F433235

General Info

Members Datasets Scaffolds Average Seq Length
395 240 369 648

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10045275|Ga0207689_100452751
Length 758
Sequence MSAQLRSGAGRSAGRSALAFNPRVPGSIPGRPTQVKDLLATQIELGVVLFMVRTVSPCVHGPFDVCPTRPRSHRDCGLRGLLGFASHGNSNDSSFPSRQSHLAFLVLECLGMSGSPQTFPQLLLLHAKERPDAVAMREKQFGIWQALSWSALLSMVRALAAGLAAAGLSRGQHIVVIGANRPRLYASMLAAQSVGAIPVPLYQDAAAAELVFPISNAEVGFAIVEDQEQVDKLLEVRQRFPGLARIWYDDPRGLRSMREPGVESLDTLVKAGMARDASDPTQFDVDIGRGRGTDVAALFFTSGTTGTPKGVMHTYAALIDRSLAGARFDKITPADEVLAYLPPAWVGQNIFSYAMWLAVGYIVNCPESADTVTIDLKEIGPTYYFAPPRVFEAFLTSVTIRMEDAGRPKRWLYDRFMGLANRIGRRLIEDQPVGVVDRLLYALGDLAIYGPLRNTLGMSRVRVAYTAGEAIGPDLFSFYRSIGINLKQLYGSTETAVFVCLQPDHEVRADTVGVPIDGVELKFASTGELLLRSPGLLKGYYKNEAATAEVLDSDGWYHTGDAGFLDAGGHLKIIDRAKDVGRLANGALFAPKFIENKLKFFPYIKEAVAFGDGREKVCALVNIDYSAVGNWAEKRNLPYAGYADLASKAEVYELIRTCVNKVNADLAADERLAGSQICRYLVLHKELDADDDELTRTNKVRRGFINEKYAVLVDALYGGLEQQYVETAVKFEDGRSGVVSAHVRIADAQTFPLQKAAA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
12 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2831864461 Roseateles noduli HZ7 Isolate Nodule
23 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
26 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
27 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
200 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
201 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
227 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
228 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.73
Nodule 0.76
Rhizoplane 0.76
Rhizosphere 66.84
Stem 0
Stem Tuber 0
Unclassified 12.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000067 3300002704 Bacteria 68902
2 JGI25156J39149_1000013 3300002705 Bacteria 189553
3 JGI25154J39366_1000032 3300002738 Bacteria 189265
4 JGI25157J39369_1000017 3300002741 Bacteria 189553
5 JGI25150J39212_1004205 3300002774 Bacteria 3239
6 JGI25159J45721_1001195 3300002987 Bacteria 11063
7 JGI25159J45721_1001596 3300002987 Bacteria 9258
8 JGI25153J46596_10000543 3300003215 Bacteria 23510
9 JGI25160J50197_1000204 3300003354 Bacteria 49352
10 JGI25160J50197_1005548 3300003354 Bacteria 5235
11 JGI25161J50226_1000036 3300003374 Bacteria 133407
12 Ga0055526_1000414 3300003771 Bacteria 34422
13 Ga0055526_1001819 3300003771 Bacteria 14756
14 Ga0055526_1017354 3300003771 Bacteria 2752
15 Ga0055537_1000596 3300003773 Bacteria 20124
16 Ga0055524_1000145 3300003775 Bacteria 84202
17 Ga0055528_1000524 3300003790 Bacteria 29831
18 Ga0055540_1000237 3300003792 Bacteria 50309
19 Ga0055531_10000179 3300003794 Bacteria 72059
20 Ga0055531_10001626 3300003794 Bacteria 16291
21 Ga0055543_1001540 3300004625 Bacteria 8994
22 Ga0055543_1003568 3300004625 Bacteria 4508
23 Ga0065165_1000177 3300005262 Bacteria 113446
24 Ga0065165_1002331 3300005262 Bacteria 16569
25 Ga0065707_10084610 3300005295 Bacteria 6985
26 Ga0070676_10021699 3300005328 Bacteria 3596
27 Ga0070676_10025551 3300005328 Bacteria 3339
28 Ga0070690_100002408 3300005330 Bacteria 10049
29 Ga0070690_100009776 3300005330 Bacteria 5564
30 Ga0070670_100003550 3300005331 Bacteria 12975
31 Ga0070670_100098658 3300005331 Bacteria 2514
32 Ga0070677_10002402 3300005333 Bacteria 5970
33 Ga0068869_100009917 3300005334 Bacteria 6189
34 Ga0068869_100024281 3300005334 Bacteria 4198
35 Ga0068869_100038923 3300005334 Bacteria 3392
36 Ga0070680_100016779 3300005336 Bacteria 5763
37 Ga0068868_100003620 3300005338 Bacteria 10778
38 Ga0070660_100028021 3300005339 Bacteria 4210
39 Ga0070668_100019956 3300005347 Bacteria 5051
40 Ga0070668_100049208 3300005347 Bacteria 3243
41 Ga0070669_100013285 3300005353 Bacteria 5852
42 Ga0070675_100000649 3300005354 Bacteria 24051
43 Ga0070675_100007888 3300005354 Bacteria 8252
44 Ga0070675_100044864 3300005354 Bacteria 3616
45 Ga0070675_100060810 3300005354 Bacteria 3118
46 Ga0070671_100015689 3300005355 Bacteria 6123
47 Ga0070671_100038573 3300005355 Bacteria 3965
48 Ga0070674_100025969 3300005356 Bacteria 3820
49 Ga0070673_100005276 3300005364 Bacteria 8257
50 Ga0070667_100009044 3300005367 Bacteria 8245
51 Ga0070667_100028053 3300005367 Bacteria 4685
52 Ga0070667_100041504 3300005367 Bacteria 3860
53 Ga0070667_100077699 3300005367 Bacteria 2835
54 Ga0070700_100006774 3300005441 Bacteria 6141
55 Ga0070678_100061643 3300005456 Bacteria 2765
56 Ga0070662_100015636 3300005457 Bacteria 5087
57 Ga0070662_100022328 3300005457 Bacteria 4331
58 Ga0068867_100000120 3300005459 Bacteria 49908
59 Ga0068867_100002001 3300005459 Bacteria 14223
60 Ga0068867_100013118 3300005459 Bacteria 5867
61 Ga0068867_100018336 3300005459 Bacteria 4975
62 Ga0068867_100030748 3300005459 Bacteria 3873
63 Ga0070706_100015349 3300005467 Bacteria 7073
64 Ga0070679_100024274 3300005530 Bacteria 5941
65 Ga0070672_100000177 3300005543 Bacteria 35110
66 Ga0070672_100016727 3300005543 Bacteria 5258
67 Ga0070672_100054988 3300005543 Bacteria 3117
68 Ga0070672_100066164 3300005543 Bacteria 2861
69 Ga0070693_100009035 3300005547 Bacteria 4946
70 Ga0068855_100060620 3300005563 Bacteria 4424
71 Ga0070664_100032863 3300005564 Bacteria 4341
72 Ga0068856_100010428 3300005614 Bacteria 9019
73 Ga0068856_100038182 3300005614 Bacteria 4714
74 Ga0068852_100007509 3300005616 Bacteria 7959
75 Ga0068852_100012294 3300005616 Bacteria 6492
76 Ga0068859_100019319 3300005617 Bacteria 6846
77 Ga0068859_100112993 3300005617 Bacteria 2780
78 Ga0068864_100000826 3300005618 Bacteria 26103
79 Ga0068864_100043531 3300005618 Bacteria 3844
80 Ga0068866_10003793 3300005718 Bacteria 6196
81 Ga0068866_10027062 3300005718 Bacteria 2715
82 Ga0068861_100002005 3300005719 Bacteria 13174
83 Ga0068861_100015344 3300005719 Bacteria 5396
84 Ga0068861_100024005 3300005719 Bacteria 4404
85 Ga0068863_100010025 3300005841 Bacteria 9220
86 Ga0068863_100019027 3300005841 Bacteria 6572
87 Ga0068858_100005438 3300005842 Bacteria 12477
88 Ga0068858_100013940 3300005842 Bacteria 7582
89 Ga0068858_100054032 3300005842 Bacteria 3715
90 Ga0068860_100005287 3300005843 Bacteria 13101
91 Ga0068860_100033305 3300005843 Bacteria 4945
92 Ga0068860_100046327 3300005843 Bacteria 4146
93 Ga0068862_100017745 3300005844 Bacteria 5923
94 Ga0068862_100043230 3300005844 Bacteria 3841
95 Ga0075366_10000550 3300006195 Bacteria 17475
96 Ga0075366_10001062 3300006195 Bacteria 13471
97 Ga0075366_10015552 3300006195 Bacteria 4364
98 Ga0097621_100009425 3300006237 Bacteria 7083
99 Ga0097621_100077024 3300006237 Bacteria 2767
100 Ga0075370_10000148 3300006353 Bacteria 23924
101 Ga0075370_10003393 3300006353 Bacteria 7571
102 Ga0075370_10017090 3300006353 Bacteria 3915
103 Ga0075430_100053518 3300006846 Bacteria 3398
104 Ga0075431_100009272 3300006847 Bacteria 9877
105 Ga0068865_100020074 3300006881 Bacteria 4332
106 Ga0097620_100019319 3300006931 Bacteria 6846
107 Ga0097620_100112992 3300006931 Bacteria 2780
108 Ga0099823_1000139 3300006944 Bacteria 37935
109 Ga0105240_10005093 3300009093 Bacteria 19689
110 Ga0105243_10001635 3300009148 Bacteria 19469
111 Ga0105243_10010904 3300009148 Bacteria 6875
112 Ga0105243_10078331 3300009148 Bacteria 2690
113 Ga0105237_10000646 3300009545 Bacteria 48623
114 Ga0105238_10034206 3300009551 Bacteria 5172
115 Ga0105249_10011823 3300009553 Bacteria 7672
116 Ga0105249_10038368 3300009553 Bacteria 4347
117 Ga0157319_1000008 3300012497 Bacteria 315600
118 Ga0157374_10011812 3300013296 Bacteria 7574
119 Ga0163162_10002024 3300013306 Bacteria 19068
120 Ga0163162_10004836 3300013306 Bacteria 12999
121 Ga0157375_10007001 3300013308 Bacteria 9846
122 Ga0163163_10011263 3300014325 Bacteria 8105
123 Ga0157380_10052497 3300014326 Bacteria 3229
124 Ga0157377_10000044 3300014745 Bacteria 100420
125 Ga0157379_10026458 3300014968 Bacteria 5165
126 Ga0157379_10061988 3300014968 Bacteria 3345
127 Ga0157376_10039510 3300014969 Bacteria 3849
128 Ga0213872_10010926 3300021361 Bacteria 4308
129 Ga0209435_100003 3300025206 Bacteria 669534
130 Ga0207425_1000426 3300025245 Bacteria 28024
131 Ga0207425_1002116 3300025245 Bacteria 7308
132 Ga0209646_1000008 3300025246 Bacteria 669534
133 Ga0209026_1000007 3300025250 Bacteria 669534
134 Ga0209759_1000026 3300025256 Bacteria 311743
135 Ga0209129_1000269 3300025258 Bacteria 51170
136 Ga0209565_1000026 3300025263 Bacteria 365910
137 Ga0209673_1000009 3300025273 Bacteria 620735
138 Ga0209673_1002449 3300025273 Bacteria 12865
139 Ga0209130_1000109 3300025284 Bacteria 133520
140 Ga0209130_1000307 3300025284 Bacteria 58849
141 Ga0209675_1000545 3300025291 Bacteria 27501
142 Ga0209676_1000013 3300025292 Bacteria 816080
143 Ga0209025_1003154 3300025294 Bacteria 16080
144 Ga0209025_1006232 3300025294 Bacteria 9349
145 Ga0209025_1028382 3300025294 Bacteria 2744
146 Ga0209564_1000008 3300025295 Bacteria 953227
147 Ga0209564_1000243 3300025295 Bacteria 118066
148 Ga0209564_1000300 3300025295 Bacteria 98386
149 Ga0209758_1000453 3300025297 Bacteria 68482
150 Ga0209758_1000605 3300025297 Bacteria 55552
151 Ga0209050_1000008 3300025298 Bacteria 1144179
152 Ga0209050_1000770 3300025298 Bacteria 46024
153 Ga0209050_1003585 3300025298 Bacteria 11290
154 Ga0209050_1004843 3300025298 Bacteria 8836
155 Ga0209256_1000003 3300025299 Bacteria 1661127
156 Ga0209256_1000413 3300025299 Bacteria 67123
157 Ga0207426_1000062 3300025302 Bacteria 362040
158 Ga0207426_1004055 3300025302 Bacteria 7404
159 Ga0209051_1000005 3300025303 Bacteria 1142353
160 Ga0209051_1000172 3300025303 Bacteria 117180
161 Ga0209051_1000886 3300025303 Bacteria 30081
162 Ga0209051_1002126 3300025303 Bacteria 14767
163 Ga0209051_1005444 3300025303 Bacteria 7440
164 Ga0209257_1000015 3300025304 Bacteria 908141
165 Ga0209257_1000047 3300025304 Bacteria 460507
166 Ga0209257_1000048 3300025304 Bacteria 455536
167 Ga0209257_1000108 3300025304 Bacteria 240229
168 Ga0209257_1008757 3300025304 Bacteria 5630
169 Ga0209257_1009164 3300025304 Bacteria 5385
170 Ga0207682_10004449 3300025893 Bacteria 5860
171 Ga0207682_10005562 3300025893 Bacteria 5127
172 Ga0207688_10054114 3300025901 Bacteria 2251
173 Ga0207645_10019688 3300025907 Bacteria 4423
174 Ga0207684_10000714 3300025910 Bacteria 39062
175 Ga0207695_10053553 3300025913 Bacteria 4220
176 Ga0207671_10004759 3300025914 Bacteria 12812
177 Ga0207657_10035786 3300025919 Bacteria 4448
178 Ga0207652_10031247 3300025921 Bacteria 4471
179 Ga0207681_10000880 3300025923 Bacteria 19761
180 Ga0207681_10006701 3300025923 Bacteria 7067
181 Ga0207681_10008608 3300025923 Bacteria 6229
182 Ga0207681_10009640 3300025923 Bacteria 5906
183 Ga0207694_10068255 3300025924 Bacteria 2776
184 Ga0207694_10070827 3300025924 Bacteria 2724
185 Ga0207650_10001020 3300025925 Bacteria 21020
186 Ga0207650_10062358 3300025925 Bacteria 2785
187 Ga0207659_10000614 3300025926 Bacteria 21272
188 Ga0207659_10044116 3300025926 Bacteria 3136
189 Ga0207644_10008782 3300025931 Bacteria 6616
190 Ga0207706_10017792 3300025933 Bacteria 6402
191 Ga0207706_10053348 3300025933 Bacteria 3569
192 Ga0207709_10001132 3300025935 Bacteria 19467
193 Ga0207709_10012117 3300025935 Bacteria 4753
194 Ga0207709_10016227 3300025935 Bacteria 4139
195 Ga0207669_10003724 3300025937 Bacteria 6633
196 Ga0207669_10007853 3300025937 Bacteria 4968
197 Ga0207704_10023492 3300025938 Bacteria 3324
198 Ga0207691_10014392 3300025940 Bacteria 7543
199 Ga0207691_10033759 3300025940 Bacteria 4763
200 Ga0207691_10084722 3300025940 Bacteria 2845
201 Ga0207689_10032343 3300025942 Bacteria 4353
202 Ga0207689_10045275 3300025942 Bacteria 3639
203 Ga0207679_10019045 3300025945 Bacteria 4607
204 Ga0207667_10023656 3300025949 Bacteria 6762
205 Ga0207651_10000476 3300025960 Bacteria 16840
206 Ga0207712_10006165 3300025961 Bacteria 7558
207 Ga0207712_10022538 3300025961 Bacteria 4148
208 Ga0207668_10007781 3300025972 Bacteria 6374
209 Ga0207668_10017753 3300025972 Bacteria 4464
210 Ga0207658_10003937 3300025986 Bacteria 10438
211 Ga0207658_10011293 3300025986 Bacteria 6082
212 Ga0207677_10040753 3300026023 Bacteria 3065
213 Ga0207703_10002711 3300026035 Bacteria 15166
214 Ga0207703_10027100 3300026035 Bacteria 4513
215 Ga0207703_10029516 3300026035 Bacteria 4328
216 Ga0207703_10039420 3300026035 Bacteria 3776
217 Ga0207678_10072134 3300026067 Bacteria 2959
218 Ga0207641_10018924 3300026088 Bacteria 5649
219 Ga0207648_10001584 3300026089 Bacteria 24952
220 Ga0207648_10006766 3300026089 Bacteria 11366
221 Ga0207648_10008899 3300026089 Bacteria 9664
222 Ga0207648_10012940 3300026089 Bacteria 7792
223 Ga0207648_10018624 3300026089 Bacteria 6281
224 Ga0207648_10020197 3300026089 Bacteria 6003
225 Ga0207648_10032076 3300026089 Bacteria 4642
226 Ga0207676_10000855 3300026095 Bacteria 23661
227 Ga0207676_10072399 3300026095 Bacteria 2770
228 Ga0207676_10073531 3300026095 Bacteria 2751
229 Ga0207675_100014229 3300026118 Bacteria 7417
230 Ga0207675_100059739 3300026118 Bacteria 3558
231 Ga0207683_10022060 3300026121 Bacteria 5464
232 Ga0207683_10027022 3300026121 Bacteria 4959
233 Ga0207683_10046373 3300026121 Bacteria 3803
234 Ga0207683_10134853 3300026121 Bacteria 2222
235 Ga0207698_10005200 3300026142 Bacteria 8002
236 Ga0209973_1000497 3300027252 Bacteria 2996
237 Ga0209389_1002532 3300027296 Bacteria 14118
238 Ga0209968_1000860 3300027526 Bacteria 4709
239 Ga0209999_1004770 3300027543 Bacteria 2437
240 Ga0209971_1004560 3300027682 Bacteria 3288
241 Ga0209966_1000017 3300027695 Bacteria 71183
242 Ga0268265_10034688 3300028380 Bacteria 3680
243 Ga0268265_10035205 3300028380 Bacteria 3656
244 Ga0268264_10016600 3300028381 Bacteria 6029
245 Ga0268264_10016771 3300028381 Bacteria 5994
246 Ga0307515_10000048 3300028794 Bacteria 288111
247 Ga0307515_10000281 3300028794 Bacteria 125306
248 Ga0307515_10000553 3300028794 Bacteria 88277
249 Ga0307515_10003339 3300028794 Bacteria 33908
250 Ga0307515_10028096 3300028794 Bacteria 9575
251 Ga0307515_10029571 3300028794 Bacteria 9251
252 Ga0307515_10054215 3300028794 Bacteria 5892
253 Ga0268256_1007512 3300030500 Bacteria 3869
254 Ga0265330_10000043 3300031235 Bacteria 116829
255 Ga0265332_10000018 3300031238 Bacteria 224913
256 Ga0265332_10000022 3300031238 Bacteria 213072
257 Ga0265325_10008692 3300031241 Bacteria 5975
258 Ga0265340_10021575 3300031247 Bacteria 3303
259 Ga0265340_10028838 3300031247 Bacteria 2789
260 Ga0265340_10041795 3300031247 Bacteria 2253
261 Ga0307513_10000034 3300031456 Bacteria 185012
262 Ga0307513_10000057 3300031456 Bacteria 146564
263 Ga0307509_10000249 3300031507 Bacteria 87094
264 Ga0307509_10004869 3300031507 Bacteria 19042
265 Ga0307509_10112969 3300031507 Bacteria 2715
266 Ga0307408_100000029 3300031548 Bacteria 227806
267 Ga0307408_100000107 3300031548 Bacteria 91378
268 Ga0307408_100010302 3300031548 Bacteria 6165
269 Ga0307408_100018676 3300031548 Bacteria 4659
270 Ga0307408_100043821 3300031548 Bacteria 3185
271 Ga0307508_10000143 3300031616 Bacteria 85046
272 Ga0307508_10001407 3300031616 Bacteria 27099
273 Ga0307514_10001712 3300031649 Bacteria 25190
274 Ga0307514_10002586 3300031649 Bacteria 18542
275 Ga0307514_10038392 3300031649 Bacteria 3787
276 Ga0265314_10000126 3300031711 Bacteria 116852
277 Ga0307516_10000236 3300031730 Bacteria 71013
278 Ga0307516_10005342 3300031730 Bacteria 15442
279 Ga0307516_10056503 3300031730 Bacteria 3827
280 Ga0307516_10092301 3300031730 Bacteria 2855
281 Ga0307410_10001858 3300031852 Bacteria 9850
282 Ga0307406_10000702 3300031901 Bacteria 18902
283 Ga0307407_10003615 3300031903 Bacteria 6394
284 Ga0307409_100010064 3300031995 Bacteria 5851
285 Ga0307416_100000552 3300032002 Bacteria 19089
286 Ga0307414_10017518 3300032004 Bacteria 4386
287 Ga0307411_10000631 3300032005 Bacteria 12755
288 Ga0307411_10002483 3300032005 Bacteria 8182
289 Ga0307415_100009374 3300032126 Bacteria 5482
290 Ga0307510_10116566 3300033180 Bacteria 2391
291 Ga0373940_0001422 3300035088 Bacteria 4322
292 Ga0373939_0000114 3300035114 Bacteria 24291
293 Ga0373960_0000259 3300035121 Bacteria 10016
294 Ga0373943_0013213 3300035170 Bacteria 3726
295 Ga0373931_0006842 3300035691 Bacteria 5362
296 Ga0373925_0003753 3300037068 Bacteria 11671
297 Ga0395899_0001161 3300037312 Bacteria 23282
298 Ga0395899_0059429 3300037312 Bacteria 2818
299 Ga0395900_0001471 3300037418 Bacteria 28105
300 Ga0395900_0008457 3300037418 Bacteria 10582
301 Ga0395900_0009117 3300037418 Bacteria 10161
302 Ga0395898_0007931 3300037466 Bacteria 11263
303 Ga0395898_0009390 3300037466 Bacteria 10273
304 Ga0395898_0022283 3300037466 Bacteria 6416
305 Ga0395905_0000090 3300037471 Bacteria 152117
306 Ga0395905_0000609 3300037471 Bacteria 47951
307 Ga0395905_0003315 3300037471 Bacteria 17279
308 Ga0395905_0006895 3300037471 Bacteria 11356
309 Ga0395905_0015893 3300037471 Bacteria 7150
310 Ga0395905_0049559 3300037471 Bacteria 3936
311 Ga0395901_0003849 3300038443 Bacteria 15110
312 Ga0395901_0064483 3300038443 Bacteria 3813
313 Ga0395901_0113811 3300038443 Bacteria 2841
314 Ga0436361_0367431 3300039447 Bacteria 49926
315 Ga0439450_003517 3300042008 Bacteria 2595
316 Ga0450891_000105 3300042129 Bacteria 7309
317 Ga0450892_000161 3300042130 Bacteria 7743
318 Ga0450918_000542 3300042531 Bacteria 8099
319 Ga0451577_0001888 3300042876 Bacteria 26618
320 Ga0451577_0010658 3300042876 Bacteria 8755
321 Ga0466969_0000046 3300044656 Bacteria 63999
322 Ga0466972_0024239 3300044658 Bacteria 3011
323 Ga0466972_0028576 3300044658 Bacteria 2750
324 Ga0453683_0000780 3300044673 Bacteria 31494
325 Ga0466965_0018832 3300044683 Bacteria 3312
326 Ga0453684_0000868 3300044712 Bacteria 101512
327 Ga0453684_0011876 3300044712 Bacteria 14501
328 Ga0453684_0020608 3300044712 Bacteria 9928
329 Ga0453684_0031663 3300044712 Bacteria 7425
330 Ga0466970_0063204 3300044765 Bacteria 1985
331 Ga0466957_0032677 3300044842 Bacteria 3117
332 Ga0451576_0003368 3300045051 Bacteria 22124
333 Ga0451576_0010795 3300045051 Bacteria 10454
334 Ga0451576_0029695 3300045051 Bacteria 5849
335 Ga0495592_0000266 3300046454 Bacteria 44803
336 Ga0495590_0018722 3300046457 Bacteria 2478
337 Ga0495632_0002610 3300046519 Bacteria 13576
338 Ga0495632_0020412 3300046519 Bacteria 3587
339 Ga0495597_0013961 3300046542 Bacteria 3837
340 Ga0495649_0000401 3300046694 Bacteria 37516
341 Ga0495687_000174 3300047443 Bacteria 95031
342 Ga0495687_017403 3300047443 Bacteria 3588
343 Ga0495686_0005097 3300047472 Bacteria 10506
344 Ga0496104_0055414 3300048907 Bacteria 3749
345 Ga0496110_0062629 3300048913 Bacteria 3286
346 Ga0496114_0113378 3300048917 Bacteria 2324
347 Ga0496124_0023272 3300048927 Bacteria 5659
348 Ga0501043_0000002 3300049579 Bacteria 351081
349 Ga0501046_0000008 3300049580 Bacteria 351167
350 Ga0501047_0000003 3300049581 Bacteria 508375
351 Ga0501047_0029371 3300049581 Bacteria 5302
352 Ga0501048_0001290 3300049582 Bacteria 19011
353 Ga0501211_000243 3300049658 Bacteria 4807
354 Ga0501221_000125 3300049704 Bacteria 9718
355 Ga0501229_000045 3300049706 Bacteria 12123
356 Ga0501044_0062626 3300049823 Bacteria 3802
357 nmdc:mga0k408_1384_c1 3300050493 Bacteria 13090
358 nmdc:mga07m45_2245_c1 3300050496 Bacteria 9018
359 nmdc:mga07m45_27312_c1 3300050496 Bacteria 3143
360 nmdc:mga0qj67_35197_c1 3300050509 Bacteria 3914
361 nmdc:mga06r32_23797_c1 3300050510 Bacteria 5674
362 Ga0500578_0000025 3300053086 Bacteria 151485
363 Ga0500641_0008913 3300053096 Bacteria 3595
364 Ga0500593_000858 3300053117 Bacteria 11326
365 Ga0500642_0006143 3300053130 Bacteria 3933
366 Ga0500652_000177 3300053131 Bacteria 24784
367 Ga0500622_0000890 3300053156 Bacteria 25460
368 Ga0500622_0007713 3300053156 Bacteria 6078
369 Ga0500645_001045 3300053730 Bacteria 15414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0113811 Ga0395901_0113811_1089_2816 575
2 3300025901 Ga0207688_10054114 Ga0207688_100541142 588
3 3300031548 Ga0307408_100018676 Ga0307408_1000186764 615
4 3300006846 Ga0075430_100053518 Ga0075430_1000535183 620
5 3300050509 nmdc:mga0qj67_35197_c1 nmdc:mga0qj67_35197_c1_717_2633 620
6 3300050510 nmdc:mga06r32_23797_c1 nmdc:mga06r32_23797_c1_2404_4320 620
7 3300003794 Ga0055531_10000179 Ga0055531_1000017948 621
8 3300005354 Ga0070675_100060810 Ga0070675_1000608102 621
9 3300025303 Ga0209051_1002126 Ga0209051_10021264 621
10 3300025304 Ga0209257_1000047 Ga0209257_1000047102 621
11 3300005328 Ga0070676_10025551 Ga0070676_100255512 627
12 3300005331 Ga0070670_100003550 Ga0070670_10000355012 627
13 3300005354 Ga0070675_100000649 Ga0070675_1000006494 627
14 3300005355 Ga0070671_100038573 Ga0070671_1000385732 627
15 3300005364 Ga0070673_100005276 Ga0070673_1000052761 627
16 3300005367 Ga0070667_100077699 Ga0070667_1000776992 627
17 3300005459 Ga0068867_100002001 Ga0068867_1000020014 627
18 3300028794 Ga0307515_10000553 Ga0307515_100005535 627
19 3300031649 Ga0307514_10002586 Ga0307514_1000258612 627
20 3300038443 Ga0395901_0003849 Ga0395901_0003849_5478_7361 627
21 3300050496 nmdc:mga07m45_27312_c1 nmdc:mga07m45_27312_c1_917_2839 628
22 3300006847 Ga0075431_100009272 Ga0075431_1000092729 635
23 3300031548 Ga0307408_100043821 Ga0307408_1000438213 635
24 3300005459 Ga0068867_100000120 Ga0068867_10000012053 636
25 3300009148 Ga0105243_10001635 Ga0105243_1000163518 636
26 3300014745 Ga0157377_10000044 Ga0157377_1000004474 636
27 3300025935 Ga0207709_10001132 Ga0207709_1000113218 636
28 3300026089 Ga0207648_10001584 Ga0207648_100015843 636
29 3300005614 Ga0068856_100010428 Ga0068856_1000104283 639
30 3300031247 Ga0265340_10021575 Ga0265340_100215751 639
31 3300037312 Ga0395899_0059429 Ga0395899_0059429_603_2543 639
32 3300042876 Ga0451577_0001888 Ga0451577_0001888_20869_22791 639
33 3300006195 Ga0075366_10000550 Ga0075366_100005509 640
34 3300006195 Ga0075366_10001062 Ga0075366_1000106211 640
35 3300006353 Ga0075370_10000148 Ga0075370_100001485 640
36 3300006353 Ga0075370_10003393 Ga0075370_100033937 640
37 3300014968 Ga0157379_10061988 Ga0157379_100619882 640
38 3300031730 Ga0307516_10000236 Ga0307516_1000023655 640
39 3300037068 Ga0373925_0003753 Ga0373925_0003753_4345_6267 640
40 3300037471 Ga0395905_0006895 Ga0395905_0006895_5300_7267 640
41 3300042129 Ga0450891_000105 Ga0450891_000105_1510_3432 640
42 3300042130 Ga0450892_000161 Ga0450892_000161_383_2305 640
43 3300044712 Ga0453684_0011876 Ga0453684_0011876_12234_14156 640
44 3300046457 Ga0495590_0018722 Ga0495590_0018722_320_2242 640
45 3300046519 Ga0495632_0002610 Ga0495632_0002610_8953_10875 640
46 3300046519 Ga0495632_0020412 Ga0495632_0020412_1504_3426 640
47 3300046542 Ga0495597_0013961 Ga0495597_0013961_1052_2974 640
48 3300046694 Ga0495649_0000401 Ga0495649_0000401_2453_4375 640
49 3300047443 Ga0495687_000174 Ga0495687_000174_54525_56447 640
50 3300047443 Ga0495687_017403 Ga0495687_017403_392_2314 640
51 3300049579 Ga0501043_0000002 Ga0501043_0000002_291785_293707 640
52 3300049580 Ga0501046_0000008 Ga0501046_0000008_291882_293804 640
53 3300049581 Ga0501047_0000003 Ga0501047_0000003_315050_316972 640
54 3300049582 Ga0501048_0001290 Ga0501048_0001290_162_2084 640
55 3300049658 Ga0501211_000243 Ga0501211_000243_486_2408 640
56 3300049704 Ga0501221_000125 Ga0501221_000125_4171_6093 640
57 3300049706 Ga0501229_000045 Ga0501229_000045_7628_9550 640
58 3300050493 nmdc:mga0k408_1384_c1 nmdc:mga0k408_1384_c1_637_2583 640
59 3300050496 nmdc:mga07m45_2245_c1 nmdc:mga07m45_2245_c1_5328_7250 640
60 3300053086 Ga0500578_0000025 Ga0500578_0000025_32024_33946 640
61 iso_pu_bacteria 2643221644 2644243901 640
62 3300013306 Ga0163162_10002024 Ga0163162_1000202414 641
63 3300013308 Ga0157375_10007001 Ga0157375_100070017 641
64 3300005328 Ga0070676_10021699 Ga0070676_100216993 643
65 3300005330 Ga0070690_100009776 Ga0070690_1000097762 643
66 3300005334 Ga0068869_100038923 Ga0068869_1000389233 643
67 3300005347 Ga0070668_100049208 Ga0070668_1000492082 643
68 3300005354 Ga0070675_100044864 Ga0070675_1000448644 643
69 3300005356 Ga0070674_100025969 Ga0070674_1000259692 643
70 3300005367 Ga0070667_100041504 Ga0070667_1000415043 643
71 3300005459 Ga0068867_100013118 Ga0068867_1000131184 643
72 3300005543 Ga0070672_100054988 Ga0070672_1000549884 643
73 3300005718 Ga0068866_10027062 Ga0068866_100270622 643
74 3300005719 Ga0068861_100024005 Ga0068861_1000240053 643
75 3300005841 Ga0068863_100019027 Ga0068863_1000190272 643
76 3300005843 Ga0068860_100046327 Ga0068860_1000463273 643
77 3300009148 Ga0105243_10010904 Ga0105243_100109044 643
78 3300025907 Ga0207645_10019688 Ga0207645_100196883 643
79 3300025923 Ga0207681_10000880 Ga0207681_100008809 643
80 3300025935 Ga0207709_10012117 Ga0207709_100121171 643
81 3300025937 Ga0207669_10003724 Ga0207669_100037243 643
82 3300025940 Ga0207691_10033759 Ga0207691_100337593 643
83 3300025942 Ga0207689_10045275 Ga0207689_100452751 643
84 3300025961 Ga0207712_10006165 Ga0207712_100061653 643
85 3300025972 Ga0207668_10007781 Ga0207668_100077812 643
86 3300025986 Ga0207658_10003937 Ga0207658_100039373 643
87 3300026035 Ga0207703_10027100 Ga0207703_100271003 643
88 3300026089 Ga0207648_10020197 Ga0207648_100201974 643
89 3300026118 Ga0207675_100059739 Ga0207675_1000597393 643
90 3300026121 Ga0207683_10134853 Ga0207683_101348532 643
91 3300028380 Ga0268265_10034688 Ga0268265_100346882 643
92 3300028381 Ga0268264_10016600 Ga0268264_100166005 643
93 iso_pu_bacteria 2643221544 2643743717 643
94 iso_pu_bacteria 2643221639 2644222372 643
95 iso_pu_bacteria 2643221646 2644256386 643
96 iso_pu_bacteria 2738541337 2739058367 643
97 3300003215 JGI25153J46596_10000543 JGI25153J46596_1000054314 644
98 3300003771 Ga0055526_1001819 Ga0055526_100181913 644
99 3300003794 Ga0055531_10001626 Ga0055531_1000162614 644
100 3300005457 Ga0070662_100015636 Ga0070662_1000156363 644
101 3300005616 Ga0068852_100012294 Ga0068852_1000122945 644
102 3300025245 Ga0207425_1000426 Ga0207425_10004268 644
103 3300025258 Ga0209129_1000269 Ga0209129_100026944 644
104 3300025295 Ga0209564_1000300 Ga0209564_100030044 644
105 3300025297 Ga0209758_1000605 Ga0209758_100060525 644
106 3300025303 Ga0209051_1000172 Ga0209051_100017239 644
107 3300025304 Ga0209257_1000015 Ga0209257_1000015548 644
108 3300025304 Ga0209257_1000108 Ga0209257_1000108162 644
109 3300025933 Ga0207706_10017792 Ga0207706_100177924 644
110 3300028794 Ga0307515_10000281 Ga0307515_1000028125 644
111 3300028794 Ga0307515_10003339 Ga0307515_1000333928 644
112 3300028794 Ga0307515_10029571 Ga0307515_100295715 644
113 3300031247 Ga0265340_10041795 Ga0265340_100417951 644
114 3300031548 Ga0307408_100000029 Ga0307408_1000000296 644
115 3300037312 Ga0395899_0001161 Ga0395899_0001161_3167_5101 644
116 3300037418 Ga0395900_0001471 Ga0395900_0001471_11677_13611 644
117 3300037466 Ga0395898_0009390 Ga0395898_0009390_3947_5881 644
118 3300037471 Ga0395905_0049559 Ga0395905_0049559_1770_3704 644
119 3300042531 Ga0450918_000542 Ga0450918_000542_2100_4034 644
120 3300044656 Ga0466969_0000046 Ga0466969_0000046_45667_47601 644
121 3300044658 Ga0466972_0024239 Ga0466972_0024239_112_2088 644
122 3300044658 Ga0466972_0028576 Ga0466972_0028576_398_2338 644
123 3300044673 Ga0453683_0000780 Ga0453683_0000780_22587_24521 644
124 3300044683 Ga0466965_0018832 Ga0466965_0018832_642_2576 644
125 3300044712 Ga0453684_0020608 Ga0453684_0020608_1910_3910 644
126 3300044842 Ga0466957_0032677 Ga0466957_0032677_711_2669 644
127 3300045051 Ga0451576_0010795 Ga0451576_0010795_235_2169 644
128 3300047472 Ga0495686_0005097 Ga0495686_0005097_7950_9896 644
129 3300053096 Ga0500641_0008913 Ga0500641_0008913_108_2063 644
130 iso_pu_bacteria 2511231002 2511247311 644
131 iso_pu_bacteria 2547132374 2548499489 644
132 iso_pu_bacteria 2585428057 2587725519 644
133 iso_pu_bacteria 2585428058 2587734989 644
134 iso_pu_bacteria 2588253510 2588290521 644
135 iso_pu_bacteria 2643221585 2643936532 644
136 iso_pu_bacteria 2643221592 2643970035 644
137 iso_pu_bacteria 2643221609 2644057432 644
138 iso_pu_bacteria 2643221611 2644072479 644
139 iso_pu_bacteria 2643221625 2644142991 644
140 iso_pu_bacteria 2643221648 2644271949 644
141 iso_pu_bacteria 2643221654 2644301187 644
142 iso_pu_bacteria 2643221656 2644317888 644
143 iso_pu_bacteria 2643221717 2644648152 644
144 iso_pu_bacteria 2738543012 2739241703 644
145 iso_pu_bacteria 2816332133 2816470992 644
146 iso_pu_bacteria 2831864461 2831869090 644
147 iso_pu_bacteria 2842718218 2842722209 644
148 iso_pu_bacteria 2881101125 2881102886 644
149 iso_pu_bacteria 2919704043 2919705667 644
150 iso_pu_bacteria 2974320154 2974320872 644
151 3300025304 Ga0209257_1009164 Ga0209257_10091643 646
152 3300006195 Ga0075366_10015552 Ga0075366_100155524 647
153 3300009545 Ga0105237_10000646 Ga0105237_1000064624 647
154 3300025914 Ga0207671_10004759 Ga0207671_100047598 647
155 3300025924 Ga0207694_10068255 Ga0207694_100682552 647
156 3300028794 Ga0307515_10028096 Ga0307515_100280966 647
157 3300032004 Ga0307414_10017518 Ga0307414_100175182 647
158 3300032005 Ga0307411_10000631 Ga0307411_100006319 647
159 3300002704 JGI25155J39150_1000067 JGI25155J39150_100006736 648
160 3300002705 JGI25156J39149_1000013 JGI25156J39149_1000013136 648
161 3300002738 JGI25154J39366_1000032 JGI25154J39366_1000032136 648
162 3300002741 JGI25157J39369_1000017 JGI25157J39369_1000017136 648
163 3300002774 JGI25150J39212_1004205 JGI25150J39212_10042052 648
164 3300002987 JGI25159J45721_1001195 JGI25159J45721_10011956 648
165 3300002987 JGI25159J45721_1001596 JGI25159J45721_10015965 648
166 3300003354 JGI25160J50197_1000204 JGI25160J50197_100020439 648
167 3300003354 JGI25160J50197_1005548 JGI25160J50197_10055482 648
168 3300003374 JGI25161J50226_1000036 JGI25161J50226_1000036126 648
169 3300003771 Ga0055526_1000414 Ga0055526_100041431 648
170 3300003771 Ga0055526_1017354 Ga0055526_10173542 648
171 3300003773 Ga0055537_1000596 Ga0055537_10005962 648
172 3300003775 Ga0055524_1000145 Ga0055524_100014541 648
173 3300003790 Ga0055528_1000524 Ga0055528_100052417 648
174 3300003792 Ga0055540_1000237 Ga0055540_10002372 648
175 3300004625 Ga0055543_1001540 Ga0055543_10015406 648
176 3300004625 Ga0055543_1003568 Ga0055543_10035682 648
177 3300005262 Ga0065165_1000177 Ga0065165_100017733 648
178 3300005262 Ga0065165_1002331 Ga0065165_10023315 648
179 3300005295 Ga0065707_10084610 Ga0065707_100846102 648
180 3300005330 Ga0070690_100002408 Ga0070690_1000024082 648
181 3300005331 Ga0070670_100098658 Ga0070670_1000986582 648
182 3300005333 Ga0070677_10002402 Ga0070677_100024023 648
183 3300005334 Ga0068869_100009917 Ga0068869_1000099173 648
184 3300005334 Ga0068869_100024281 Ga0068869_1000242812 648
185 3300005336 Ga0070680_100016779 Ga0070680_1000167793 648
186 3300005338 Ga0068868_100003620 Ga0068868_10000362010 648
187 3300005339 Ga0070660_100028021 Ga0070660_1000280212 648
188 3300005347 Ga0070668_100019956 Ga0070668_1000199563 648
189 3300005353 Ga0070669_100013285 Ga0070669_1000132853 648
190 3300005354 Ga0070675_100007888 Ga0070675_1000078884 648
191 3300005355 Ga0070671_100015689 Ga0070671_1000156895 648
192 3300005367 Ga0070667_100009044 Ga0070667_1000090442 648
193 3300005367 Ga0070667_100028053 Ga0070667_1000280533 648
194 3300005441 Ga0070700_100006774 Ga0070700_1000067745 648
195 3300005456 Ga0070678_100061643 Ga0070678_1000616432 648
196 3300005457 Ga0070662_100022328 Ga0070662_1000223283 648
197 3300005459 Ga0068867_100018336 Ga0068867_1000183362 648
198 3300005459 Ga0068867_100030748 Ga0068867_1000307482 648
199 3300005467 Ga0070706_100015349 Ga0070706_1000153495 648
200 3300005530 Ga0070679_100024274 Ga0070679_1000242744 648
201 3300005543 Ga0070672_100000177 Ga0070672_1000001774 648
202 3300005543 Ga0070672_100016727 Ga0070672_1000167273 648
203 3300005543 Ga0070672_100066164 Ga0070672_1000661642 648
204 3300005547 Ga0070693_100009035 Ga0070693_1000090352 648
205 3300005563 Ga0068855_100060620 Ga0068855_1000606204 648
206 3300005564 Ga0070664_100032863 Ga0070664_1000328632 648
207 3300005614 Ga0068856_100038182 Ga0068856_1000381822 648
208 3300005616 Ga0068852_100007509 Ga0068852_1000075097 648
209 3300005617 Ga0068859_100019319 Ga0068859_1000193194 648
210 3300005617 Ga0068859_100112993 Ga0068859_1001129932 648
211 3300005618 Ga0068864_100000826 Ga0068864_10000082610 648
212 3300005618 Ga0068864_100043531 Ga0068864_1000435312 648
213 3300005718 Ga0068866_10003793 Ga0068866_100037933 648
214 3300005719 Ga0068861_100002005 Ga0068861_1000020053 648
215 3300005719 Ga0068861_100015344 Ga0068861_1000153442 648
216 3300005841 Ga0068863_100010025 Ga0068863_1000100254 648
217 3300005842 Ga0068858_100005438 Ga0068858_1000054388 648
218 3300005842 Ga0068858_100013940 Ga0068858_1000139407 648
219 3300005842 Ga0068858_100054032 Ga0068858_1000540322 648
220 3300005843 Ga0068860_100005287 Ga0068860_10000528710 648
221 3300005843 Ga0068860_100033305 Ga0068860_1000333052 648
222 3300005844 Ga0068862_100017745 Ga0068862_1000177455 648
223 3300005844 Ga0068862_100043230 Ga0068862_1000432303 648
224 3300006237 Ga0097621_100009425 Ga0097621_1000094254 648
225 3300006237 Ga0097621_100077024 Ga0097621_1000770242 648
226 3300006353 Ga0075370_10017090 Ga0075370_100170902 648
227 3300006881 Ga0068865_100020074 Ga0068865_1000200743 648
228 3300006931 Ga0097620_100019319 Ga0097620_1000193194 648
229 3300006931 Ga0097620_100112992 Ga0097620_1001129921 648
230 3300006944 Ga0099823_1000139 Ga0099823_100013928 648
231 3300009093 Ga0105240_10005093 Ga0105240_100050934 648
232 3300009148 Ga0105243_10078331 Ga0105243_100783312 648
233 3300009551 Ga0105238_10034206 Ga0105238_100342062 648
234 3300009553 Ga0105249_10011823 Ga0105249_100118232 648
235 3300009553 Ga0105249_10038368 Ga0105249_100383683 648
236 3300012497 Ga0157319_1000008 Ga0157319_100000845 648
237 3300013296 Ga0157374_10011812 Ga0157374_100118122 648
238 3300013306 Ga0163162_10004836 Ga0163162_100048366 648
239 3300014325 Ga0163163_10011263 Ga0163163_100112634 648
240 3300014326 Ga0157380_10052497 Ga0157380_100524972 648
241 3300014968 Ga0157379_10026458 Ga0157379_100264583 648
242 3300014969 Ga0157376_10039510 Ga0157376_100395103 648
243 3300021361 Ga0213872_10010926 Ga0213872_100109262 648
244 3300025206 Ga0209435_100003 Ga0209435_10000335 648
245 3300025245 Ga0207425_1002116 Ga0207425_10021166 648
246 3300025246 Ga0209646_1000008 Ga0209646_100000835 648
247 3300025250 Ga0209026_1000007 Ga0209026_100000735 648
248 3300025256 Ga0209759_1000026 Ga0209759_1000026244 648
249 3300025263 Ga0209565_1000026 Ga0209565_1000026161 648
250 3300025273 Ga0209673_1000009 Ga0209673_1000009168 648
251 3300025273 Ga0209673_1002449 Ga0209673_100244914 648
252 3300025284 Ga0209130_1000109 Ga0209130_10001094 648
253 3300025284 Ga0209130_1000307 Ga0209130_10003078 648
254 3300025291 Ga0209675_1000545 Ga0209675_100054521 648
255 3300025292 Ga0209676_1000013 Ga0209676_100001373 648
256 3300025294 Ga0209025_1003154 Ga0209025_10031547 648
257 3300025294 Ga0209025_1006232 Ga0209025_10062326 648
258 3300025294 Ga0209025_1028382 Ga0209025_10283822 648
259 3300025295 Ga0209564_1000008 Ga0209564_1000008686 648
260 3300025295 Ga0209564_1000243 Ga0209564_100024332 648
261 3300025297 Ga0209758_1000453 Ga0209758_100045339 648
262 3300025298 Ga0209050_1000008 Ga0209050_100000873 648
263 3300025298 Ga0209050_1000770 Ga0209050_100077029 648
264 3300025298 Ga0209050_1003585 Ga0209050_10035856 648
265 3300025298 Ga0209050_1004843 Ga0209050_10048432 648
266 3300025299 Ga0209256_1000003 Ga0209256_1000003323 648
267 3300025299 Ga0209256_1000413 Ga0209256_100041356 648
268 3300025302 Ga0207426_1000062 Ga0207426_100006249 648
269 3300025302 Ga0207426_1004055 Ga0207426_10040555 648
270 3300025303 Ga0209051_1000005 Ga0209051_100000573 648
271 3300025303 Ga0209051_1000886 Ga0209051_100088622 648
272 3300025303 Ga0209051_1005444 Ga0209051_10054446 648
273 3300025304 Ga0209257_1000048 Ga0209257_100004873 648
274 3300025304 Ga0209257_1008757 Ga0209257_10087572 648
275 3300025893 Ga0207682_10004449 Ga0207682_100044495 648
276 3300025893 Ga0207682_10005562 Ga0207682_100055624 648
277 3300025910 Ga0207684_10000714 Ga0207684_1000071424 648
278 3300025913 Ga0207695_10053553 Ga0207695_100535532 648
279 3300025919 Ga0207657_10035786 Ga0207657_100357862 648
280 3300025921 Ga0207652_10031247 Ga0207652_100312472 648
281 3300025923 Ga0207681_10006701 Ga0207681_100067013 648
282 3300025923 Ga0207681_10008608 Ga0207681_100086083 648
283 3300025923 Ga0207681_10009640 Ga0207681_100096405 648
284 3300025924 Ga0207694_10070827 Ga0207694_100708272 648
285 3300025925 Ga0207650_10001020 Ga0207650_1000102014 648
286 3300025925 Ga0207650_10062358 Ga0207650_100623582 648
287 3300025926 Ga0207659_10000614 Ga0207659_1000061416 648
288 3300025926 Ga0207659_10044116 Ga0207659_100441162 648
289 3300025931 Ga0207644_10008782 Ga0207644_100087825 648
290 3300025933 Ga0207706_10053348 Ga0207706_100533482 648
291 3300025935 Ga0207709_10016227 Ga0207709_100162273 648
292 3300025937 Ga0207669_10007853 Ga0207669_100078532 648
293 3300025938 Ga0207704_10023492 Ga0207704_100234922 648
294 3300025940 Ga0207691_10014392 Ga0207691_100143927 648
295 3300025940 Ga0207691_10084722 Ga0207691_100847222 648
296 3300025942 Ga0207689_10032343 Ga0207689_100323432 648
297 3300025945 Ga0207679_10019045 Ga0207679_100190453 648
298 3300025949 Ga0207667_10023656 Ga0207667_100236563 648
299 3300025960 Ga0207651_10000476 Ga0207651_100004764 648
300 3300025961 Ga0207712_10022538 Ga0207712_100225383 648
301 3300025972 Ga0207668_10017753 Ga0207668_100177532 648
302 3300025986 Ga0207658_10011293 Ga0207658_100112932 648
303 3300026023 Ga0207677_10040753 Ga0207677_100407532 648
304 3300026035 Ga0207703_10002711 Ga0207703_1000271110 648
305 3300026035 Ga0207703_10029516 Ga0207703_100295162 648
306 3300026035 Ga0207703_10039420 Ga0207703_100394203 648
307 3300026067 Ga0207678_10072134 Ga0207678_100721342 648
308 3300026088 Ga0207641_10018924 Ga0207641_100189243 648
309 3300026089 Ga0207648_10006766 Ga0207648_100067662 648
310 3300026089 Ga0207648_10008899 Ga0207648_1000889910 648
311 3300026089 Ga0207648_10012940 Ga0207648_100129403 648
312 3300026089 Ga0207648_10018624 Ga0207648_100186243 648
313 3300026089 Ga0207648_10032076 Ga0207648_100320763 648
314 3300026095 Ga0207676_10000855 Ga0207676_1000085513 648
315 3300026095 Ga0207676_10072399 Ga0207676_100723992 648
316 3300026095 Ga0207676_10073531 Ga0207676_100735312 648
317 3300026118 Ga0207675_100014229 Ga0207675_1000142291 648
318 3300026121 Ga0207683_10022060 Ga0207683_100220603 648
319 3300026121 Ga0207683_10027022 Ga0207683_100270222 648
320 3300026121 Ga0207683_10046373 Ga0207683_100463733 648
321 3300026142 Ga0207698_10005200 Ga0207698_100052002 648
322 3300027252 Ga0209973_1000497 Ga0209973_10004972 648
323 3300027296 Ga0209389_1002532 Ga0209389_10025325 648
324 3300027526 Ga0209968_1000860 Ga0209968_10008603 648
325 3300027543 Ga0209999_1004770 Ga0209999_10047702 648
326 3300027682 Ga0209971_1004560 Ga0209971_10045602 648
327 3300027695 Ga0209966_1000017 Ga0209966_10000177 648
328 3300028380 Ga0268265_10035205 Ga0268265_100352053 648
329 3300028381 Ga0268264_10016771 Ga0268264_100167713 648
330 3300028794 Ga0307515_10000048 Ga0307515_10000048255 648
331 3300028794 Ga0307515_10054215 Ga0307515_100542153 648
332 3300030500 Ga0268256_1007512 Ga0268256_10075123 648
333 3300031235 Ga0265330_10000043 Ga0265330_1000004382 648
334 3300031238 Ga0265332_10000018 Ga0265332_10000018193 648
335 3300031238 Ga0265332_10000022 Ga0265332_1000002296 648
336 3300031241 Ga0265325_10008692 Ga0265325_100086923 648
337 3300031247 Ga0265340_10028838 Ga0265340_100288382 648
338 3300031456 Ga0307513_10000034 Ga0307513_1000003423 648
339 3300031456 Ga0307513_10000057 Ga0307513_1000005719 648
340 3300031507 Ga0307509_10000249 Ga0307509_100002494 648
341 3300031507 Ga0307509_10004869 Ga0307509_1000486911 648
342 3300031507 Ga0307509_10112969 Ga0307509_101129692 648
343 3300031548 Ga0307408_100000107 Ga0307408_10000010771 648
344 3300031548 Ga0307408_100010302 Ga0307408_1000103022 648
345 3300031616 Ga0307508_10000143 Ga0307508_1000014321 648
346 3300031616 Ga0307508_10001407 Ga0307508_1000140724 648
347 3300031649 Ga0307514_10001712 Ga0307514_1000171212 648
348 3300031649 Ga0307514_10038392 Ga0307514_100383922 648
349 3300031711 Ga0265314_10000126 Ga0265314_1000012622 648
350 3300031730 Ga0307516_10005342 Ga0307516_1000534214 648
351 3300031730 Ga0307516_10056503 Ga0307516_100565033 648
352 3300031730 Ga0307516_10092301 Ga0307516_100923011 648
353 3300031852 Ga0307410_10001858 Ga0307410_100018589 648
354 3300031901 Ga0307406_10000702 Ga0307406_1000070213 648
355 3300031903 Ga0307407_10003615 Ga0307407_100036153 648
356 3300031995 Ga0307409_100010064 Ga0307409_1000100645 648
357 3300032002 Ga0307416_100000552 Ga0307416_10000055212 648
358 3300032005 Ga0307411_10002483 Ga0307411_100024832 648
359 3300032126 Ga0307415_100009374 Ga0307415_1000093742 648
360 3300033180 Ga0307510_10116566 Ga0307510_101165662 648
361 3300035088 Ga0373940_0001422 Ga0373940_0001422_1283_3298 648
362 3300035114 Ga0373939_0000114 Ga0373939_0000114_1940_3955 648
363 3300035121 Ga0373960_0000259 Ga0373960_0000259_4405_6420 648
364 3300035170 Ga0373943_0013213 Ga0373943_0013213_1759_3705 648
365 3300035691 Ga0373931_0006842 Ga0373931_0006842_3333_5348 648
366 3300037418 Ga0395900_0008457 Ga0395900_0008457_3997_5943 648
367 3300037418 Ga0395900_0009117 Ga0395900_0009117_137_2083 648
368 3300037466 Ga0395898_0007931 Ga0395898_0007931_4293_6239 648
369 3300037466 Ga0395898_0022283 Ga0395898_0022283_2840_4786 648
370 3300037471 Ga0395905_0000090 Ga0395905_0000090_79782_81728 648
371 3300037471 Ga0395905_0000609 Ga0395905_0000609_34093_36039 648
372 3300037471 Ga0395905_0003315 Ga0395905_0003315_10927_12873 648
373 3300037471 Ga0395905_0015893 Ga0395905_0015893_1249_3195 648
374 3300038443 Ga0395901_0064483 Ga0395901_0064483_442_2388 648
375 3300039447 Ga0436361_0367431 Ga0436361_0367431_15751_17697 648
376 3300042008 Ga0439450_003517 Ga0439450_003517_25_1971 648
377 3300042876 Ga0451577_0010658 Ga0451577_0010658_5719_7668 648
378 3300044712 Ga0453684_0000868 Ga0453684_0000868_13050_14996 648
379 3300044712 Ga0453684_0031663 Ga0453684_0031663_4344_6290 648
380 3300044765 Ga0466970_0063204 Ga0466970_0063204_18_1964 648
381 3300045051 Ga0451576_0003368 Ga0451576_0003368_8188_10134 648
382 3300045051 Ga0451576_0029695 Ga0451576_0029695_3821_5767 648
383 3300046454 Ga0495592_0000266 Ga0495592_0000266_39563_41512 648
384 3300048907 Ga0496104_0055414 Ga0496104_0055414_765_2717 648
385 3300048913 Ga0496110_0062629 Ga0496110_0062629_122_2170 648
386 3300048917 Ga0496114_0113378 Ga0496114_0113378_28_1980 648
387 3300048927 Ga0496124_0023272 Ga0496124_0023272_1426_3372 648
388 3300049581 Ga0501047_0029371 Ga0501047_0029371_2985_4931 648
389 3300049823 Ga0501044_0062626 Ga0501044_0062626_1409_3355 648
390 3300053117 Ga0500593_000858 Ga0500593_000858_9261_11207 648
391 3300053130 Ga0500642_0006143 Ga0500642_0006143_645_2645 648
392 3300053131 Ga0500652_000177 Ga0500652_000177_19283_21283 648
393 3300053156 Ga0500622_0000890 Ga0500622_0000890_22347_24347 648
394 3300053156 Ga0500622_0007713 Ga0500622_0007713_160_2106 648
395 3300053730 Ga0500645_001045 Ga0500645_001045_645_2591 648

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00501

AMP-binding

AMP-binding enzyme

124

541

0.85

PF23562

578

721

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wv5-assembly2.cif.gz_B complex structure of vinn with 3-methylaspartate 0.8903 2 458
3wvn-assembly2.cif.gz_B complex structure of vinn with l-aspartate 0.8889 2 452
3wv5-assembly2.cif.gz_B complex structure of vinn with 3-methylaspartate 0.8761 2 458
3wvn-assembly2.cif.gz_B complex structure of vinn with l-aspartate 0.8674 2 452
3wv4-assembly2.cif.gz_B crystal structure of vinn 0.859 2 458
ID Description Score Start End Superfamily
2d1qA01 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9771 396 462 2.30.38.10
5u95D03 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9723 399 462 2.30.38.10
af_P9WQ53_285_415_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9651 333 462 2.30.38.10
af_Q4CT79_2_96_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9646 394 464 2.30.38.10
af_P9WQ53_285_415_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9509 333 462 2.30.38.10
ID Description Score Start End GO Terms
AF-A0A3D0EWR9-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9919 222 401 GO:0004467
GO:0005811
GO:0005886
GO:0035336
AF-A0A4Q3LL77-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9858 1 99 GO:0016874
AF-A0A800IIC7-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9819 4 320 GO:0004467
GO:0016020
AF-A0A4Q3LL77-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9761 1 99 GO:0016874
AF-A0A3D0EWR9-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9704 222 401 GO:0004467
GO:0005811
GO:0005886
GO:0035336

Feature Viewer

pLDDT pTM Quality
87.73 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map