020
703 Ga0496121_0333249
704 Ga0496122_0003405
705 Ga0496123_0002568
706 Ga0496123_0004517
707 Ga0496124_0002639
708 Ga0496124_0070521
709 Ga0496124_0453341
710 Ga0496124_0520599
711 Ga0496125_0016558
712 Ga0496125_0265654
713 Ga0496126_0000903
714 Ga0496126_0005423
715 Ga0496126_0016005
716 Ga0496126_0029763
717 Ga0496126_0756200
718 Ga0501224_012497
719 Ga0501249_037548
720 Ga0501253_148991
721 Ga0501044_0835928
722 nmdc:mga03683_129_c1
723 nmdc:mga03683_17_c1
724 nmdc:mga03n38_11369_c1
725 nmdc:mga03n38_14999_c1
726 nmdc:mga00v17_15744_c1
727 nmdc:mga00v17_21437_c1
728 nmdc:mga00v17_2484_c1
729 nmdc:mga00v17_389305_c1
730 nmdc:mga0yw44_50239_c1
731 nmdc:mga0k408_103759_c1
732 nmdc:mga0k408_12_c1
733 nmdc:mga0k408_148766_c1
734 nmdc:mga0k408_173413_c1
735 nmdc:mga0k408_296578_c1
736 nmdc:mga0k408_54305_c1
737 nmdc:mga06z11_122_c1
738 nmdc:mga06z11_76152_c1
739 nmdc:mga04h51_231_c1
740 nmdc:mga07m45_103199_c1
741 nmdc:mga07m45_1104_c1
742 nmdc:mga07m45_11_c1
743 nmdc:mga07m45_32_c1
744 nmdc:mga07m45_43258_c1
745 nmdc:mga07m45_4934_c1
746 nmdc:mga05p37_358728_c1
747 nmdc:mga08y16_258387_c1
748 nmdc:mga0sz30_1089_c1
749 nmdc:mga0sz30_4583_c1
750 nmdc:mga0sz30_6357_c1
751 Ga0500643_037377
752 Ga0500566_0167697
753 Ga0500641_0043589
754 Ga0500555_167993
755 Ga0500562_030083
756 Ga0500572_280558
757 Ga0500594_0021424
758 Ga0500595_069077
759 Ga0500607_000007
760 Ga0500607_002827
761 Ga0500608_000042
762 Ga0500608_079112
763 Ga0500614_011267
764 Ga0500559_0001214
765 Ga0500559_0036242
766 Ga0500559_0036593
767 Ga0500564_035075
768 Ga0500573_0048517
769 Ga0500590_012959
770 Ga0500590_087603
771 Ga0500604_0047703
772 Ga0500616_0003561
773 Ga0500622_0000167
774 Ga0500637_0015618
775 Ga0500567_005388
776 Ga0500625_000001
777 Ga0500645_004049
778 Ga0500645_013291
779 2738712323
780 2738850748
781 2738866477
782 2739298995
783 2739360673
784 2739649025
785 2740027498
786 2848297648
787 2896186712
788 2928103350
789 2928962568
790 3000866686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11730

DUF3297

Protein of unknown function (DUF3297)

35

105

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f8u-assembly1.cif.gz_A bifunctional ligase/repressor bira from klebsiella pneumoniae (domain swapped dimer) 0.5134 41 96
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.501 48 88
2d6f-assembly1.cif.gz_B crystal structure of glu-trna(gln) amidotransferase in the complex with trna(gln) 0.4959 43 102
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.4958 41 93
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.4917 40 93
ID Description Score Start End Superfamily
af_Q9VKD9_641_739_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.5434 43 96 2.40.128.20
af_P11875_109_453_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5293 66 87 3.40.50.620
2x4jA01 Mainly Beta;Roll;SH3 type barrels.; 0.5168 44 96 2.30.30.600
af_I1K9W9_40_323_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5104 67 96 3.40.390.10
2d6fB01 Mainly Beta;Roll;SH3 type barrels.; 0.4959 43 102 2.30.30.520
ID Description Score Start End GO Terms
AF-A0A4Q3SLM9-F1-model_v4 DUF3297 family protein 0.9365 20 74
AF-A0A4Q3SLM9-F1-model_v4 DUF3297 family protein 0.905 20 74
AF-A0A3C0JBD0-F1-model_v4 DUF3297 domain-containing protein 0.8999 21 70
AF-A0A3C0JBD0-F1-model_v4 DUF3297 domain-containing protein 0.8839 21 70
AF-A0A564G304-F1-model_v4 Glutathione peroxidase 0.8128 22 98

Map