F433197

General Info

Members Datasets Scaffolds Average Seq Length
395 199 790 190

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11171090|Ga0114129_111710902
Length 212
Sequence MRWLRLFRGGLILAAFPDPEVVLTSSRDVTGLLRGWSRGNHSALNQLLPLVYAELRRIAARQLRSERADHTLQPTALVHEVYLRLVDQRRVDWQNRAHFFGVAAQVMRRILVDYARRRGASKRGEGVRCVSIDEAKHAAASNEMPVLALDHALDRLEKVDSELAKIVELRAFGGLTIEEAAHVLRVSPSTAKRDWRTAKAWLNRELGSEVRQ

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.29
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 19.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11171090 3300009147 Unclassified 959
2 MRS1b_contig_915325 2162886011 Bacteria 1503
3 JGI24751J29686_10055858 3300002459 Bacteria 814
4 JGI25406J46586_10000582 3300003203 Bacteria 17234
5 JGI25406J46586_10002709 3300003203 Bacteria 8352
6 Ga0065704_10075900 3300005289 Bacteria 5363
7 Ga0065712_10067825 3300005290 Bacteria 27922
8 Ga0065712_10072651 3300005290 Bacteria 4667
9 Ga0065715_10126758 3300005293 Unclassified 2102
10 Ga0065707_10085558 3300005295 Bacteria 6066
11 Ga0070690_100123632 3300005330 Bacteria 1739
12 Ga0070690_100661737 3300005330 Bacteria 799
13 Ga0070670_100292929 3300005331 Bacteria 1423
14 Ga0070670_100303436 3300005331 Bacteria 1397
15 Ga0068869_100017784 3300005334 Bacteria 4829
16 Ga0068868_100777477 3300005338 Unclassified 862
17 Ga0068868_101149498 3300005338 Bacteria 716
18 Ga0070660_100354438 3300005339 Bacteria 1209
19 Ga0070668_100239918 3300005347 Bacteria 1501
20 Ga0070668_100251300 3300005347 Bacteria 1468
21 Ga0070669_100085978 3300005353 Bacteria 2349
22 Ga0070675_100006882 3300005354 Bacteria 8729
23 Ga0070675_100008101 3300005354 Bacteria 8146
24 Ga0070675_100020770 3300005354 Bacteria 5241
25 Ga0070675_100227184 3300005354 Bacteria 1627
26 Ga0070675_100684613 3300005354 Unclassified 933
27 Ga0070671_100808199 3300005355 Bacteria 817
28 Ga0070674_100056688 3300005356 Bacteria 2717
29 Ga0070673_100348294 3300005364 Unclassified 1314
30 Ga0070688_100049024 3300005365 Bacteria 2627
31 Ga0070688_100140629 3300005365 Bacteria 1639
32 Ga0070667_100287855 3300005367 Bacteria 1477
33 Ga0070667_101025163 3300005367 Unclassified 770
34 Ga0070705_100003805 3300005440 Bacteria 7381
35 Ga0070700_100266859 3300005441 Bacteria 1235
36 Ga0070694_100007176 3300005444 Bacteria 6785
37 Ga0070694_100085891 3300005444 Bacteria 2198
38 Ga0070708_100563871 3300005445 Bacteria 1074
39 Ga0070708_100907346 3300005445 Bacteria 827
40 Ga0070663_100388412 3300005455 Unclassified 1138
41 Ga0070678_100667069 3300005456 Bacteria 934
42 Ga0070662_100226034 3300005457 Bacteria 1495
43 Ga0070698_100284565 3300005471 Unclassified 1585
44 Ga0070698_100362304 3300005471 Bacteria 1382
45 Ga0070698_100541531 3300005471 Bacteria 1103
46 Ga0070699_100013919 3300005518 Bacteria 6919
47 Ga0070699_100077608 3300005518 Bacteria 2892
48 Ga0070699_100617675 3300005518 Bacteria 989
49 Ga0070697_100430725 3300005536 Unclassified 1147
50 Ga0070672_100056655 3300005543 Bacteria 3075
51 Ga0070672_100056706 3300005543 Bacteria 3073
52 Ga0070672_100165719 3300005543 Bacteria 1835
53 Ga0070672_100519860 3300005543 Unclassified 1031
54 Ga0070672_100653967 3300005543 Unclassified 918
55 Ga0070695_100000032 3300005545 Bacteria 53084
56 Ga0070695_100349539 3300005545 Bacteria 1107
57 Ga0070696_100000294 3300005546 Bacteria 30113
58 Ga0070696_100025221 3300005546 Bacteria 4041
59 Ga0070696_100658774 3300005546 Unclassified 849
60 Ga0070704_100023970 3300005549 Bacteria 3997
61 Ga0070704_100041882 3300005549 Bacteria 3164
62 Ga0070664_100212331 3300005564 Bacteria 1730
63 Ga0070702_100006021 3300005615 Bacteria 5709
64 Ga0068859_100072521 3300005617 Bacteria 3480
65 Ga0068859_100125720 3300005617 Bacteria 2633
66 Ga0068859_100218589 3300005617 Bacteria 1993
67 Ga0068859_100392372 3300005617 Bacteria 1484
68 Ga0068859_100722952 3300005617 Unclassified 1086
69 Ga0068864_100204536 3300005618 Bacteria 1815
70 Ga0068861_100164765 3300005719 Bacteria 1832
71 Ga0068851_10002039 3300005834 Bacteria 8912
72 Ga0068870_10007362 3300005840 Bacteria 4902
73 Ga0068870_10133707 3300005840 Bacteria 1444
74 Ga0068870_10320960 3300005840 Bacteria 984
75 Ga0068863_100191084 3300005841 Bacteria 1968
76 Ga0068860_100085554 3300005843 Bacteria 3001
77 Ga0068862_100069545 3300005844 Bacteria 3039
78 Ga0081455_10008539 3300005937 Bacteria 10631
79 Ga0081455_10011684 3300005937 Bacteria 8806
80 Ga0081455_10482787 3300005937 Unclassified 837
81 Ga0081455_10555897 3300005937 Unclassified 758
82 Ga0081540_1185710 3300005983 Unclassified 772
83 Ga0081539_10000010 3300005985 Bacteria 484386
84 Ga0081539_10000133 3300005985 Bacteria 173855
85 Ga0081539_10009127 3300005985 Bacteria 8381
86 Ga0075427_10055021 3300006194 Unclassified 690
87 Ga0075428_100005938 3300006844 Bacteria 13569
88 Ga0075428_100015737 3300006844 Bacteria 8382
89 Ga0075428_100052606 3300006844 Unclassified 4462
90 Ga0075428_100068920 3300006844 Bacteria 3869
91 Ga0075428_100098571 3300006844 Unclassified 3186
92 Ga0075428_100113688 3300006844 Bacteria 2949
93 Ga0075430_100012626 3300006846 Bacteria 7193
94 Ga0075430_100105984 3300006846 Bacteria 2346
95 Ga0075431_100018030 3300006847 Bacteria 7181
96 Ga0075431_100029680 3300006847 Bacteria 5630
97 Ga0075431_100031833 3300006847 Bacteria 5433
98 Ga0075431_100130057 3300006847 Unclassified 2597
99 Ga0075431_100264968 3300006847 Bacteria 1743
100 Ga0075431_100280049 3300006847 Bacteria 1688
101 Ga0075431_100337626 3300006847 Unclassified 1517
102 Ga0075431_100340627 3300006847 Bacteria 1509
103 Ga0075431_100618575 3300006847 Unclassified 1066
104 Ga0075433_10009677 3300006852 Bacteria 7716
105 Ga0075433_10063495 3300006852 Bacteria 3236
106 Ga0075433_10100799 3300006852 Bacteria 2557
107 Ga0075434_100163193 3300006871 Bacteria 2248
108 Ga0075434_100206647 3300006871 Bacteria 1984
109 Ga0075434_100390031 3300006871 Bacteria 1414
110 Ga0075434_100769162 3300006871 Bacteria 980
111 Ga0075429_100148040 3300006880 Bacteria 2055
112 Ga0075429_100277665 3300006880 Bacteria 1467
113 Ga0068865_100169523 3300006881 Unclassified 1672
114 Ga0068865_100524744 3300006881 Unclassified 991
115 Ga0075436_100205869 3300006914 Unclassified 1394
116 Ga0097620_100072521 3300006931 Bacteria 3480
117 Ga0097620_100125722 3300006931 Bacteria 2633
118 Ga0097620_100218583 3300006931 Bacteria 1993
119 Ga0097620_100392320 3300006931 Bacteria 1484
120 Ga0097620_100722981 3300006931 Unclassified 1086
121 Ga0099794_10007842 3300007265 Bacteria 4409
122 Ga0111539_10000680 3300009094 Bacteria 44027
123 Ga0111539_10016754 3300009094 Bacteria 9083
124 Ga0111539_10069557 3300009094 Bacteria 4156
125 Ga0111539_10075111 3300009094 Bacteria 3982
126 Ga0111539_10146492 3300009094 Bacteria 2765
127 Ga0111539_10302560 3300009094 Bacteria 1861
128 Ga0111539_10412723 3300009094 Bacteria 1572
129 Ga0105245_10517810 3300009098 Bacteria 1211
130 Ga0114129_10002417 3300009147 Bacteria 25932
131 Ga0114129_10009953 3300009147 Bacteria 13553
132 Ga0114129_10034916 3300009147 Bacteria 7103
133 Ga0114129_10053438 3300009147 Bacteria 5665
134 Ga0114129_10053895 3300009147 Bacteria 5641
135 Ga0114129_10089607 3300009147 Bacteria 4264
136 Ga0114129_10115898 3300009147 Bacteria 3692
137 Ga0114129_10482231 3300009147 Bacteria 1622
138 Ga0114129_10754302 3300009147 Unclassified 1245
139 Ga0105243_10008214 3300009148 Bacteria 8019
140 Ga0105243_10435034 3300009148 Unclassified 1227
141 Ga0105241_10091529 3300009174 Unclassified 2400
142 Ga0105242_10027769 3300009176 Bacteria 4499
143 Ga0105248_10100533 3300009177 Bacteria 3259
144 Ga0105248_10561028 3300009177 Bacteria 1288
145 Ga0105238_10003204 3300009551 Bacteria 16337
146 Ga0105249_10189380 3300009553 Bacteria 2007
147 Ga0105249_10443310 3300009553 Bacteria 1336
148 Ga0157370_10127917 3300013104 Bacteria 2371
149 Ga0157374_11516840 3300013296 Unclassified 694
150 Ga0157378_10063137 3300013297 Bacteria 3309
151 Ga0157378_11153766 3300013297 Bacteria 813
152 Ga0157378_11581821 3300013297 Unclassified 701
153 Ga0163162_11303955 3300013306 Unclassified 825
154 Ga0157372_10301650 3300013307 Bacteria 1863
155 Ga0157372_10459280 3300013307 Bacteria 1484
156 Ga0157375_10704232 3300013308 Bacteria 1163
157 Ga0163163_10889437 3300014325 Bacteria 954
158 Ga0157380_10298956 3300014326 Bacteria 1482
159 Ga0157377_10266170 3300014745 Bacteria 1117
160 Ga0157379_10328337 3300014968 Bacteria 1397
161 Ga0213875_10002219 3300021388 Bacteria 11820
162 Ga0207656_10254052 3300025321 Unclassified 862
163 Ga0207653_10098731 3300025885 Bacteria 1030
164 Ga0207688_10246450 3300025901 Unclassified 1081
165 Ga0207680_10209953 3300025903 Bacteria 1331
166 Ga0207643_10019220 3300025908 Bacteria 3743
167 Ga0207643_10506576 3300025908 Bacteria 772
168 Ga0207649_10529038 3300025920 Bacteria 900
169 Ga0207681_10558097 3300025923 Unclassified 943
170 Ga0207694_10003524 3300025924 Bacteria 12423
171 Ga0207650_10203529 3300025925 Bacteria 1587
172 Ga0207650_10280517 3300025925 Bacteria 1357
173 Ga0207650_11226217 3300025925 Bacteria 639
174 Ga0207659_10006636 3300025926 Bacteria 7107
175 Ga0207659_10010291 3300025926 Bacteria 5871
176 Ga0207659_10022875 3300025926 Bacteria 4167
177 Ga0207659_10212978 3300025926 Bacteria 1550
178 Ga0207659_10213642 3300025926 Bacteria 1547
179 Ga0207659_10560359 3300025926 Bacteria 972
180 Ga0207706_10405644 3300025933 Bacteria 1181
181 Ga0207686_10132526 3300025934 Bacteria 1711
182 Ga0207709_10032578 3300025935 Bacteria 3053
183 Ga0207670_10018566 3300025936 Bacteria 4232
184 Ga0207669_10267225 3300025937 Unclassified 1283
185 Ga0207704_10073530 3300025938 Bacteria 2177
186 Ga0207704_10139835 3300025938 Unclassified 1692
187 Ga0207704_10620590 3300025938 Unclassified 887
188 Ga0207691_10077278 3300025940 Bacteria 2999
189 Ga0207691_10174354 3300025940 Unclassified 1882
190 Ga0207691_10601278 3300025940 Unclassified 931
191 Ga0207689_10010123 3300025942 Bacteria 8130
192 Ga0207689_10175490 3300025942 Bacteria 1767
193 Ga0207679_10297661 3300025945 Bacteria 1389
194 Ga0207651_10349762 3300025960 Bacteria 1244
195 Ga0207712_10089282 3300025961 Bacteria 2265
196 Ga0207677_10386230 3300026023 Bacteria 1183
197 Ga0207677_10837165 3300026023 Unclassified 826
198 Ga0207678_10355395 3300026067 Unclassified 1264
199 Ga0207708_10209842 3300026075 Bacteria 1556
200 Ga0207641_10041355 3300026088 Bacteria 3863
201 Ga0207675_100102374 3300026118 Bacteria 2699
202 Ga0207675_100499954 3300026118 Bacteria 1210
203 Ga0207683_10195327 3300026121 Bacteria 1838
204 Ga0209971_1013997 3300027682 Bacteria 1901
205 Ga0209974_10044382 3300027876 Unclassified 1483
206 Ga0207428_10002273 3300027907 Bacteria 19278
207 Ga0207428_10035617 3300027907 Bacteria 4067
208 Ga0207428_10036363 3300027907 Bacteria 4017
209 Ga0207428_10151448 3300027907 Bacteria 1765
210 Ga0268265_10040286 3300028380 Bacteria 3450
211 Ga0268265_10542891 3300028380 Bacteria 1102
212 Ga0268264_10646767 3300028381 Unclassified 1046
213 Ga0265326_10007319 3300028558 Bacteria 3391
214 Ga0265319_1005680 3300028563 Bacteria 5923
215 Ga0265334_10001346 3300028573 Bacteria 11870
216 Ga0265318_10000277 3300028577 Bacteria 42980
217 Ga0265338_10096773 3300028800 Bacteria 2420
218 Ga0265328_10020995 3300031239 Bacteria 2496
219 Ga0265339_10028731 3300031249 Bacteria 3160
220 Ga0265331_10041642 3300031250 Unclassified 2231
221 Ga0307408_100016829 3300031548 Bacteria 4887
222 Ga0265313_10021076 3300031595 Bacteria 3574
223 Ga0265342_10003824 3300031712 Bacteria 12120
224 Ga0307405_10001000 3300031731 Bacteria 11399
225 Ga0307405_10342956 3300031731 Bacteria 1149
226 Ga0307413_10015376 3300031824 Bacteria 3919
227 Ga0307413_10220193 3300031824 Unclassified 1386
228 Ga0307413_10530341 3300031824 Bacteria 951
229 Ga0307410_10008547 3300031852 Bacteria 5685
230 Ga0307410_10172860 3300031852 Bacteria 1629
231 Ga0307410_10382684 3300031852 Bacteria 1132
232 Ga0307406_10002648 3300031901 Bacteria 9750
233 Ga0307406_10063210 3300031901 Bacteria 2397
234 Ga0307406_10342252 3300031901 Bacteria 1165
235 Ga0307407_10012394 3300031903 Bacteria 4095
236 Ga0307412_10004216 3300031911 Bacteria 8017
237 Ga0307412_10684518 3300031911 Bacteria 878
238 Ga0307409_100007831 3300031995 Bacteria 6429
239 Ga0307409_100106100 3300031995 Bacteria 2344
240 Ga0307409_101011969 3300031995 Unclassified 849
241 Ga0307416_100026846 3300032002 Bacteria 4251
242 Ga0307416_100168677 3300032002 Unclassified 2034
243 Ga0307416_101279337 3300032002 Unclassified 839
244 Ga0307414_10011333 3300032004 Bacteria 5224
245 Ga0307411_10048694 3300032005 Bacteria 2748
246 Ga0307411_10051808 3300032005 Bacteria 2680
247 Ga0307415_100032137 3300032126 Bacteria 3390
248 Ga0307415_100383428 3300032126 Bacteria 1194
249 Ga0307415_100714985 3300032126 Bacteria 905
250 Ga0373939_0029619 3300035114 Bacteria 1568
251 Ga0373937_0076003 3300036401 Unclassified 3102
252 Ga0436364_1140111 3300037853 Bacteria 23456
253 Ga0439441_052346 3300042001 Bacteria 844
254 Ga0439449_0033962 3300042007 Bacteria 1900
255 Ga0439450_007802 3300042008 Bacteria 1974
256 Ga0450920_087773 3300042122 Bacteria 640
257 Ga0439435_0207321 3300042436 Bacteria 648
258 Ga0439464_0002583 3300042439 Unclassified 4473
259 Ga0439464_0003652 3300042439 Bacteria 3901
260 Ga0451577_0094912 3300042876 Bacteria 2663
261 Ga0451577_0214550 3300042876 Bacteria 1739
262 Ga0451577_1032754 3300042876 Bacteria 737
263 Ga0439440_0029931 3300042993 Bacteria 1280
264 Ga0439440_0036870 3300042993 Bacteria 1178
265 Ga0453684_0065519 3300044712 Bacteria 4633
266 Ga0451576_0061586 3300045051 Bacteria 3913
267 Ga0451576_0075926 3300045051 Bacteria 3497
268 Ga0451576_0156432 3300045051 Bacteria 2378
269 Ga0451576_1229126 3300045051 Unclassified 782
270 Ga0451576_1467409 3300045051 Unclassified 709
271 Ga0495580_0266449 3300046472 Bacteria 1171
272 Ga0495580_0433946 3300046472 Bacteria 883
273 Ga0495584_0180342 3300046491 Bacteria 1073
274 Ga0495642_0037067 3300046528 Bacteria 1972
275 Ga0495598_0003501 3300046537 Bacteria 3343
276 Ga0495598_0240631 3300046537 Unclassified 667
277 Ga0495622_0056099 3300046557 Bacteria 1827
278 Ga0495656_0274238 3300046615 Bacteria 858
279 Ga0495668_0002753 3300046616 Bacteria 14049
280 Ga0495647_0149625 3300046681 Bacteria 1000
281 Ga0495658_0459040 3300046683 Bacteria 814
282 Ga0495684_0287644 3300047471 Bacteria 1184
283 Ga0496100_0635957 3300048903 Unclassified 830
284 Ga0496102_0063594 3300048905 Unclassified 3379
285 Ga0496102_0933299 3300048905 Unclassified 789
286 Ga0496103_0573514 3300048906 Bacteria 720
287 Ga0496108_0496977 3300048911 Bacteria 1065
288 Ga0496108_0511553 3300048911 Bacteria 1048
289 Ga0496109_0147829 3300048912 Bacteria 2199
290 Ga0496109_0527825 3300048912 Bacteria 1114
291 Ga0496109_0990325 3300048912 Unclassified 778
292 Ga0496110_0806268 3300048913 Unclassified 843
293 Ga0496113_0107692 3300048916 Bacteria 2166
294 Ga0496113_0246834 3300048916 Bacteria 1425
295 Ga0496114_0779827 3300048917 Bacteria 834
296 Ga0501031_0226193 3300049568 Bacteria 1218
297 Ga0501036_0290151 3300049572 Unclassified 1369
298 Ga0501038_0027647 3300049574 Bacteria 5045
299 Ga0501039_0110851 3300049575 Bacteria 2145
300 Ga0501039_0520173 3300049575 Bacteria 934
301 Ga0501039_0729426 3300049575 Unclassified 774
302 Ga0501040_0017602 3300049576 Bacteria 4745
303 Ga0501040_0286248 3300049576 Bacteria 1177
304 Ga0501040_0694184 3300049576 Unclassified 736
305 Ga0501041_0192662 3300049577 Unclassified 1277
306 Ga0501042_0014557 3300049578 Bacteria 5372
307 Ga0501042_0038857 3300049578 Bacteria 3380
308 Ga0501043_0048559 3300049579 Bacteria 3337
309 Ga0501043_0272456 3300049579 Bacteria 1299
310 Ga0501046_0125774 3300049580 Bacteria 1947
311 Ga0501046_0156494 3300049580 Bacteria 1716
312 Ga0501048_0165424 3300049582 Bacteria 1566
313 Ga0501048_0169743 3300049582 Bacteria 1545
314 Ga0501068_0163821 3300049584 Bacteria 1402
315 Ga0501071_0188161 3300049587 Bacteria 1548
316 Ga0501071_0302133 3300049587 Bacteria 1213
317 Ga0501071_0313604 3300049587 Bacteria 1190
318 Ga0501072_0008787 3300049588 Bacteria 7671
319 Ga0501072_0023408 3300049588 Bacteria 4798
320 Ga0501072_0524706 3300049588 Bacteria 936
321 Ga0501073_0318788 3300049589 Bacteria 1073
322 Ga0501073_0882874 3300049589 Bacteria 616
323 Ga0501074_0031524 3300049590 Bacteria 3840
324 Ga0501074_0575525 3300049590 Bacteria 797
325 Ga0501075_0012894 3300049591 Bacteria 5952
326 Ga0501075_0049342 3300049591 Bacteria 3164
327 Ga0501075_0133938 3300049591 Bacteria 1887
328 Ga0501075_0293150 3300049591 Bacteria 1239
329 Ga0501075_0424821 3300049591 Bacteria 1013
330 Ga0501076_0035508 3300049592 Bacteria 3900
331 Ga0501076_0114299 3300049592 Bacteria 2184
332 Ga0501076_0125907 3300049592 Unclassified 2076
333 Ga0501076_0130671 3300049592 Bacteria 2036
334 Ga0501076_0375572 3300049592 Unclassified 1168
335 Ga0501077_0038373 3300049593 Bacteria 3050
336 Ga0501202_099075 3300049652 Unclassified 707
337 Ga0501079_0061872 3300049741 Bacteria 2887
338 Ga0501079_0184690 3300049741 Bacteria 1627
339 Ga0501080_0334766 3300049742 Bacteria 1368
340 Ga0501081_0007257 3300049743 Bacteria 7208
341 Ga0501081_0100742 3300049743 Bacteria 2042
342 Ga0501081_0483380 3300049743 Unclassified 922
343 Ga0501081_1032909 3300049743 Bacteria 621
344 Ga0501265_050748 3300049762 Unclassified 652
345 Ga0501283_005390 3300049779 Unclassified 1758
346 Ga0501035_0193076 3300049822 Unclassified 1750
347 Ga0501035_0381860 3300049822 Bacteria 1175
348 Ga0501045_0134298 3300049824 Unclassified 1840
349 Ga0501045_0215339 3300049824 Unclassified 1430
350 Ga0501045_0388236 3300049824 Bacteria 1039
351 Ga0501045_0470665 3300049824 Bacteria 934
352 nmdc:mga05p37_15874_c1 3300050507 Bacteria 9058
353 nmdc:mga05p37_16303_c1 3300050507 Bacteria 8944
354 nmdc:mga05p37_193050_c1 3300050507 Bacteria 2471
355 nmdc:mga05p37_196570_c1 3300050507 Bacteria 2445
356 nmdc:mga05p37_25722_c1 3300050507 Bacteria 7158
357 nmdc:mga05p37_429965_c1 3300050507 Bacteria 1534
358 nmdc:mga05p37_8942_c1 3300050507 Bacteria 11843
359 nmdc:mga05p37_9773_c1 3300050507 Bacteria 11380
360 nmdc:mga09592_357974_c1 3300050508 Bacteria 1263
361 nmdc:mga0qj67_108692_c1 3300050509 Bacteria 2238
362 nmdc:mga0qj67_94526_c1 3300050509 Bacteria 2404
363 nmdc:mga06r32_13541_c1 3300050510 Bacteria 7391
364 nmdc:mga06r32_198436_c1 3300050510 Bacteria 1994
365 nmdc:mga06r32_24876_c1 3300050510 Bacteria 5565
366 nmdc:mga06r32_255758_c1 3300050510 Bacteria 1739
367 nmdc:mga06r32_257291_c1 3300050510 Bacteria 1733
368 nmdc:mga06r32_29549_c1 3300050510 Bacteria 5139
369 nmdc:mga06r32_337540_c1 3300050510 Bacteria 1492
370 nmdc:mga06r32_392993_c1 3300050510 Bacteria 1369
371 nmdc:mga06r32_417016_c1 3300050510 Unclassified 1324
372 nmdc:mga08y16_15485_c1 3300050511 Bacteria 8020
373 nmdc:mga08y16_1562_c1 3300050511 Bacteria 23091
374 nmdc:mga08y16_171900_c1 3300050511 Bacteria 2251
375 nmdc:mga08y16_313549_c1 3300050511 Bacteria 1615
376 nmdc:mga08y16_66004_c1 3300050511 Bacteria 3777
377 nmdc:mga08y16_83524_c1 3300050511 Bacteria 3329
378 nmdc:mga08y16_943237_c1 3300050511 Bacteria 846
379 nmdc:mga0n895_156666_c1 3300050512 Bacteria 2308
380 nmdc:mga0n895_204660_c1 3300050512 Bacteria 2004
381 nmdc:mga0n895_332914_c1 3300050512 Unclassified 1538
382 nmdc:mga0n895_369488_c1 3300050512 Bacteria 1452
383 nmdc:mga0a205_12474_c1 3300050515 Bacteria 5665
384 nmdc:mga0a205_15347_c1 3300050515 Bacteria 7157
385 nmdc:mga0a205_209061_c1 3300050515 Unclassified 1840
386 nmdc:mga0a205_90375_c1 3300050515 Bacteria 2959
387 Ga0501084_0006610 3300054114 Bacteria 9533
388 Ga0501084_0041657 3300054114 Unclassified 3842
389 Ga0501084_0359790 3300054114 Bacteria 1230
390 Ga0501084_0475140 3300054114 Unclassified 1057
391 Ga0501082_0148664 3300060353 Bacteria 2034
392 Ga0501082_0329370 3300060353 Bacteria 1330
393 Ga0501082_0733365 3300060353 Bacteria 865
394 Ga0530510_0140115 3300061734 Bacteria 1782
395 Ga0530510_0205489 3300061734 Bacteria 1464
396 Ga0114129_11171090
397 MRS1b_contig_915325
398 JGI24751J29686_10055858
399 JGI25406J46586_10000582
400 JGI25406J46586_10002709
401 Ga0065704_10075900
402 Ga0065712_10067825
403 Ga0065712_10072651
404 Ga0065715_10126758
405 Ga0065707_10085558
406 Ga0070690_100123632
407 Ga0070690_100661737
408 Ga0070670_100292929
409 Ga0070670_100303436
410 Ga0068869_100017784
411 Ga0068868_100777477
412 Ga0068868_101149498
413 Ga0070660_100354438
414 Ga0070668_100239918
415 Ga0070668_100251300
416 Ga0070669_100085978
417 Ga0070675_100006882
418 Ga0070675_100008101
419 Ga0070675_100020770
420 Ga0070675_100227184
421 Ga0070675_100684613
422 Ga0070671_100808199
423 Ga0070674_100056688
424 Ga0070673_100348294
425 Ga0070688_100049024
426 Ga0070688_100140629
427 Ga0070667_100287855
428 Ga0070667_101025163
429 Ga0070705_100003805
430 Ga0070700_100266859
431 Ga0070694_100007176
432 Ga0070694_100085891
433 Ga0070708_100563871
434 Ga0070708_100907346
435 Ga0070663_100388412
436 Ga0070678_100667069
437 Ga0070662_100226034
438 Ga0070698_100284565
439 Ga0070698_100362304
440 Ga0070698_100541531
441 Ga0070699_100013919
442 Ga0070699_100077608
443 Ga0070699_100617675
444 Ga0070697_100430725
445 Ga0070672_100056655
446 Ga0070672_100056706
447 Ga0070672_100165719
448 Ga0070672_100519860
449 Ga0070672_100653967
450 Ga0070695_100000032
451 Ga0070695_100349539
452 Ga0070696_100000294
453 Ga0070696_100025221
454 Ga0070696_100658774
455 Ga0070704_100023970
456 Ga0070704_100041882
457 Ga0070664_100212331
458 Ga0070702_100006021
459 Ga0068859_100072521
460 Ga0068859_100125720
461 Ga0068859_100218589
462 Ga0068859_100392372
463 Ga0068859_100722952
464 Ga0068864_100204536
465 Ga0068861_100164765
466 Ga0068851_10002039
467 Ga0068870_10007362
468 Ga0068870_10133707
469 Ga0068870_10320960
470 Ga0068863_100191084
471 Ga0068860_100085554
472 Ga0068862_100069545
473 Ga0081455_10008539
474 Ga0081455_10011684
475 Ga0081455_10482787
476 Ga0081455_10555897
477 Ga0081540_1185710
478 Ga0081539_10000010
479 Ga0081539_10000133
480 Ga0081539_10009127
481 Ga0075427_10055021
482 Ga0075428_100005938
483 Ga0075428_100015737
484 Ga0075428_100052606
485 Ga0075428_100068920
486 Ga0075428_100098571
487 Ga0075428_100113688
488 Ga0075430_100012626
489 Ga0075430_100105984
490 Ga0075431_100018030
491 Ga0075431_100029680
492 Ga0075431_100031833
493 Ga0075431_100130057
494 Ga0075431_100264968
495 Ga0075431_100280049
496 Ga0075431_100337626
497 Ga0075431_100340627
498 Ga0075431_100618575
499 Ga0075433_10009677
500 Ga0075433_10063495
501 Ga0075433_10100799
502 Ga0075434_100163193
503 Ga0075434_100206647
504 Ga0075434_100390031
505 Ga0075434_100769162
506 Ga0075429_100148040
507 Ga0075429_100277665
508 Ga0068865_100169523
509 Ga0068865_100524744
510 Ga0075436_100205869
511 Ga0097620_100072521
512 Ga0097620_100125722
513 Ga0097620_100218583
514 Ga0097620_100392320
515 Ga0097620_100722981
516 Ga0099794_10007842
517 Ga0111539_10000680
518 Ga0111539_10016754
519 Ga0111539_10069557
520 Ga0111539_10075111
521 Ga0111539_10146492
522 Ga0111539_10302560
523 Ga0111539_10412723
524 Ga0105245_10517810
525 Ga0114129_10002417
526 Ga0114129_10009953
527 Ga0114129_10034916
528 Ga0114129_10053438
529 Ga0114129_10053895
530 Ga0114129_10089607
531 Ga0114129_10115898
532 Ga0114129_10482231
533 Ga0114129_10754302
534 Ga0105243_10008214
535 Ga0105243_10435034
536 Ga0105241_10091529
537 Ga0105242_10027769
538 Ga0105248_10100533
539 Ga0105248_10561028
540 Ga0105238_10003204
541 Ga0105249_10189380
542 Ga0105249_10443310
543 Ga0157370_10127917
544 Ga0157374_11516840
545 Ga0157378_10063137
546 Ga0157378_11153766
547 Ga0157378_11581821
548 Ga0163162_11303955
549 Ga0157372_10301650
550 Ga0157372_10459280
551 Ga0157375_10704232
552 Ga0163163_10889437
553 Ga0157380_10298956
554 Ga0157377_10266170
555 Ga0157379_10328337
556 Ga0213875_10002219
557 Ga0207656_10254052
558 Ga0207653_10098731
559 Ga0207688_10246450
560 Ga0207680_10209953
561 Ga0207643_10019220
562 Ga0207643_10506576
563 Ga0207649_10529038
564 Ga0207681_10558097
565 Ga0207694_10003524
566 Ga0207650_10203529
567 Ga0207650_10280517
568 Ga0207650_11226217
569 Ga0207659_10006636
570 Ga0207659_10010291
571 Ga0207659_10022875
572 Ga0207659_10212978
573 Ga0207659_10213642
574 Ga0207659_10560359
575 Ga0207706_10405644
576 Ga0207686_10132526
577 Ga0207709_10032578
578 Ga0207670_10018566
579 Ga0207669_10267225
580 Ga0207704_10073530
581 Ga0207704_10139835
582 Ga0207704_10620590
583 Ga0207691_10077278
584 Ga0207691_10174354
585 Ga0207691_10601278
586 Ga0207689_10010123
587 Ga0207689_10175490
588 Ga0207679_10297661
589 Ga0207651_10349762
590 Ga0207712_10089282
591 Ga0207677_10386230
592 Ga0207677_10837165
593 Ga0207678_10355395
594 Ga0207708_10209842
595 Ga0207641_10041355
596 Ga0207675_100102374
597 Ga0207675_100499954
598 Ga0207683_10195327
599 Ga0209971_1013997
600 Ga0209974_10044382
601 Ga0207428_10002273
602 Ga0207428_10035617
603 Ga0207428_10036363
604 Ga0207428_10151448
605 Ga0268265_10040286
606 Ga0268265_10542891
607 Ga0268264_10646767
608 Ga0265326_10007319
609 Ga0265319_1005680
610 Ga0265334_10001346
611 Ga0265318_10000277
612 Ga0265338_10096773
613 Ga0265328_10020995
614 Ga0265339_10028731
615 Ga0265331_10041642
616 Ga0307408_100016829
617 Ga0265313_10021076
618 Ga0265342_10003824
619 Ga0307405_10001000
620 Ga0307405_10342956
621 Ga0307413_10015376
622 Ga0307413_10220193
623 Ga0307413_10530341
624 Ga0307410_10008547
625 Ga0307410_10172860
626 Ga0307410_10382684
627 Ga0307406_10002648
628 Ga0307406_10063210
629 Ga0307406_10342252
630 Ga0307407_10012394
631 Ga0307412_10004216
632 Ga0307412_10684518
633 Ga0307409_100007831
634 Ga0307409_100106100
635 Ga0307409_101011969
636 Ga0307416_100026846
637 Ga0307416_100168677
638 Ga0307416_101279337
639 Ga0307414_10011333
640 Ga0307411_10048694
641 Ga0307411_10051808
642 Ga0307415_100032137
643 Ga0307415_100383428
644 Ga0307415_100714985
645 Ga0373939_0029619
646 Ga0373937_0076003
647 Ga0436364_1140111
648 Ga0439441_052346
649 Ga0439449_0033962
650 Ga0439450_007802
651 Ga0450920_087773
652 Ga0439435_0207321
653 Ga0439464_0002583
654 Ga0439464_0003652
655 Ga0451577_0094912
656 Ga0451577_0214550
657 Ga0451577_1032754
658 Ga0439440_0029931
659 Ga0439440_0036870
660 Ga0453684_0065519
661 Ga0451576_0061586
662 Ga0451576_0075926
663 Ga0451576_0156432
664 Ga0451576_1229126
665 Ga0451576_1467409
666 Ga0495580_0266449
667 Ga0495580_0433946
668 Ga0495584_0180342
669 Ga0495642_0037067
670 Ga0495598_0003501
671 Ga0495598_0240631
672 Ga0495622_0056099
673 Ga0495656_0274238
674 Ga0495668_0002753
675 Ga0495647_0149625
676 Ga0495658_0459040
677 Ga0495684_0287644
678 Ga0496100_0635957
679 Ga0496102_0063594
680 Ga0496102_0933299
681 Ga0496103_0573514
682 Ga0496108_0496977
683 Ga0496108_0511553
684 Ga0496109_0147829
685 Ga0496109_0527825
686 Ga0496109_0990325
687 Ga0496110_0806268
688 Ga0496113_0107692
689 Ga0496113_0246834
690 Ga0496114_0779827
691 Ga0501031_0226193
692 Ga0501036_0290151
693 Ga0501038_0027647
694 Ga0501039_0110851
695 Ga0501039_0520173
696 Ga0501039_0729426
697 Ga0501040_0017602
698 Ga0501040_0286248
699 Ga0501040_0694184
700 Ga0501041_0192662
701 Ga0501042_0014557
702 Ga0501042_0038857
703 Ga0501043_0048559
704 Ga0501043_0272456
705 Ga0501046_0125774
706 Ga0501046_0156494
707 Ga0501048_0165424
708 Ga0501048_0169743
709 Ga0501068_0163821
710 Ga0501071_0188161
711 Ga0501071_0302133
712 Ga0501071_0313604
713 Ga0501072_0008787
714 Ga0501072_0023408
715 Ga0501072_0524706
716 Ga0501073_0318788
717 Ga0501073_0882874
718 Ga0501074_0031524
719 Ga0501074_0575525
720 Ga0501075_0012894
721 Ga0501075_0049342
722 Ga0501075_0133938
723 Ga0501075_0293150
724 Ga0501075_0424821
725 Ga0501076_0035508
726 Ga0501076_0114299
727 Ga0501076_0125907
728 Ga0501076_0130671
729 Ga0501076_0375572
730 Ga0501077_0038373
731 Ga0501202_099075
732 Ga0501079_0061872
733 Ga0501079_0184690
734 Ga0501080_0334766
735 Ga0501081_0007257
736 Ga0501081_0100742
737 Ga0501081_0483380
738 Ga0501081_1032909
739 Ga0501265_050748
740 Ga0501283_005390
741 Ga0501035_0193076
742 Ga0501035_0381860
743 Ga0501045_0134298
744 Ga0501045_0215339
745 Ga0501045_0388236
746 Ga0501045_0470665
747 nmdc:mga05p37_15874_c1
748 nmdc:mga05p37_16303_c1
749 nmdc:mga05p37_193050_c1
750 nmdc:mga05p37_196570_c1
751 nmdc:mga05p37_25722_c1
752 nmdc:mga05p37_429965_c1
753 nmdc:mga05p37_8942_c1
754 nmdc:mga05p37_9773_c1
755 nmdc:mga09592_357974_c1
756 nmdc:mga0qj67_108692_c1
757 nmdc:mga0qj67_94526_c1
758 nmdc:mga06r32_13541_c1
759 nmdc:mga06r32_198436_c1
760 nmdc:mga06r32_24876_c1
761 nmdc:mga06r32_255758_c1
762 nmdc:mga06r32_257291_c1
763 nmdc:mga06r32_29549_c1
764 nmdc:mga06r32_337540_c1
765 nmdc:mga06r32_392993_c1
766 nmdc:mga06r32_417016_c1
767 nmdc:mga08y16_15485_c1
768 nmdc:mga08y16_1562_c1
769 nmdc:mga08y16_171900_c1
770 nmdc:mga08y16_313549_c1
771 nmdc:mga08y16_66004_c1
772 nmdc:mga08y16_83524_c1
773 nmdc:mga08y16_943237_c1
774 nmdc:mga0n895_156666_c1
775 nmdc:mga0n895_204660_c1
776 nmdc:mga0n895_332914_c1
777 nmdc:mga0n895_369488_c1
778 nmdc:mga0a205_12474_c1
779 nmdc:mga0a205_15347_c1
780 nmdc:mga0a205_209061_c1
781 nmdc:mga0a205_90375_c1
782 Ga0501084_0006610
783 Ga0501084_0041657
784 Ga0501084_0359790
785 Ga0501084_0475140
786 Ga0501082_0148664
787 Ga0501082_0329370
788 Ga0501082_0733365
789 Ga0530510_0140115
790 Ga0530510_0205489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07638

Sigma70_ECF

ECF sigma factor

26

208

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8751 122 184
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8694 124 180
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.8561 118 189
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.8442 118 189
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8374 122 184
ID Description Score Start End Superfamily
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.921 124 186 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8948 125 186 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8913 125 186 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.871 125 184 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8694 124 180 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H3LN00-F1-model_v4 RNA polymerase sigma factor, TIGR02999 family 0.9073 26 186 GO:0003700
GO:0006352
AF-A0A4U5JKJ4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9068 17 187 GO:0006352
GO:0016987
AF-A0A1Q4FNM0-F1-model_v4 RNA polymerase sigma-70 ECF-like HTH domain-containing protein 0.8838 1 184 GO:0006352
GO:0016987
AF-A0A521ARL5-F1-model_v4 RNA polymerase, sigma subunit, ECF family 0.8764 1 185 GO:0006352
GO:0016987
AF-A0A2V8MFR8-F1-model_v4 RNA polymerase subunit sigma-70 0.8706 60 187 GO:0006352
GO:0016987

Map