F433233

General Info

Members Datasets Scaffolds Average Seq Length
395 261 372 261

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10077985|Ga0207664_100779852
Length 297
Sequence MATVLGYNWRRSRAAEYEPGNVVRRVEVGDVKVVMLCGGKGTRLREETEFRPKPMVEIGGRPILWHIMKLYAYYGFNEFVLCLGYKGSVIKDYFLNYNSMLNDFTLSLGTRNGRAITYHGDDEIHDFIVTLADTGEETLTAGRLKRVERYLDDDTFMVTYGDGLADVNIRDLLAFHHAHGKLATVTAIQPTSRFGLLDIEHDGSVSRFVEKPQVDEWINGGFFVFNRRIFNYINRDCMLEQDPLMSLAEDGQLVAYRHTGFWQAMDTYRDTLYLNDIWREGDAPWAVWQRAPVALKV

Samples

Sample ID Description Type Environment
1 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
8 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
9 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
10 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
11 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
12 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
13 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
14 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
15 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
16 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
17 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
18 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
19 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
20 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
21 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
22 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.67
Metatranscriptomes 0.51
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 3.04
Rhizoplane 1.77
Rhizosphere 80.51
Stem 0
Stem Tuber 0
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10022285 3300003215 Bacteria 2340
2 JGI25160J50197_1004971 3300003354 Bacteria 5643
3 Ga0007409J51694_1040004 3300003575 Bacteria 1915
4 Ga0065712_10010685 3300005290 Bacteria 2458
5 Ga0065707_10204170 3300005295 Bacteria 1296
6 Ga0065707_10270834 3300005295 Bacteria 1072
7 Ga0065707_10315408 3300005295 Bacteria 976
8 Ga0070676_10032451 3300005328 Bacteria 2992
9 Ga0070676_10208637 3300005328 Bacteria 1284
10 Ga0070683_100001472 3300005329 Bacteria 18134
11 Ga0070670_100144029 3300005331 Bacteria 2061
12 Ga0068869_100059385 3300005334 Bacteria 2800
13 Ga0068869_100092025 3300005334 Bacteria 2282
14 Ga0070666_10039032 3300005335 Bacteria 3162
15 Ga0070680_100026662 3300005336 Bacteria 4621
16 Ga0070680_100072796 3300005336 Bacteria 2825
17 Ga0070680_100259213 3300005336 Bacteria 1471
18 Ga0070680_100562358 3300005336 Bacteria 978
19 Ga0068868_100181540 3300005338 Bacteria 1746
20 Ga0070669_100476452 3300005353 Bacteria 1032
21 Ga0070675_100094271 3300005354 Bacteria 2511
22 Ga0070671_100001464 3300005355 Bacteria 17629
23 Ga0070671_100062598 3300005355 Bacteria 3098
24 Ga0070673_100005402 3300005364 Bacteria 8174
25 Ga0070673_100084642 3300005364 Bacteria 2579
26 Ga0070688_100098992 3300005365 Bacteria 1919
27 Ga0070688_100300675 3300005365 Bacteria 1160
28 Ga0070659_100192727 3300005366 Bacteria 1676
29 Ga0070667_100003703 3300005367 Bacteria 13006
30 Ga0070709_10142879 3300005434 Bacteria 1646
31 Ga0070714_100051464 3300005435 Bacteria 3511
32 Ga0070701_10004983 3300005438 Bacteria 5440
33 Ga0070705_100000670 3300005440 Bacteria 19576
34 Ga0070705_100007798 3300005440 Bacteria 5286
35 Ga0070700_100026966 3300005441 Bacteria 3401
36 Ga0070700_100323922 3300005441 Bacteria 1133
37 Ga0070694_100003717 3300005444 Bacteria 9097
38 Ga0070708_100707444 3300005445 Bacteria 948
39 Ga0070681_10010314 3300005458 Bacteria 9223
40 Ga0070685_10217005 3300005466 Bacteria 1251
41 Ga0070707_100167265 3300005468 Bacteria 2143
42 Ga0070698_100000421 3300005471 Bacteria 45224
43 Ga0070699_100011287 3300005518 Bacteria 7717
44 Ga0070679_100000040 3300005530 Bacteria 96771
45 Ga0070679_100134389 3300005530 Bacteria 2454
46 Ga0070684_100000983 3300005535 Bacteria 20350
47 Ga0070684_100240993 3300005535 Bacteria 1652
48 Ga0070684_100526081 3300005535 Bacteria 1096
49 Ga0070697_100008361 3300005536 Bacteria 8075
50 Ga0070697_100282551 3300005536 Bacteria 1424
51 Ga0070686_100076843 3300005544 Bacteria 2200
52 Ga0070695_100015678 3300005545 Bacteria 4578
53 Ga0070696_100000070 3300005546 Bacteria 49576
54 Ga0070696_100063999 3300005546 Bacteria 2577
55 Ga0070696_100127734 3300005546 Unclassified 1846
56 Ga0070696_100198148 3300005546 Bacteria 1498
57 Ga0070665_100003279 3300005548 Bacteria 17367
58 Ga0070665_100010856 3300005548 Bacteria 9212
59 Ga0070665_101026157 3300005548 Bacteria 837
60 Ga0070704_100003430 3300005549 Bacteria 9086
61 Ga0070704_100037902 3300005549 Unclassified 3298
62 Ga0068855_100008888 3300005563 Bacteria 12144
63 Ga0068856_100000837 3300005614 Bacteria 33198
64 Ga0068856_100116282 3300005614 Bacteria 2675
65 Ga0068856_100158613 3300005614 Bacteria 2273
66 Ga0068856_100237099 3300005614 Bacteria 1840
67 Ga0070702_100012951 3300005615 Bacteria 4200
68 Ga0068852_100000394 3300005616 Bacteria 29271
69 Ga0068852_100066004 3300005616 Bacteria 3159
70 Ga0068859_100000456 3300005617 Bacteria 40505
71 Ga0068859_100004984 3300005617 Bacteria 13487
72 Ga0068859_100676515 3300005617 Bacteria 1123
73 Ga0068859_100743934 3300005617 Unclassified 1070
74 Ga0068861_100018447 3300005719 Bacteria 4971
75 Ga0068861_100068436 3300005719 Bacteria 2744
76 Ga0068861_100145000 3300005719 Unclassified 1942
77 Ga0068861_100448936 3300005719 Bacteria 1155
78 Ga0068858_100000239 3300005842 Bacteria 59492
79 Ga0068858_100295450 3300005842 Bacteria 1545
80 Ga0068858_100674301 3300005842 Bacteria 1005
81 Ga0068860_100050030 3300005843 Bacteria 3980
82 Ga0081455_10000367 3300005937 Bacteria 59549
83 Ga0081539_10059642 3300005985 Unclassified 2099
84 Ga0075363_100000126 3300006048 Bacteria 18188
85 Ga0075364_10293253 3300006051 Bacteria 1107
86 Ga0070716_100346860 3300006173 Bacteria 1049
87 Ga0075366_10021699 3300006195 Bacteria 3734
88 Ga0097621_100228432 3300006237 Bacteria 1624
89 Ga0075370_10013904 3300006353 Bacteria 4284
90 Ga0068871_100294824 3300006358 Bacteria 1422
91 Ga0075428_100009483 3300006844 Bacteria 10805
92 Ga0075428_100090129 3300006844 Unclassified 3345
93 Ga0075428_100312830 3300006844 Bacteria 1688
94 Ga0075430_100019376 3300006846 Bacteria 5786
95 Ga0075430_100046615 3300006846 Bacteria 3661
96 Ga0075430_100100447 3300006846 Bacteria 2416
97 Ga0075431_100164401 3300006847 Bacteria 2281
98 Ga0075433_10093422 3300006852 Bacteria 2661
99 Ga0075433_10457416 3300006852 Bacteria 1125
100 Ga0075434_100063066 3300006871 Bacteria 3689
101 Ga0075434_100181997 3300006871 Bacteria 2122
102 Ga0075434_100223386 3300006871 Bacteria 1903
103 Ga0075434_100302056 3300006871 Bacteria 1621
104 Ga0068865_100257491 3300006881 Bacteria 1380
105 Ga0068865_100459524 3300006881 Bacteria 1054
106 Ga0075436_100000141 3300006914 Bacteria 43568
107 Ga0097620_100000456 3300006931 Bacteria 40505
108 Ga0097620_100004983 3300006931 Bacteria 13487
109 Ga0097620_100676428 3300006931 Bacteria 1123
110 Ga0097620_100743941 3300006931 Unclassified 1070
111 Ga0075435_100203397 3300007076 Bacteria 1678
112 Ga0105240_10002083 3300009093 Bacteria 32763
113 Ga0105240_10003249 3300009093 Bacteria 25440
114 Ga0105240_10020369 3300009093 Bacteria 8850
115 Ga0111539_10317622 3300009094 Bacteria 1813
116 Ga0111539_10353613 3300009094 Bacteria 1710
117 Ga0105245_10350089 3300009098 Bacteria 1463
118 Ga0105247_10000170 3300009101 Bacteria 64314
119 Ga0114129_10000349 3300009147 Bacteria 53637
120 Ga0114129_10020657 3300009147 Bacteria 9361
121 Ga0114129_10048494 3300009147 Bacteria 5968
122 Ga0114129_10250971 3300009147 Bacteria 2375
123 Ga0114129_10742733 3300009147 Bacteria 1257
124 Ga0105243_10036903 3300009148 Bacteria 3796
125 Ga0105243_10065313 3300009148 Bacteria 2922
126 Ga0105243_10190795 3300009148 Bacteria 1790
127 Ga0105241_10300359 3300009174 Bacteria 1378
128 Ga0105242_10060543 3300009176 Bacteria 3111
129 Ga0105242_10490503 3300009176 Bacteria 1166
130 Ga0105242_10688343 3300009176 Bacteria 999
131 Ga0105248_10023722 3300009177 Bacteria 6817
132 Ga0105248_10054054 3300009177 Bacteria 4504
133 Ga0105248_10054438 3300009177 Bacteria 4487
134 Ga0105237_10001152 3300009545 Bacteria 35466
135 Ga0105237_10032535 3300009545 Bacteria 5279
136 Ga0105237_10311444 3300009545 Bacteria 1577
137 Ga0105238_10012497 3300009551 Bacteria 8564
138 Ga0105238_10014085 3300009551 Bacteria 8085
139 Ga0105238_10049454 3300009551 Bacteria 4234
140 Ga0105249_10009188 3300009553 Bacteria 8643
141 Ga0105249_10020014 3300009553 Bacteria 5976
142 Ga0105239_10000248 3300010375 Bacteria 80738
143 Ga0157370_10008202 3300013104 Bacteria 11287
144 Ga0157370_10009072 3300013104 Bacteria 10666
145 Ga0157370_10093300 3300013104 Bacteria 2825
146 Ga0157369_10021215 3300013105 Bacteria 7263
147 Ga0157369_10060913 3300013105 Bacteria 4069
148 Ga0157369_10457681 3300013105 Bacteria 1321
149 Ga0157378_10014258 3300013297 Bacteria 6958
150 Ga0163162_10084991 3300013306 Bacteria 3240
151 Ga0157372_10515914 3300013307 Bacteria 1393
152 Ga0157375_11086534 3300013308 Unclassified 936
153 Ga0163163_10004752 3300014325 Bacteria 11650
154 Ga0163163_10045735 3300014325 Bacteria 4298
155 Ga0157377_10024631 3300014745 Bacteria 3201
156 Ga0157379_10008222 3300014968 Bacteria 9060
157 Ga0157379_10250340 3300014968 Bacteria 1608
158 Ga0213875_10027271 3300021388 Bacteria 2718
159 Ga0209026_1000539 3300025250 Bacteria 26079
160 Ga0209758_1000516 3300025297 Bacteria 62036
161 Ga0209758_1039434 3300025297 Bacteria 1797
162 Ga0209050_1000090 3300025298 Bacteria 253783
163 Ga0207426_1000160 3300025302 Bacteria 174540
164 Ga0209257_1002389 3300025304 Bacteria 18811
165 Ga0209257_1002767 3300025304 Bacteria 16583
166 Ga0207697_10161113 3300025315 Bacteria 979
167 Ga0207680_10008542 3300025903 Bacteria 5037
168 Ga0207645_10027333 3300025907 Bacteria 3685
169 Ga0207645_10202566 3300025907 Bacteria 1306
170 Ga0207707_10000232 3300025912 Bacteria 60065
171 Ga0207707_10093616 3300025912 Bacteria 2625
172 Ga0207695_10004555 3300025913 Bacteria 18846
173 Ga0207695_10014184 3300025913 Bacteria 9454
174 Ga0207695_10032550 3300025913 Bacteria 5704
175 Ga0207695_10035948 3300025913 Bacteria 5362
176 Ga0207671_10004764 3300025914 Bacteria 12810
177 Ga0207671_10076977 3300025914 Bacteria 2497
178 Ga0207660_10057876 3300025917 Bacteria 2777
179 Ga0207652_10013527 3300025921 Bacteria 6601
180 Ga0207652_10153700 3300025921 Bacteria 2061
181 Ga0207646_10119929 3300025922 Bacteria 2363
182 Ga0207681_10302073 3300025923 Bacteria 1267
183 Ga0207694_10016410 3300025924 Bacteria 5591
184 Ga0207694_10028815 3300025924 Bacteria 4235
185 Ga0207694_10253150 3300025924 Bacteria 1442
186 Ga0207650_10025483 3300025925 Bacteria 4213
187 Ga0207659_10004027 3300025926 Bacteria 8865
188 Ga0207664_10077985 3300025929 Bacteria 2686
189 Ga0207644_10013696 3300025931 Bacteria 5413
190 Ga0207706_10205601 3300025933 Bacteria 1727
191 Ga0207686_10044936 3300025934 Bacteria 2715
192 Ga0207709_10140938 3300025935 Bacteria 1657
193 Ga0207709_10279181 3300025935 Bacteria 1233
194 Ga0207704_10077235 3300025938 Bacteria 2137
195 Ga0207665_10021719 3300025939 Bacteria 4222
196 Ga0207711_10025958 3300025941 Bacteria 4913
197 Ga0207711_10134329 3300025941 Bacteria 2221
198 Ga0207711_10374524 3300025941 Bacteria 1320
199 Ga0207689_10135345 3300025942 Bacteria 2029
200 Ga0207661_10181780 3300025944 Bacteria 1837
201 Ga0207679_10341688 3300025945 Bacteria 1302
202 Ga0207667_10008131 3300025949 Bacteria 12490
203 Ga0207651_10007787 3300025960 Bacteria 5729
204 Ga0207651_10047446 3300025960 Bacteria 2896
205 Ga0207651_10133480 3300025960 Bacteria 1905
206 Ga0207712_10138473 3300025961 Bacteria 1864
207 Ga0207658_10002599 3300025986 Bacteria 13108
208 Ga0207658_10003048 3300025986 Bacteria 11980
209 Ga0207677_10458883 3300026023 Bacteria 1093
210 Ga0207703_10004395 3300026035 Bacteria 11587
211 Ga0207703_10046868 3300026035 Bacteria 3484
212 Ga0207703_10537470 3300026035 Bacteria 1101
213 Ga0207708_10030333 3300026075 Bacteria 4099
214 Ga0207702_10005199 3300026078 Bacteria 11436
215 Ga0207702_10260312 3300026078 Bacteria 1633
216 Ga0207648_10259942 3300026089 Bacteria 1549
217 Ga0207648_10375796 3300026089 Bacteria 1284
218 Ga0207674_10101737 3300026116 Bacteria 2854
219 Ga0207674_10106033 3300026116 Bacteria 2788
220 Ga0207675_100035619 3300026118 Bacteria 4642
221 Ga0207675_100092035 3300026118 Bacteria 2852
222 Ga0207675_100114995 3300026118 Bacteria 2542
223 Ga0207675_100279858 3300026118 Bacteria 1621
224 Ga0207698_10063184 3300026142 Bacteria 2896
225 Ga0268266_10024703 3300028379 Bacteria 5113
226 Ga0268265_10026648 3300028380 Bacteria 4115
227 Ga0268264_10038159 3300028381 Bacteria 3962
228 Ga0268264_10760048 3300028381 Bacteria 966
229 Ga0265319_1003866 3300028563 Bacteria 7649
230 Ga0307517_10008378 3300028786 Bacteria 14839
231 Ga0307515_10002251 3300028794 Bacteria 42303
232 Ga0307511_10000015 3300030521 Bacteria 126567
233 Ga0265330_10000028 3300031235 Archaea 138261
234 Ga0265332_10000004 3300031238 Bacteria 426592
235 Ga0265339_10054370 3300031249 Bacteria 2175
236 Ga0265316_10006307 3300031344 Bacteria 11355
237 Ga0307513_10011268 3300031456 Bacteria 11128
238 Ga0307513_10024220 3300031456 Bacteria 7067
239 Ga0307513_10026467 3300031456 Bacteria 6685
240 Ga0307509_10067217 3300031507 Bacteria 3756
241 Ga0307509_10069562 3300031507 Bacteria 3679
242 Ga0307408_100030019 3300031548 Bacteria 3772
243 Ga0307408_100117499 3300031548 Bacteria 2054
244 Ga0307508_10010392 3300031616 Bacteria 8517
245 Ga0307514_10018767 3300031649 Bacteria 5666
246 Ga0316579_10002618 3300031691 Bacteria 6832
247 Ga0316579_10151902 3300031691 Bacteria 1117
248 Ga0265342_10000015 3300031712 Archaea 194661
249 Ga0316576_10001213 3300031727 Bacteria 13619
250 Ga0316578_10000026 3300031728 Bacteria 29947
251 Ga0307405_10011570 3300031731 Bacteria 4633
252 Ga0316577_10003660 3300031733 Bacteria 7809
253 Ga0307413_10155492 3300031824 Bacteria 1599
254 Ga0307410_10051725 3300031852 Bacteria 2770
255 Ga0307406_10025314 3300031901 Bacteria 3552
256 Ga0307412_10059446 3300031911 Bacteria 2562
257 Ga0307409_100042497 3300031995 Bacteria 3405
258 Ga0307416_100018000 3300032002 Bacteria 4963
259 Ga0307411_10005140 3300032005 Bacteria 6390
260 Ga0307411_10356802 3300032005 Bacteria 1194
261 Ga0316583_10071921 3300032133 Bacteria 1210
262 Ga0316585_10001389 3300032137 Bacteria 6376
263 Ga0316580_10003192 3300032139 Bacteria 4635
264 Ga0307510_10384595 3300033180 Bacteria 848
265 Ga0316587_1005772 3300033529 Bacteria 1868
266 Ga0316582_0000852 3300036647 Bacteria 12415
267 Ga0316584_0000875 3300036712 Bacteria 17104
268 Ga0395899_0000091 3300037312 Bacteria 154780
269 Ga0395900_0000008 3300037418 Bacteria 480459
270 Ga0395900_0184048 3300037418 Bacteria 2121
271 Ga0395905_0000114 3300037471 Bacteria 134334
272 Ga0395905_0048162 3300037471 Bacteria 3995
273 Ga0395905_0164315 3300037471 Bacteria 2086
274 Ga0436364_0004663 3300037853 Bacteria 901
275 Ga0436364_0390115 3300037853 Bacteria 2362
276 Ga0436364_1220745 3300037853 Bacteria 1089
277 Ga0436364_1297695 3300037853 Bacteria 9465
278 Ga0436364_1436078 3300037853 Bacteria 2346
279 Ga0395901_0000008 3300038443 Bacteria 495962
280 Ga0400483_183393 3300039062 Bacteria 3561
281 Ga0436365_0370809 3300039437 Bacteria 961
282 Ga0436365_0588054 3300039437 Bacteria 1688
283 Ga0436365_1380562 3300039437 Bacteria 2095
284 Ga0436361_1081907 3300039447 Bacteria 1156
285 Ga0436361_1201302 3300039447 Bacteria 11640
286 Ga0436363_0427729 3300039450 Bacteria 2507
287 Ga0436362_0625556 3300039453 Bacteria 2125
288 Ga0439464_0145065 3300042439 Bacteria 741
289 Ga0466969_0100256 3300044656 Bacteria 1364
290 Ga0453683_0000006 3300044673 Bacteria 586638
291 Ga0466966_0044971 3300044684 Bacteria 2824
292 Ga0453684_0004928 3300044712 Bacteria 27219
293 Ga0453684_0032082 3300044712 Bacteria 7362
294 Ga0453684_0939167 3300044712 Bacteria 924
295 Ga0466971_0042547 3300044719 Bacteria 2041
296 Ga0451576_0000642 3300045051 Bacteria 72433
297 Ga0451576_0036990 3300045051 Bacteria 5172
298 Ga0451576_0234718 3300045051 Bacteria 1915
299 Ga0451576_0317977 3300045051 Bacteria 1629
300 Ga0466967_0773498 3300045976 Bacteria 953
301 Ga0495590_0005512 3300046457 Bacteria 5013
302 Ga0495638_0094677 3300046460 Bacteria 1795
303 Ga0495605_0153675 3300046474 Bacteria 1025
304 Ga0495584_0033008 3300046491 Bacteria 2618
305 Ga0495608_0032408 3300046511 Bacteria 3532
306 Ga0495616_0001065 3300046513 Bacteria 19541
307 Ga0495632_0024860 3300046519 Bacteria 3175
308 Ga0495632_0038789 3300046519 Bacteria 2410
309 Ga0495663_0015634 3300046525 Bacteria 2139
310 Ga0495642_0046001 3300046528 Bacteria 1784
311 Ga0495609_0000449 3300046538 Bacteria 33799
312 Ga0495609_0063534 3300046538 Bacteria 1629
313 Ga0495621_0012045 3300046539 Bacteria 2690
314 Ga0495622_0055622 3300046557 Bacteria 1835
315 Ga0495667_0008861 3300046559 Bacteria 6841
316 Ga0495668_0047455 3300046616 Bacteria 2385
317 Ga0495659_0055348 3300046664 Bacteria 1453
318 Ga0495657_0003771 3300046675 Bacteria 12272
319 Ga0495649_0018333 3300046694 Bacteria 3939
320 Ga0495649_0210348 3300046694 Bacteria 1008
321 Ga0495636_0016966 3300047318 Bacteria 2911
322 Ga0495672_0016407 3300047320 Bacteria 4992
323 Ga0495677_0100032 3300047445 Bacteria 1097
324 Ga0495673_0014648 3300047469 Bacteria 4071
325 Ga0495673_0055247 3300047469 Bacteria 1723
326 Ga0495686_0185040 3300047472 Bacteria 1204
327 Ga0496104_0210797 3300048907 Bacteria 1854
328 Ga0496106_0119933 3300048909 Bacteria 2055
329 Ga0496108_0151799 3300048911 Bacteria 1999
330 Ga0496113_0215498 3300048916 Bacteria 1529
331 Ga0496113_0499033 3300048916 Bacteria 977
332 Ga0496115_0231134 3300048918 Bacteria 1525
333 Ga0496115_0240424 3300048918 Bacteria 1492
334 Ga0496116_0000026 3300048919 Bacteria 450803
335 Ga0496116_0018937 3300048919 Bacteria 5287
336 Ga0496121_0000533 3300048924 Bacteria 72413
337 Ga0496124_0238812 3300048927 Bacteria 1353
338 Ga0496125_0002793 3300048928 Bacteria 22077
339 Ga0496126_0048147 3300048929 Bacteria 3898
340 Ga0496126_0081428 3300048929 Bacteria 2862
341 Ga0495682_0071809 3300049460 Bacteria 1246
342 Ga0501299_025361 3300049522 Bacteria 1113
343 Ga0501032_0175618 3300049569 Unclassified 1403
344 Ga0501047_0007638 3300049581 Bacteria 10182
345 Ga0501075_0438843 3300049591 Bacteria 996
346 Ga0501077_0148610 3300049593 Bacteria 1487
347 nmdc:mga00v17_331881_c1 3300050491 Bacteria 988
348 nmdc:mga0k408_11701_c1 3300050493 Bacteria 4783
349 nmdc:mga05p37_10461_c1 3300050507 Bacteria 11010
350 nmdc:mga05p37_426085_c1 3300050507 Bacteria 1543
351 nmdc:mga05p37_44678_c1 3300050507 Bacteria 5451
352 nmdc:mga05p37_859183_c1 3300050507 Unclassified 984
353 nmdc:mga09592_310442_c1 3300050508 Bacteria 1367
354 nmdc:mga0qj67_252105_c1 3300050509 Bacteria 1432
355 nmdc:mga0qj67_3448_c2 3300050509 Bacteria 5796
356 nmdc:mga0qj67_61106_c1 3300050509 Bacteria 2991
357 nmdc:mga06r32_138378_c1 3300050510 Bacteria 2409
358 nmdc:mga08y16_19479_c1 3300050511 Bacteria 7153
359 nmdc:mga08y16_260318_c1 3300050511 Bacteria 1791
360 nmdc:mga0n895_41868_c1 3300050512 Bacteria 4454
361 nmdc:mga0n895_446900_c1 3300050512 Bacteria 1305
362 nmdc:mga0rr50_187634_c1 3300050513 Bacteria 1693
363 nmdc:mga08x19_497_c1 3300050514 Bacteria 26186
364 nmdc:mga0a205_453530_c1 3300050515 Bacteria 1142
365 nmdc:mga0sz30_28162_c1 3300050516 Bacteria 2310
366 nmdc:mga0sz30_87083_c1 3300050516 Bacteria 1356
367 Ga0500562_011655 3300053108 Bacteria 2232
368 Ga0500568_0026936 3300053139 Bacteria 2408
369 Ga0500590_077719 3300053148 Bacteria 1637
370 Ga0500638_150856 3300053162 Bacteria 1034
371 Ga0500636_0300514 3300053177 Bacteria 791
372 Ga0500645_000940 3300053730 Bacteria 16583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10375796 Ga0207648_103757962 206
2 3300005295 Ga0065707_10315408 Ga0065707_103154081 216
3 3300049522 Ga0501299_025361 Ga0501299_025361_23_757 216
4 3300037853 Ga0436364_0004663 Ga0436364_0004663_19_681 218
5 3300037853 Ga0436364_1220745 Ga0436364_1220745_25_687 218
6 3300031616 Ga0307508_10010392 Ga0307508_100103924 226
7 iso_pu_bacteria 2841957949 2841959151 227
8 3300042439 Ga0439464_0145065 Ga0439464_0145065_23_730 229
9 3300049569 Ga0501032_0175618 Ga0501032_0175618_673_1383 229
10 3300005616 Ga0068852_100066004 Ga0068852_1000660042 230
11 3300037471 Ga0395905_0048162 Ga0395905_0048162_1781_2491 231
12 3300046474 Ga0495605_0153675 Ga0495605_0153675_39_749 231
13 3300046538 Ga0495609_0000449 Ga0495609_0000449_12376_13086 231
14 3300046557 Ga0495622_0055622 Ga0495622_0055622_99_797 231
15 3300047469 Ga0495673_0014648 Ga0495673_0014648_2885_3595 231
16 3300048907 Ga0496104_0210797 Ga0496104_0210797_526_1224 231
17 3300048916 Ga0496113_0499033 Ga0496113_0499033_37_735 231
18 3300048919 Ga0496116_0018937 Ga0496116_0018937_3278_3976 231
19 3300048929 Ga0496126_0048147 Ga0496126_0048147_2220_2918 231
20 3300049460 Ga0495682_0071809 Ga0495682_0071809_25_723 231
21 3300050516 nmdc:mga0sz30_28162_c1 nmdc:mga0sz30_28162_c1_570_1268 231
22 3300053139 Ga0500568_0026936 Ga0500568_0026936_1687_2388 231
23 3300053148 Ga0500590_077719 Ga0500590_077719_475_1173 231
24 3300053162 Ga0500638_150856 Ga0500638_150856_208_906 231
25 3300053177 Ga0500636_0300514 Ga0500636_0300514_73_771 231
26 3300005548 Ga0070665_100010856 Ga0070665_1000108568 235
27 3300028379 Ga0268266_10024703 Ga0268266_100247032 235
28 3300005719 Ga0068861_100018447 Ga0068861_1000184472 236
29 3300006358 Ga0068871_100294824 Ga0068871_1002948242 236
30 3300006844 Ga0075428_100090129 Ga0075428_1000901294 236
31 3300006846 Ga0075430_100100447 Ga0075430_1001004472 236
32 3300006871 Ga0075434_100181997 Ga0075434_1001819972 236
33 3300009553 Ga0105249_10020014 Ga0105249_100200143 236
34 3300025961 Ga0207712_10138473 Ga0207712_101384732 236
35 3300026118 Ga0207675_100035619 Ga0207675_1000356194 236
36 3300050509 nmdc:mga0qj67_252105_c1 nmdc:mga0qj67_252105_c1_70_915 236
37 3300005295 Ga0065707_10270834 Ga0065707_102708341 237
38 3300044673 Ga0453683_0000006 Ga0453683_0000006_48968_49711 238
39 3300045051 Ga0451576_0000642 Ga0451576_0000642_54254_54997 238
40 3300046511 Ga0495608_0032408 Ga0495608_0032408_2656_3447 241
41 3300046559 Ga0495667_0008861 Ga0495667_0008861_2126_2917 241
42 3300046675 Ga0495657_0003771 Ga0495657_0003771_4273_5064 241
43 3300006846 Ga0075430_100019376 Ga0075430_1000193764 244
44 3300021388 Ga0213875_10027271 Ga0213875_100272712 244
45 3300032005 Ga0307411_10356802 Ga0307411_103568022 244
46 3300037853 Ga0436364_0390115 Ga0436364_0390115_1420_2199 244
47 3300037853 Ga0436364_1297695 Ga0436364_1297695_5971_6750 244
48 3300037853 Ga0436364_1436078 Ga0436364_1436078_485_1264 244
49 3300039437 Ga0436365_0588054 Ga0436365_0588054_67_846 244
50 3300044684 Ga0466966_0044971 Ga0466966_0044971_257_1030 244
51 3300046457 Ga0495590_0005512 Ga0495590_0005512_3928_4680 244
52 3300046513 Ga0495616_0001065 Ga0495616_0001065_5102_5854 244
53 3300046519 Ga0495632_0038789 Ga0495632_0038789_1459_2211 244
54 3300046616 Ga0495668_0047455 Ga0495668_0047455_1546_2298 244
55 3300046694 Ga0495649_0018333 Ga0495649_0018333_1794_2546 244
56 3300050509 nmdc:mga0qj67_3448_c2 nmdc:mga0qj67_3448_c2_1123_1899 244
57 3300050516 nmdc:mga0sz30_87083_c1 nmdc:mga0sz30_87083_c1_595_1341 246
58 3300005329 Ga0070683_100001472 Ga0070683_1000014729 247
59 3300005535 Ga0070684_100000983 Ga0070684_10000098317 247
60 3300009093 Ga0105240_10002083 Ga0105240_1000208325 247
61 3300009545 Ga0105237_10032535 Ga0105237_100325353 247
62 3300009551 Ga0105238_10012497 Ga0105238_100124976 247
63 3300013104 Ga0157370_10093300 Ga0157370_100933002 247
64 3300013105 Ga0157369_10021215 Ga0157369_100212155 247
65 3300013307 Ga0157372_10515914 Ga0157372_105159142 247
66 3300025913 Ga0207695_10014184 Ga0207695_100141843 247
67 3300025914 Ga0207671_10076977 Ga0207671_100769772 247
68 3300025924 Ga0207694_10253150 Ga0207694_102531502 247
69 3300025944 Ga0207661_10181780 Ga0207661_101817802 247
70 iso_pu_bacteria 2643221654 2644301315 248
71 3300005331 Ga0070670_100144029 Ga0070670_1001440292 249
72 3300005617 Ga0068859_100676515 Ga0068859_1006765152 249
73 3300006931 Ga0097620_100676428 Ga0097620_1006764282 249
74 3300009177 Ga0105248_10054438 Ga0105248_100544382 249
75 3300013297 Ga0157378_10014258 Ga0157378_100142585 249
76 3300025925 Ga0207650_10025483 Ga0207650_100254832 249
77 3300025941 Ga0207711_10134329 Ga0207711_101343293 249
78 3300045051 Ga0451576_0234718 Ga0451576_0234718_594_1364 249
79 3300025986 Ga0207658_10002599 Ga0207658_1000259910 250
80 iso_pu_bacteria 2889295896 2889299379 250
81 iso_pu_bacteria 2980182181 2980182358 250
82 iso_pu_bacteria 2981284811 2981288850 250
83 iso_pu_bacteria 2981289755 2981293697 250
84 iso_pu_bacteria 2981980479 2981984458 250
85 iso_pu_bacteria 2981985349 2981989414 250
86 iso_pu_bacteria 2513237095 2513648674 251
87 iso_pu_bacteria 2513237101 2513698578 251
88 iso_pu_bacteria 2513237141 2513891770 251
89 iso_pu_bacteria 2585427633 2585994347 251
90 iso_pu_bacteria 2585427634 2585998805 251
91 iso_pu_bacteria 2816332527 2818241910 251
92 iso_pu_bacteria 2824746037 2824747895 251
93 iso_pu_bacteria 2841966195 2841968709 251
94 iso_pu_bacteria 2857576091 2857579566 251
95 iso_pu_bacteria 2881665667 2881667567 251
96 iso_pu_bacteria 2908775508 2908778339 251
97 iso_pu_bacteria 2935638405 2935646887 251
98 iso_pu_bacteria 2935827899 2935836154 251
99 iso_pu_bacteria 2941531003 2941535237 251
100 3300005328 Ga0070676_10032451 Ga0070676_100324512 252
101 3300005334 Ga0068869_100092025 Ga0068869_1000920252 252
102 3300005338 Ga0068868_100181540 Ga0068868_1001815402 252
103 3300005364 Ga0070673_100005402 Ga0070673_1000054023 252
104 3300005364 Ga0070673_100084642 Ga0070673_1000846422 252
105 3300005438 Ga0070701_10004983 Ga0070701_100049834 252
106 3300005440 Ga0070705_100000670 Ga0070705_1000006706 252
107 3300005444 Ga0070694_100003717 Ga0070694_1000037176 252
108 3300005468 Ga0070707_100167265 Ga0070707_1001672652 252
109 3300005471 Ga0070698_100000421 Ga0070698_1000004217 252
110 3300005518 Ga0070699_100011287 Ga0070699_1000112873 252
111 3300005535 Ga0070684_100240993 Ga0070684_1002409932 252
112 3300005536 Ga0070697_100008361 Ga0070697_1000083617 252
113 3300005545 Ga0070695_100015678 Ga0070695_1000156782 252
114 3300005546 Ga0070696_100000070 Ga0070696_1000000709 252
115 3300005546 Ga0070696_100063999 Ga0070696_1000639993 252
116 3300005549 Ga0070704_100003430 Ga0070704_1000034306 252
117 3300005615 Ga0070702_100012951 Ga0070702_1000129515 252
118 3300005617 Ga0068859_100743934 Ga0068859_1007439342 252
119 3300005719 Ga0068861_100068436 Ga0068861_1000684362 252
120 3300005842 Ga0068858_100674301 Ga0068858_1006743011 252
121 3300006844 Ga0075428_100009483 Ga0075428_1000094833 252
122 3300006846 Ga0075430_100046615 Ga0075430_1000466152 252
123 3300006847 Ga0075431_100164401 Ga0075431_1001644012 252
124 3300006852 Ga0075433_10093422 Ga0075433_100934224 252
125 3300006852 Ga0075433_10457416 Ga0075433_104574162 252
126 3300006871 Ga0075434_100063066 Ga0075434_1000630663 252
127 3300006871 Ga0075434_100223386 Ga0075434_1002233862 252
128 3300006881 Ga0068865_100459524 Ga0068865_1004595242 252
129 3300006931 Ga0097620_100743941 Ga0097620_1007439412 252
130 3300009094 Ga0111539_10317622 Ga0111539_103176222 252
131 3300009094 Ga0111539_10353613 Ga0111539_103536132 252
132 3300009098 Ga0105245_10350089 Ga0105245_103500892 252
133 3300009147 Ga0114129_10020657 Ga0114129_100206574 252
134 3300009147 Ga0114129_10048494 Ga0114129_100484942 252
135 3300009147 Ga0114129_10742733 Ga0114129_107427332 252
136 3300009148 Ga0105243_10065313 Ga0105243_100653133 252
137 3300009148 Ga0105243_10190795 Ga0105243_101907952 252
138 3300009176 Ga0105242_10490503 Ga0105242_104905032 252
139 3300009177 Ga0105248_10054054 Ga0105248_100540544 252
140 3300013308 Ga0157375_11086534 Ga0157375_110865341 252
141 3300014745 Ga0157377_10024631 Ga0157377_100246313 252
142 3300025315 Ga0207697_10161113 Ga0207697_101611131 252
143 3300025903 Ga0207680_10008542 Ga0207680_100085423 252
144 3300025907 Ga0207645_10027333 Ga0207645_100273333 252
145 3300025922 Ga0207646_10119929 Ga0207646_101199292 252
146 3300025923 Ga0207681_10302073 Ga0207681_103020732 252
147 3300025926 Ga0207659_10004027 Ga0207659_100040277 252
148 3300025929 Ga0207664_10077985 Ga0207664_100779852 252
149 3300025933 Ga0207706_10205601 Ga0207706_102056012 252
150 3300025935 Ga0207709_10140938 Ga0207709_101409382 252
151 3300025941 Ga0207711_10025958 Ga0207711_100259584 252
152 3300025945 Ga0207679_10341688 Ga0207679_103416882 252
153 3300025960 Ga0207651_10007787 Ga0207651_100077874 252
154 3300025960 Ga0207651_10047446 Ga0207651_100474462 252
155 3300026023 Ga0207677_10458883 Ga0207677_104588832 252
156 3300026035 Ga0207703_10046868 Ga0207703_100468683 252
157 3300026035 Ga0207703_10537470 Ga0207703_105374701 252
158 3300026118 Ga0207675_100279858 Ga0207675_1002798582 252
159 3300044712 Ga0453684_0032082 Ga0453684_0032082_4614_5390 252
160 3300046491 Ga0495584_0033008 Ga0495584_0033008_661_1518 252
161 3300046525 Ga0495663_0015634 Ga0495663_0015634_433_1290 252
162 3300046528 Ga0495642_0046001 Ga0495642_0046001_469_1326 252
163 3300046538 Ga0495609_0063534 Ga0495609_0063534_610_1470 252
164 3300046539 Ga0495621_0012045 Ga0495621_0012045_207_1070 252
165 3300046664 Ga0495659_0055348 Ga0495659_0055348_565_1422 252
166 3300046694 Ga0495649_0210348 Ga0495649_0210348_147_923 252
167 3300047318 Ga0495636_0016966 Ga0495636_0016966_1141_1998 252
168 3300047445 Ga0495677_0100032 Ga0495677_0100032_31_888 252
169 3300048916 Ga0496113_0215498 Ga0496113_0215498_105_881 252
170 3300048918 Ga0496115_0231134 Ga0496115_0231134_442_1218 252
171 3300049591 Ga0501075_0438843 Ga0501075_0438843_139_942 252
172 3300050507 nmdc:mga05p37_10461_c1 nmdc:mga05p37_10461_c1_4351_5205 252
173 3300050507 nmdc:mga05p37_44678_c1 nmdc:mga05p37_44678_c1_392_1243 252
174 3300050507 nmdc:mga05p37_859183_c1 nmdc:mga05p37_859183_c1_114_893 252
175 3300050508 nmdc:mga09592_310442_c1 nmdc:mga09592_310442_c1_437_1285 252
176 3300050509 nmdc:mga0qj67_61106_c1 nmdc:mga0qj67_61106_c1_585_1433 252
177 3300050510 nmdc:mga06r32_138378_c1 nmdc:mga06r32_138378_c1_1000_1848 252
178 3300050511 nmdc:mga08y16_260318_c1 nmdc:mga08y16_260318_c1_577_1425 252
179 3300050515 nmdc:mga0a205_453530_c1 nmdc:mga0a205_453530_c1_29_877 252
180 3300005290 Ga0065712_10010685 Ga0065712_100106852 253
181 3300005295 Ga0065707_10204170 Ga0065707_102041701 253
182 3300005328 Ga0070676_10208637 Ga0070676_102086372 253
183 3300005334 Ga0068869_100059385 Ga0068869_1000593853 253
184 3300005335 Ga0070666_10039032 Ga0070666_100390323 253
185 3300005336 Ga0070680_100072796 Ga0070680_1000727963 253
186 3300005353 Ga0070669_100476452 Ga0070669_1004764521 253
187 3300005355 Ga0070671_100001464 Ga0070671_1000014649 253
188 3300005355 Ga0070671_100062598 Ga0070671_1000625983 253
189 3300005365 Ga0070688_100098992 Ga0070688_1000989922 253
190 3300005365 Ga0070688_100300675 Ga0070688_1003006752 253
191 3300005367 Ga0070667_100003703 Ga0070667_10000370310 253
192 3300005440 Ga0070705_100007798 Ga0070705_1000077984 253
193 3300005441 Ga0070700_100026966 Ga0070700_1000269662 253
194 3300005441 Ga0070700_100323922 Ga0070700_1003239222 253
195 3300005445 Ga0070708_100707444 Ga0070708_1007074441 253
196 3300005458 Ga0070681_10010314 Ga0070681_100103146 253
197 3300005466 Ga0070685_10217005 Ga0070685_102170051 253
198 3300005530 Ga0070679_100000040 Ga0070679_10000004059 253
199 3300005535 Ga0070684_100526081 Ga0070684_1005260812 253
200 3300005536 Ga0070697_100282551 Ga0070697_1002825512 253
201 3300005544 Ga0070686_100076843 Ga0070686_1000768432 253
202 3300005546 Ga0070696_100127734 Ga0070696_1001277342 253
203 3300005546 Ga0070696_100198148 Ga0070696_1001981482 253
204 3300005548 Ga0070665_100003279 Ga0070665_10000327913 253
205 3300005549 Ga0070704_100037902 Ga0070704_1000379022 253
206 3300005563 Ga0068855_100008888 Ga0068855_1000088886 253
207 3300005617 Ga0068859_100000456 Ga0068859_10000045621 253
208 3300005617 Ga0068859_100004984 Ga0068859_1000049845 253
209 3300005719 Ga0068861_100145000 Ga0068861_1001450002 253
210 3300005842 Ga0068858_100000239 Ga0068858_1000002393 253
211 3300005842 Ga0068858_100295450 Ga0068858_1002954502 253
212 3300005843 Ga0068860_100050030 Ga0068860_1000500304 253
213 3300005937 Ga0081455_10000367 Ga0081455_1000036735 253
214 3300005985 Ga0081539_10059642 Ga0081539_100596422 253
215 3300006195 Ga0075366_10021699 Ga0075366_100216993 253
216 3300006237 Ga0097621_100228432 Ga0097621_1002284322 253
217 3300006844 Ga0075428_100312830 Ga0075428_1003128301 253
218 3300006881 Ga0068865_100257491 Ga0068865_1002574912 253
219 3300006931 Ga0097620_100000456 Ga0097620_10000045614 253
220 3300006931 Ga0097620_100004983 Ga0097620_1000049835 253
221 3300007076 Ga0075435_100203397 Ga0075435_1002033972 253
222 3300009093 Ga0105240_10003249 Ga0105240_1000324911 253
223 3300009093 Ga0105240_10020369 Ga0105240_100203696 253
224 3300009101 Ga0105247_10000170 Ga0105247_1000017036 253
225 3300009147 Ga0114129_10000349 Ga0114129_1000034923 253
226 3300009148 Ga0105243_10036903 Ga0105243_100369034 253
227 3300009174 Ga0105241_10300359 Ga0105241_103003592 253
228 3300009176 Ga0105242_10060543 Ga0105242_100605432 253
229 3300009176 Ga0105242_10688343 Ga0105242_106883431 253
230 3300009177 Ga0105248_10023722 Ga0105248_100237224 253
231 3300009545 Ga0105237_10001152 Ga0105237_1000115232 253
232 3300009551 Ga0105238_10049454 Ga0105238_100494543 253
233 3300009553 Ga0105249_10009188 Ga0105249_100091884 253
234 3300010375 Ga0105239_10000248 Ga0105239_1000024832 253
235 3300013104 Ga0157370_10009072 Ga0157370_100090726 253
236 3300013105 Ga0157369_10060913 Ga0157369_100609134 253
237 3300013306 Ga0163162_10084991 Ga0163162_100849913 253
238 3300014325 Ga0163163_10004752 Ga0163163_100047524 253
239 3300014968 Ga0157379_10008222 Ga0157379_100082227 253
240 3300014968 Ga0157379_10250340 Ga0157379_102503401 253
241 3300025907 Ga0207645_10202566 Ga0207645_102025662 253
242 3300025912 Ga0207707_10000232 Ga0207707_100002326 253
243 3300025913 Ga0207695_10032550 Ga0207695_100325504 253
244 3300025913 Ga0207695_10035948 Ga0207695_100359482 253
245 3300025914 Ga0207671_10004764 Ga0207671_100047649 253
246 3300025917 Ga0207660_10057876 Ga0207660_100578763 253
247 3300025921 Ga0207652_10013527 Ga0207652_100135276 253
248 3300025924 Ga0207694_10028815 Ga0207694_100288154 253
249 3300025931 Ga0207644_10013696 Ga0207644_100136964 253
250 3300025934 Ga0207686_10044936 Ga0207686_100449362 253
251 3300025935 Ga0207709_10279181 Ga0207709_102791811 253
252 3300025938 Ga0207704_10077235 Ga0207704_100772352 253
253 3300025941 Ga0207711_10374524 Ga0207711_103745242 253
254 3300025942 Ga0207689_10135345 Ga0207689_101353453 253
255 3300025949 Ga0207667_10008131 Ga0207667_100081315 253
256 3300025960 Ga0207651_10133480 Ga0207651_101334802 253
257 3300025986 Ga0207658_10003048 Ga0207658_100030483 253
258 3300026035 Ga0207703_10004395 Ga0207703_100043953 253
259 3300026075 Ga0207708_10030333 Ga0207708_100303334 253
260 3300026089 Ga0207648_10259942 Ga0207648_102599422 253
261 3300026116 Ga0207674_10101737 Ga0207674_101017371 253
262 3300026116 Ga0207674_10106033 Ga0207674_101060333 253
263 3300026118 Ga0207675_100092035 Ga0207675_1000920353 253
264 3300026118 Ga0207675_100114995 Ga0207675_1001149952 253
265 3300028380 Ga0268265_10026648 Ga0268265_100266484 253
266 3300028381 Ga0268264_10038159 Ga0268264_100381592 253
267 3300028381 Ga0268264_10760048 Ga0268264_107600482 253
268 3300030521 Ga0307511_10000015 Ga0307511_1000001516 253
269 3300031249 Ga0265339_10054370 Ga0265339_100543703 253
270 3300031456 Ga0307513_10026467 Ga0307513_100264675 253
271 3300031507 Ga0307509_10067217 Ga0307509_100672173 253
272 3300031548 Ga0307408_100117499 Ga0307408_1001174992 253
273 3300031691 Ga0316579_10002618 Ga0316579_100026185 253
274 3300031727 Ga0316576_10001213 Ga0316576_100012138 253
275 3300031728 Ga0316578_10000026 Ga0316578_1000002610 253
276 3300031733 Ga0316577_10003660 Ga0316577_100036606 253
277 3300032133 Ga0316583_10071921 Ga0316583_100719212 253
278 3300032137 Ga0316585_10001389 Ga0316585_100013893 253
279 3300032139 Ga0316580_10003192 Ga0316580_100031925 253
280 3300033529 Ga0316587_1005772 Ga0316587_10057722 253
281 3300036647 Ga0316582_0000852 Ga0316582_0000852_4800_5576 253
282 3300036712 Ga0316584_0000875 Ga0316584_0000875_10208_10984 253
283 3300039062 Ga0400483_183393 Ga0400483_183393_1503_2282 253
284 3300039437 Ga0436365_0370809 Ga0436365_0370809_135_911 253
285 3300039437 Ga0436365_1380562 Ga0436365_1380562_866_1642 253
286 3300039450 Ga0436363_0427729 Ga0436363_0427729_1138_1914 253
287 3300039453 Ga0436362_0625556 Ga0436362_0625556_53_829 253
288 3300045051 Ga0451576_0036990 Ga0451576_0036990_2961_3734 253
289 3300045051 Ga0451576_0317977 Ga0451576_0317977_782_1558 253
290 3300045976 Ga0466967_0773498 Ga0466967_0773498_90_872 253
291 3300048909 Ga0496106_0119933 Ga0496106_0119933_999_1775 253
292 3300048911 Ga0496108_0151799 Ga0496108_0151799_34_810 253
293 3300048924 Ga0496121_0000533 Ga0496121_0000533_33201_33977 253
294 3300048928 Ga0496125_0002793 Ga0496125_0002793_607_1383 253
295 3300049593 Ga0501077_0148610 Ga0501077_0148610_556_1395 253
296 3300050493 nmdc:mga0k408_11701_c1 nmdc:mga0k408_11701_c1_2346_3128 253
297 3300050511 nmdc:mga08y16_19479_c1 nmdc:mga08y16_19479_c1_3471_4244 253
298 3300050512 nmdc:mga0n895_41868_c1 nmdc:mga0n895_41868_c1_1433_2209 253
299 3300050513 nmdc:mga0rr50_187634_c1 nmdc:mga0rr50_187634_c1_750_1526 253
300 3300005336 Ga0070680_100259213 Ga0070680_1002592131 254
301 3300005336 Ga0070680_100562358 Ga0070680_1005623581 254
302 3300006173 Ga0070716_100346860 Ga0070716_1003468602 254
303 3300006871 Ga0075434_100302056 Ga0075434_1003020562 254
304 3300006914 Ga0075436_100000141 Ga0075436_10000014114 254
305 3300009147 Ga0114129_10250971 Ga0114129_102509712 254
306 3300026142 Ga0207698_10063184 Ga0207698_100631842 254
307 3300037471 Ga0395905_0000114 Ga0395905_0000114_54861_55628 254
308 3300050507 nmdc:mga05p37_426085_c1 nmdc:mga05p37_426085_c1_355_1146 254
309 3300050512 nmdc:mga0n895_446900_c1 nmdc:mga0n895_446900_c1_124_954 254
310 3300050514 nmdc:mga08x19_497_c1 nmdc:mga08x19_497_c1_17531_18346 254
311 3300003215 JGI25153J46596_10022285 JGI25153J46596_100222852 255
312 3300003354 JGI25160J50197_1004971 JGI25160J50197_10049714 255
313 3300003575 Ga0007409J51694_1040004 Ga0007409J51694_10400042 255
314 3300005336 Ga0070680_100026662 Ga0070680_1000266623 255
315 3300005354 Ga0070675_100094271 Ga0070675_1000942712 255
316 3300005366 Ga0070659_100192727 Ga0070659_1001927272 255
317 3300005434 Ga0070709_10142879 Ga0070709_101428791 255
318 3300005435 Ga0070714_100051464 Ga0070714_1000514643 255
319 3300005530 Ga0070679_100134389 Ga0070679_1001343892 255
320 3300005548 Ga0070665_101026157 Ga0070665_1010261571 255
321 3300005614 Ga0068856_100000837 Ga0068856_1000008372 255
322 3300005614 Ga0068856_100116282 Ga0068856_1001162823 255
323 3300005614 Ga0068856_100158613 Ga0068856_1001586132 255
324 3300005614 Ga0068856_100237099 Ga0068856_1002370992 255
325 3300005616 Ga0068852_100000394 Ga0068852_10000039416 255
326 3300005719 Ga0068861_100448936 Ga0068861_1004489361 255
327 3300006048 Ga0075363_100000126 Ga0075363_1000001268 255
328 3300006051 Ga0075364_10293253 Ga0075364_102932531 255
329 3300006353 Ga0075370_10013904 Ga0075370_100139042 255
330 3300009545 Ga0105237_10311444 Ga0105237_103114442 255
331 3300009551 Ga0105238_10014085 Ga0105238_100140853 255
332 3300013104 Ga0157370_10008202 Ga0157370_100082027 255
333 3300013105 Ga0157369_10457681 Ga0157369_104576812 255
334 3300014325 Ga0163163_10045735 Ga0163163_100457355 255
335 3300025250 Ga0209026_1000539 Ga0209026_100053911 255
336 3300025297 Ga0209758_1000516 Ga0209758_100051613 255
337 3300025297 Ga0209758_1039434 Ga0209758_10394342 255
338 3300025298 Ga0209050_1000090 Ga0209050_100009047 255
339 3300025302 Ga0207426_1000160 Ga0207426_1000160105 255
340 3300025304 Ga0209257_1002389 Ga0209257_100238911 255
341 3300025304 Ga0209257_1002767 Ga0209257_10027677 255
342 3300025912 Ga0207707_10093616 Ga0207707_100936162 255
343 3300025913 Ga0207695_10004555 Ga0207695_1000455511 255
344 3300025921 Ga0207652_10153700 Ga0207652_101537002 255
345 3300025924 Ga0207694_10016410 Ga0207694_100164103 255
346 3300025939 Ga0207665_10021719 Ga0207665_100217193 255
347 3300026078 Ga0207702_10005199 Ga0207702_100051992 255
348 3300026078 Ga0207702_10260312 Ga0207702_102603121 255
349 3300028563 Ga0265319_1003866 Ga0265319_10038664 255
350 3300028786 Ga0307517_10008378 Ga0307517_100083788 255
351 3300028794 Ga0307515_10002251 Ga0307515_1000225134 255
352 3300031235 Ga0265330_10000028 Ga0265330_10000028127 255
353 3300031238 Ga0265332_10000004 Ga0265332_10000004340 255
354 3300031344 Ga0265316_10006307 Ga0265316_1000630710 255
355 3300031456 Ga0307513_10011268 Ga0307513_1001126812 255
356 3300031456 Ga0307513_10024220 Ga0307513_100242202 255
357 3300031507 Ga0307509_10069562 Ga0307509_100695623 255
358 3300031548 Ga0307408_100030019 Ga0307408_1000300194 255
359 3300031649 Ga0307514_10018767 Ga0307514_100187674 255
360 3300031691 Ga0316579_10151902 Ga0316579_101519022 255
361 3300031712 Ga0265342_10000015 Ga0265342_1000001572 255
362 3300031731 Ga0307405_10011570 Ga0307405_100115702 255
363 3300031824 Ga0307413_10155492 Ga0307413_101554922 255
364 3300031852 Ga0307410_10051725 Ga0307410_100517252 255
365 3300031901 Ga0307406_10025314 Ga0307406_100253142 255
366 3300031911 Ga0307412_10059446 Ga0307412_100594462 255
367 3300031995 Ga0307409_100042497 Ga0307409_1000424973 255
368 3300032002 Ga0307416_100018000 Ga0307416_1000180003 255
369 3300032005 Ga0307411_10005140 Ga0307411_100051404 255
370 3300033180 Ga0307510_10384595 Ga0307510_103845951 255
371 3300037312 Ga0395899_0000091 Ga0395899_0000091_49233_50000 255
372 3300037418 Ga0395900_0000008 Ga0395900_0000008_374912_375679 255
373 3300037418 Ga0395900_0184048 Ga0395900_0184048_435_1208 255
374 3300037471 Ga0395905_0164315 Ga0395905_0164315_603_1376 255
375 3300038443 Ga0395901_0000008 Ga0395901_0000008_104781_105548 255
376 3300039447 Ga0436361_1081907 Ga0436361_1081907_278_1051 255
377 3300039447 Ga0436361_1201302 Ga0436361_1201302_5877_6650 255
378 3300044656 Ga0466969_0100256 Ga0466969_0100256_204_977 255
379 3300044712 Ga0453684_0004928 Ga0453684_0004928_1104_1913 255
380 3300044712 Ga0453684_0939167 Ga0453684_0939167_135_902 255
381 3300044719 Ga0466971_0042547 Ga0466971_0042547_1124_1897 255
382 3300046460 Ga0495638_0094677 Ga0495638_0094677_228_1028 255
383 3300046519 Ga0495632_0024860 Ga0495632_0024860_1286_2059 255
384 3300047320 Ga0495672_0016407 Ga0495672_0016407_3348_4115 255
385 3300047469 Ga0495673_0055247 Ga0495673_0055247_863_1636 255
386 3300047472 Ga0495686_0185040 Ga0495686_0185040_175_942 255
387 3300048918 Ga0496115_0240424 Ga0496115_0240424_368_1141 255
388 3300048919 Ga0496116_0000026 Ga0496116_0000026_295725_296555 255
389 3300048927 Ga0496124_0238812 Ga0496124_0238812_401_1246 255
390 3300048929 Ga0496126_0081428 Ga0496126_0081428_1509_2282 255
391 3300049581 Ga0501047_0007638 Ga0501047_0007638_4354_5121 255
392 3300050491 nmdc:mga00v17_331881_c1 nmdc:mga00v17_331881_c1_72_845 255
393 3300053108 Ga0500562_011655 Ga0500562_011655_1121_1888 255
394 3300053730 Ga0500645_000940 Ga0500645_000940_14325_15092 255
395 iso_pu_bacteria 2585427634 2586003708 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

32

263

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9272 2 254
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.914 2 254
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9024 2 254
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8931 2 254
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8435 1 249
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9272 2 254 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9024 2 254 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8454 94 233 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8379 1 247 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8305 1 247 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A257GWQ9-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9842 1 136 GO:0009058
GO:0047343
AF-A0A258KUJ6-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9812 1 147 GO:0009058
GO:0047343
AF-A0A7V0UHJ4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9784 1 254 GO:0009243
GO:0047343
AF-A0A382RYG7-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9766 1 135 GO:0009058
GO:0047343
AF-A0A4Q3T577-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9737 1 255 GO:0009243
GO:0047343

Feature Viewer

pLDDT pTM Quality
91.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map