F433021

General Info

Members Datasets Scaffolds Average Seq Length
394 203 394 131

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0175357|Ga0496108_0175357_487_879
Length 130
Sequence MATWDDVRRLALALPQTAESTSYGSMSWKVKDKMFVWERPLRQSDLTALGADAPPDGPILGARVADEGVKQALVADEPDIYFTIPHFDGYAAVLVRLDQIDNSSLEQLVTESWLCRAPKRLAATYLADSG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 10.66
Rhizosphere 84.77
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10221875 3300005328 Bacteria 1249
2 Ga0070676_11254101 3300005328 Bacteria 565
3 Ga0070683_100133174 3300005329 Bacteria 2352
4 Ga0070683_101217008 3300005329 Bacteria 724
5 Ga0070677_10000085 3300005333 Bacteria 29927
6 Ga0070682_100000102 3300005337 Bacteria 76457
7 Ga0068868_100446517 3300005338 Bacteria 1124
8 Ga0070689_100959506 3300005340 Bacteria 759
9 Ga0070691_10224925 3300005341 Bacteria 996
10 Ga0070668_100004092 3300005347 Bacteria 10800
11 Ga0070671_101173324 3300005355 Unclassified 675
12 Ga0070714_100032749 3300005435 Bacteria 4340
13 Ga0070714_100183145 3300005435 Bacteria 1907
14 Ga0070714_100355201 3300005435 Bacteria 1377
15 Ga0070714_101527650 3300005435 Bacteria 652
16 Ga0070713_100140540 3300005436 Bacteria 2138
17 Ga0070713_100478922 3300005436 Bacteria 1172
18 Ga0070713_100997355 3300005436 Bacteria 808
19 Ga0070701_10215324 3300005438 Bacteria 1143
20 Ga0070711_100329426 3300005439 Bacteria 1222
21 Ga0070700_100252763 3300005441 Bacteria 1265
22 Ga0070700_100856057 3300005441 Bacteria 737
23 Ga0070708_100865377 3300005445 Bacteria 849
24 Ga0070678_100273282 3300005456 Bacteria 1426
25 Ga0070662_100106743 3300005457 Bacteria 2128
26 Ga0070662_101065294 3300005457 Bacteria 693
27 Ga0068867_101784919 3300005459 Bacteria 578
28 Ga0070679_101249464 3300005530 Bacteria 688
29 Ga0070684_100272721 3300005535 Bacteria 1549
30 Ga0070684_102204403 3300005535 Bacteria 520
31 Ga0070686_100163727 3300005544 Bacteria 1568
32 Ga0070695_100494120 3300005545 Bacteria 945
33 Ga0070696_100390134 3300005546 Bacteria 1087
34 Ga0070696_100411399 3300005546 Bacteria 1060
35 Ga0068857_102522078 3300005577 Bacteria 505
36 Ga0070702_100033735 3300005615 Bacteria 2817
37 Ga0068864_102311925 3300005618 Bacteria 544
38 Ga0068861_100002338 3300005719 Bacteria 12324
39 Ga0068860_100489132 3300005843 Bacteria 1227
40 Ga0068862_101047375 3300005844 Bacteria 809
41 Ga0081455_10005348 3300005937 Bacteria 14102
42 Ga0081455_10373728 3300005937 Bacteria 998
43 Ga0081455_10487734 3300005937 Bacteria 831
44 Ga0081455_10971933 3300005937 Bacteria 526
45 Ga0081538_10000473 3300005981 Bacteria 45178
46 Ga0081538_10006594 3300005981 Bacteria 10190
47 Ga0081540_1004791 3300005983 Bacteria 10199
48 Ga0081539_10002608 3300005985 Bacteria 24719
49 Ga0081539_10010873 3300005985 Bacteria 7310
50 Ga0070717_10000013 3300006028 Bacteria 228046
51 Ga0070717_10025727 3300006028 Bacteria 4686
52 Ga0070717_10137815 3300006028 Bacteria 2103
53 Ga0070717_10903056 3300006028 Bacteria 804
54 Ga0075365_10773509 3300006038 Bacteria 678
55 Ga0075364_10665087 3300006051 Bacteria 711
56 Ga0070712_100017262 3300006175 Unclassified 4670
57 Ga0070712_101395514 3300006175 Bacteria 611
58 Ga0070712_101833638 3300006175 Bacteria 531
59 Ga0075428_100099687 3300006844 Bacteria 3167
60 Ga0075428_100197448 3300006844 Bacteria 2176
61 Ga0075428_100992630 3300006844 Bacteria 889
62 Ga0075428_101112506 3300006844 Bacteria 834
63 Ga0075430_100087839 3300006846 Bacteria 2602
64 Ga0075430_101378774 3300006846 Bacteria 579
65 Ga0075431_100069037 3300006847 Bacteria 3647
66 Ga0075431_100457679 3300006847 Bacteria 1271
67 Ga0075431_100521252 3300006847 Bacteria 1178
68 Ga0075434_100222966 3300006871 Bacteria 1905
69 Ga0075429_100060227 3300006880 Bacteria 3307
70 Ga0068865_100430403 3300006881 Bacteria 1087
71 Ga0075435_100378940 3300007076 Bacteria 1215
72 Ga0099795_10343992 3300007788 Bacteria 666
73 Ga0111539_10125164 3300009094 Bacteria 3012
74 Ga0111539_10340887 3300009094 Bacteria 1745
75 Ga0111539_10723713 3300009094 Bacteria 1158
76 Ga0111539_12360084 3300009094 Bacteria 617
77 Ga0111539_13039689 3300009094 Bacteria 542
78 Ga0105245_10010427 3300009098 Bacteria 8092
79 Ga0105245_10461723 3300009098 Bacteria 1280
80 Ga0105245_11564615 3300009098 Bacteria 711
81 Ga0114129_10361810 3300009147 Bacteria 1920
82 Ga0114129_10526274 3300009147 Bacteria 1541
83 Ga0114129_10900979 3300009147 Bacteria 1121
84 Ga0114129_10954985 3300009147 Bacteria 1082
85 Ga0114129_11255963 3300009147 Bacteria 920
86 Ga0114129_11358898 3300009147 Bacteria 878
87 Ga0114129_11428618 3300009147 Bacteria 853
88 Ga0114129_11787568 3300009147 Bacteria 748
89 Ga0105243_10637022 3300009148 Bacteria 1031
90 Ga0105243_12237903 3300009148 Bacteria 584
91 Ga0105242_11461143 3300009176 Bacteria 713
92 Ga0105248_10208658 3300009177 Bacteria 2201
93 Ga0105248_12805778 3300009177 Bacteria 556
94 Ga0105249_10186486 3300009553 Bacteria 2021
95 Ga0105249_10418206 3300009553 Bacteria 1374
96 Ga0105249_10607443 3300009553 Bacteria 1149
97 Ga0105249_12651031 3300009553 Bacteria 573
98 Ga0105147_117167 3300009982 Bacteria 615
99 Ga0105239_10605080 3300010375 Bacteria 1250
100 Ga0105239_10841031 3300010375 Bacteria 1052
101 Ga0105246_10112678 3300011119 Bacteria 2001
102 Ga0157369_10604506 3300013105 Bacteria 1132
103 Ga0157378_10685473 3300013297 Bacteria 1043
104 Ga0163162_10031767 3300013306 Bacteria 5239
105 Ga0163162_10937435 3300013306 Bacteria 977
106 Ga0157372_10237183 3300013307 Bacteria 2116
107 Ga0157372_10252754 3300013307 Bacteria 2046
108 Ga0157375_11529123 3300013308 Bacteria 788
109 Ga0157380_10255028 3300014326 Bacteria 1590
110 Ga0157379_10031006 3300014968 Bacteria 4763
111 Ga0163161_10415226 3300017792 Bacteria 1082
112 Ga0206353_11714800 3300020082 Bacteria 787
113 Ga0213876_10078952 3300021384 Bacteria 1739
114 Ga0207682_10000060 3300025893 Bacteria 46992
115 Ga0207692_10124574 3300025898 Bacteria 1447
116 Ga0207688_10146503 3300025901 Bacteria 1392
117 Ga0207645_10068654 3300025907 Bacteria 2267
118 Ga0207663_10211853 3300025916 Bacteria 1405
119 Ga0207652_11571854 3300025921 Bacteria 562
120 Ga0207700_10004257 3300025928 Bacteria 8411
121 Ga0207700_10375793 3300025928 Bacteria 1242
122 Ga0207700_10677604 3300025928 Bacteria 920
123 Ga0207700_11506220 3300025928 Bacteria 597
124 Ga0207664_10290741 3300025929 Bacteria 1436
125 Ga0207664_10379930 3300025929 Bacteria 1254
126 Ga0207664_10649306 3300025929 Unclassified 948
127 Ga0207664_10858080 3300025929 Bacteria 816
128 Ga0207706_10026047 3300025933 Bacteria 5236
129 Ga0207686_10572334 3300025934 Bacteria 886
130 Ga0207709_10140480 3300025935 Bacteria 1659
131 Ga0207709_10258934 3300025935 Bacteria 1275
132 Ga0207709_10586784 3300025935 Bacteria 881
133 Ga0207689_10483906 3300025942 Bacteria 1036
134 Ga0207661_10228670 3300025944 Bacteria 1646
135 Ga0207712_10566906 3300025961 Bacteria 978
136 Ga0207668_10720668 3300025972 Unclassified 878
137 Ga0207668_11345211 3300025972 Bacteria 643
138 Ga0207640_10377330 3300025981 Bacteria 1148
139 Ga0207640_10577998 3300025981 Unclassified 948
140 Ga0207658_11272369 3300025986 Bacteria 673
141 Ga0207677_10421255 3300026023 Bacteria 1137
142 Ga0207677_11839262 3300026023 Bacteria 562
143 Ga0207639_11039422 3300026041 Bacteria 768
144 Ga0207639_12106443 3300026041 Bacteria 525
145 Ga0207708_10346183 3300026075 Bacteria 1218
146 Ga0207708_10485714 3300026075 Unclassified 1033
147 Ga0207708_10568481 3300026075 Bacteria 958
148 Ga0207708_11089904 3300026075 Unclassified 696
149 Ga0207648_10122765 3300026089 Bacteria 2284
150 Ga0207675_100008394 3300026118 Bacteria 9740
151 Ga0207675_100209464 3300026118 Bacteria 1874
152 Ga0207675_102306091 3300026118 Bacteria 552
153 Ga0207698_11186115 3300026142 Bacteria 777
154 Ga0207428_10724219 3300027907 Bacteria 710
155 Ga0268266_10484220 3300028379 Bacteria 1180
156 Ga0268266_12378025 3300028379 Bacteria 501
157 Ga0268265_10929158 3300028380 Bacteria 856
158 Ga0268265_11200307 3300028380 Bacteria 756
159 Ga0268264_11542186 3300028381 Bacteria 675
160 Ga0265337_1075739 3300028556 Bacteria 922
161 Ga0265318_10104302 3300028577 Bacteria 1043
162 Ga0265338_10058563 3300028800 Bacteria 3399
163 Ga0265320_10400134 3300031240 Bacteria 606
164 Ga0265327_10006439 3300031251 Bacteria 9385
165 Ga0265327_10041625 3300031251 Bacteria 2474
166 Ga0307408_100180386 3300031548 Bacteria 1693
167 Ga0307408_101068764 3300031548 Bacteria 747
168 Ga0307408_101524093 3300031548 Bacteria 633
169 Ga0265342_10684683 3300031712 Bacteria 513
170 Ga0307405_10009225 3300031731 Bacteria 5048
171 Ga0307405_10053413 3300031731 Bacteria 2517
172 Ga0307413_10005387 3300031824 Bacteria 5707
173 Ga0307413_10040665 3300031824 Bacteria 2715
174 Ga0307410_10275180 3300031852 Bacteria 1319
175 Ga0307410_10511685 3300031852 Bacteria 989
176 Ga0307410_10643787 3300031852 Bacteria 888
177 Ga0307406_10013726 3300031901 Bacteria 4647
178 Ga0307406_10028709 3300031901 Bacteria 3363
179 Ga0307406_10060060 3300031901 Bacteria 2450
180 Ga0307406_10070702 3300031901 Bacteria 2286
181 Ga0307406_10353773 3300031901 Bacteria 1149
182 Ga0307407_10088109 3300031903 Bacteria 1895
183 Ga0307407_10190297 3300031903 Bacteria 1367
184 Ga0307407_10298198 3300031903 Bacteria 1123
185 Ga0307409_100003626 3300031995 Bacteria 8440
186 Ga0307409_100984074 3300031995 Bacteria 861
187 Ga0307409_101249007 3300031995 Bacteria 767
188 Ga0307416_100011045 3300032002 Bacteria 6000
189 Ga0307416_100127501 3300032002 Bacteria 2282
190 Ga0307416_100151709 3300032002 Bacteria 2126
191 Ga0307414_10016127 3300032004 Bacteria 4533
192 Ga0307414_10779146 3300032004 Bacteria 871
193 Ga0307411_10044221 3300032005 Bacteria 2855
194 Ga0307411_10215749 3300032005 Bacteria 1485
195 Ga0307415_100004673 3300032126 Bacteria 7159
196 Ga0307415_100019141 3300032126 Bacteria 4151
197 Ga0307415_100260292 3300032126 Bacteria 1415
198 Ga0307415_100970097 3300032126 Bacteria 788
199 Ga0307415_101961905 3300032126 Bacteria 569
200 Ga0373931_1157663 3300035691 Unclassified 528
201 Ga0373925_1540932 3300037068 Bacteria 544
202 Ga0395900_0066709 3300037418 Bacteria 3698
203 Ga0395900_0101062 3300037418 Bacteria 2962
204 Ga0395900_0128360 3300037418 Bacteria 2599
205 Ga0395900_0145216 3300037418 Bacteria 2426
206 Ga0395900_1281007 3300037418 Bacteria 647
207 Ga0395898_0007962 3300037466 Bacteria 11238
208 Ga0395898_0015722 3300037466 Bacteria 7754
209 Ga0395898_0044716 3300037466 Bacteria 4356
210 Ga0395898_0102124 3300037466 Bacteria 2753
211 Ga0395898_0144043 3300037466 Bacteria 2281
212 Ga0395898_0215493 3300037466 Bacteria 1831
213 Ga0395905_0006109 3300037471 Bacteria 12169
214 Ga0395905_0344317 3300037471 Bacteria 1382
215 Ga0395905_0714062 3300037471 Bacteria 905
216 Ga0395905_0761459 3300037471 Bacteria 871
217 Ga0395905_1420854 3300037471 Bacteria 598
218 Ga0436364_1123500 3300037853 Bacteria 1238
219 Ga0436364_1336883 3300037853 Bacteria 594
220 Ga0395901_0006092 3300038443 Bacteria 12215
221 Ga0395901_0010090 3300038443 Bacteria 9570
222 Ga0395901_0032512 3300038443 Bacteria 5382
223 Ga0395901_0062504 3300038443 Bacteria 3875
224 Ga0395901_0448819 3300038443 Bacteria 1319
225 Ga0395901_0531322 3300038443 Bacteria 1194
226 Ga0395901_1060435 3300038443 Bacteria 783
227 Ga0395901_1610976 3300038443 Bacteria 602
228 Ga0436365_0321401 3300039437 Bacteria 3985
229 Ga0436365_1602523 3300039437 Unclassified 723
230 Ga0436363_0087396 3300039450 Bacteria 601
231 Ga0436363_0254830 3300039450 Bacteria 502
232 Ga0436363_0613501 3300039450 Bacteria 506
233 Ga0436363_0615274 3300039450 Bacteria 2949
234 Ga0436363_1629480 3300039450 Bacteria 523
235 Ga0436362_0617194 3300039453 Bacteria 1660
236 Ga0451853_2252391 3300041512 Bacteria 509
237 Ga0451853_3840077 3300041512 Bacteria 3368
238 Ga0439463_194626 3300042016 Bacteria 526
239 Ga0466969_0017109 3300044656 Bacteria 3789
240 Ga0466969_0341113 3300044656 Bacteria 678
241 Ga0466965_0141638 3300044683 Bacteria 1252
242 Ga0466965_0163202 3300044683 Bacteria 1169
243 Ga0466966_0014526 3300044684 Bacteria 5212
244 Ga0466966_0037228 3300044684 Bacteria 3139
245 Ga0466961_0854428 3300044693 Bacteria 542
246 Ga0466963_0005479 3300044694 Bacteria 7431
247 Ga0466963_0391912 3300044694 Bacteria 979
248 Ga0466963_0584453 3300044694 Bacteria 789
249 Ga0466963_0668341 3300044694 Bacteria 733
250 Ga0466964_0050800 3300044706 Bacteria 1701
251 Ga0466964_0065917 3300044706 Bacteria 1519
252 Ga0466964_0093360 3300044706 Bacteria 1314
253 Ga0466971_0048400 3300044719 Unclassified 1911
254 Ga0466968_0012904 3300044735 Bacteria 3278
255 Ga0466968_0109204 3300044735 Bacteria 1242
256 Ga0466968_0219667 3300044735 Bacteria 895
257 Ga0466970_0099349 3300044765 Bacteria 1584
258 Ga0466970_0189495 3300044765 Bacteria 1142
259 Ga0466957_0006576 3300044842 Bacteria 6570
260 Ga0466957_0288823 3300044842 Bacteria 1099
261 Ga0466957_0856292 3300044842 Bacteria 648
262 Ga0466960_0473624 3300044901 Bacteria 731
263 Ga0466959_0011553 3300045049 Bacteria 6346
264 Ga0466959_0012873 3300045049 Bacteria 6055
265 Ga0466959_0032069 3300045049 Bacteria 3889
266 Ga0466959_0504990 3300045049 Bacteria 817
267 Ga0466959_0746467 3300045049 Bacteria 655
268 Ga0466958_0002757 3300045836 Bacteria 8920
269 Ga0466958_0003754 3300045836 Bacteria 7931
270 Ga0466958_0015567 3300045836 Bacteria 4360
271 Ga0466958_0041520 3300045836 Bacteria 2767
272 Ga0466958_0223302 3300045836 Unclassified 1202
273 Ga0466967_0008912 3300045976 Bacteria 7404
274 Ga0466967_0014809 3300045976 Bacteria 6092
275 Ga0466967_0076628 3300045976 Bacteria 3008
276 Ga0466967_0100483 3300045976 Bacteria 2643
277 Ga0466967_0118110 3300045976 Bacteria 2446
278 Ga0466967_0272098 3300045976 Bacteria 1623
279 Ga0466967_0368824 3300045976 Bacteria 1392
280 Ga0466967_0998247 3300045976 Bacteria 833
281 Ga0466967_1576014 3300045976 Bacteria 654
282 Ga0466967_1843447 3300045976 Bacteria 602
283 Ga0466967_2333221 3300045976 Bacteria 530
284 Ga0495629_0091491 3300046459 Bacteria 2123
285 Ga0495641_0000440 3300046461 Bacteria 34775
286 Ga0495605_0176410 3300046474 Bacteria 942
287 Ga0495596_0163858 3300046500 Bacteria 864
288 Ga0495596_0164976 3300046500 Bacteria 861
289 Ga0495608_0052814 3300046511 Bacteria 2690
290 Ga0495630_0308564 3300046517 Bacteria 1209
291 Ga0495631_0195585 3300046518 Bacteria 865
292 Ga0495652_0032517 3300046529 Bacteria 4562
293 Ga0495652_0230476 3300046529 Bacteria 1386
294 Ga0495640_0402125 3300046533 Bacteria 841
295 Ga0495640_0451475 3300046533 Bacteria 785
296 Ga0495609_0192250 3300046538 Bacteria 856
297 Ga0495645_0011564 3300046543 Bacteria 6214
298 Ga0495656_0196865 3300046615 Bacteria 998
299 Ga0495635_0405795 3300046663 Bacteria 905
300 Ga0495657_0330814 3300046675 Bacteria 904
301 Ga0495599_0131502 3300046678 Bacteria 1554
302 Ga0495669_0000181 3300046684 Bacteria 39486
303 Ga0495670_0239011 3300046691 Bacteria 967
304 Ga0495589_0070571 3300046794 Bacteria 1708
305 Ga0495660_0271647 3300046810 Bacteria 779
306 Ga0495604_0227841 3300047317 Bacteria 1280
307 Ga0495674_0359452 3300047319 Bacteria 1181
308 Ga0495680_0001363 3300047322 Bacteria 26520
309 Ga0495602_0802770 3300048088 Bacteria 632
310 Ga0496100_0000006 3300048903 Bacteria 297429
311 Ga0496100_1644745 3300048903 Bacteria 508
312 Ga0496101_0000009 3300048904 Bacteria 297429
313 Ga0496101_0018103 3300048904 Bacteria 4784
314 Ga0496101_0022764 3300048904 Bacteria 4318
315 Ga0496101_0967131 3300048904 Bacteria 670
316 Ga0496103_0401372 3300048906 Bacteria 881
317 Ga0496104_0000008 3300048907 Bacteria 516976
318 Ga0496104_0162467 3300048907 Bacteria 2142
319 Ga0496105_0000003 3300048908 Bacteria 713251
320 Ga0496105_0007781 3300048908 Bacteria 8318
321 Ga0496105_0463829 3300048908 Bacteria 998
322 Ga0496106_0000013 3300048909 Bacteria 202263
323 Ga0496106_0000064 3300048909 Bacteria 85019
324 Ga0496106_0078002 3300048909 Bacteria 2541
325 Ga0496107_0000002 3300048910 Bacteria 320871
326 Ga0496107_0036475 3300048910 Bacteria 3527
327 Ga0496107_0506313 3300048910 Bacteria 895
328 Ga0496108_0000004 3300048911 Bacteria 545055
329 Ga0496108_0175357 3300048911 Unclassified 1856
330 Ga0496108_1245936 3300048911 Bacteria 627
331 Ga0496108_1278747 3300048911 Bacteria 618
332 Ga0496109_0000031 3300048912 Bacteria 163998
333 Ga0496109_0081097 3300048912 Bacteria 2990
334 Ga0496110_0172244 3300048913 Bacteria 1964
335 Ga0496110_0471337 3300048913 Bacteria 1144
336 Ga0496110_1682464 3300048913 Bacteria 545
337 Ga0496111_0195574 3300048914 Bacteria 1503
338 Ga0496112_0003239 3300048915 Bacteria 13411
339 Ga0496112_0196479 3300048915 Bacteria 1978
340 Ga0496112_0231054 3300048915 Bacteria 1804
341 Ga0496112_0271052 3300048915 Bacteria 1646
342 Ga0496112_0301830 3300048915 Bacteria 1547
343 Ga0496113_0090357 3300048916 Bacteria 2359
344 Ga0496113_0114137 3300048916 Bacteria 2106
345 Ga0496113_0202188 3300048916 Bacteria 1579
346 Ga0496114_0016697 3300048917 Bacteria 5919
347 Ga0496114_0129511 3300048917 Bacteria 2178
348 Ga0496114_0442679 3300048917 Bacteria 1151
349 Ga0496114_0484870 3300048917 Bacteria 1094
350 Ga0496115_0000070 3300048918 Bacteria 91981
351 Ga0496115_0653661 3300048918 Bacteria 831
352 Ga0496119_0170082 3300048922 Bacteria 1152
353 Ga0496125_0087147 3300048928 Bacteria 2359
354 Ga0501031_0208619 3300049568 Bacteria 1273
355 Ga0501033_0205521 3300049570 Bacteria 1406
356 Ga0501040_0780427 3300049576 Bacteria 691
357 Ga0501041_0948201 3300049577 Bacteria 553
358 Ga0501042_0175732 3300049578 Bacteria 1545
359 Ga0501046_0104520 3300049580 Bacteria 2171
360 Ga0501048_0289866 3300049582 Bacteria 1164
361 Ga0501067_0324855 3300049583 Bacteria 857
362 Ga0501067_0464171 3300049583 Bacteria 707
363 Ga0501070_0426576 3300049586 Bacteria 1071
364 Ga0501070_0474716 3300049586 Bacteria 1007
365 Ga0501075_0453184 3300049591 Bacteria 978
366 Ga0501076_0431015 3300049592 Bacteria 1085
367 Ga0501202_090652 3300049652 Bacteria 731
368 Ga0501080_1729834 3300049742 Unclassified 527
369 Ga0501081_0185299 3300049743 Bacteria 1506
370 Ga0501035_0784594 3300049822 Bacteria 762
371 Ga0501035_1068044 3300049822 Bacteria 632
372 Ga0501045_0189071 3300049824 Bacteria 1535
373 Ga0501045_0905257 3300049824 Bacteria 648
374 nmdc:mga06z11_576077_c1 3300050494 Unclassified 684
375 nmdc:mga05p37_122257_c1 3300050507 Bacteria 3197
376 nmdc:mga05p37_1337181_c1 3300050507 Bacteria 727
377 nmdc:mga05p37_1555215_c1 3300050507 Bacteria 655
378 nmdc:mga09592_116073_c1 3300050508 Bacteria 2297
379 nmdc:mga09592_733601_c1 3300050508 Bacteria 839
380 nmdc:mga0qj67_81329_c1 3300050509 Bacteria 2597
381 nmdc:mga06r32_2059569_c1 3300050510 Bacteria 504
382 nmdc:mga06r32_455942_c1 3300050510 Bacteria 1258
383 nmdc:mga08y16_157611_c1 3300050511 Bacteria 2359
384 nmdc:mga08y16_173205_c1 3300050511 Bacteria 2241
385 nmdc:mga08y16_1907003_c1 3300050511 Bacteria 545
386 nmdc:mga08y16_617514_c1 3300050511 Bacteria 1091
387 nmdc:mga08y16_64036_c1 3300050511 Bacteria 3840
388 nmdc:mga0n895_191428_c1 3300050512 Bacteria 2076
389 Ga0495655_0019030 3300053083 Bacteria 1519
390 Ga0495619_0242556 3300053085 Bacteria 1249
391 Ga0500614_002080 3300053123 Bacteria 4572
392 Ga0501082_0529802 3300060353 Bacteria 1030
393 Ga0466962_0095598 3300061719 Bacteria 1424
394 Ga0466962_0138609 3300061719 Unclassified 1178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100260292 Ga0307415_1002602922 124
2 3300009147 Ga0114129_10954985 Ga0114129_109549851 125
3 3300009147 Ga0114129_11787568 Ga0114129_117875682 126
4 3300031548 Ga0307408_101068764 Ga0307408_1010687642 126
5 3300031901 Ga0307406_10013726 Ga0307406_100137263 126
6 3300032126 Ga0307415_100970097 Ga0307415_1009700972 126
7 3300049824 Ga0501045_0905257 Ga0501045_0905257_124_504 126
8 3300050508 nmdc:mga09592_733601_c1 nmdc:mga09592_733601_c1_154_543 126
9 3300009176 Ga0105242_11461143 Ga0105242_114611432 127
10 3300011119 Ga0105246_10112678 Ga0105246_101126782 127
11 3300026041 Ga0207639_11039422 Ga0207639_110394221 127
12 3300049568 Ga0501031_0208619 Ga0501031_0208619_381_764 127
13 3300049586 Ga0501070_0474716 Ga0501070_0474716_540_923 127
14 3300049822 Ga0501035_0784594 Ga0501035_0784594_346_729 127
15 3300005329 Ga0070683_101217008 Ga0070683_1012170081 128
16 3300005340 Ga0070689_100959506 Ga0070689_1009595062 128
17 3300005435 Ga0070714_100355201 Ga0070714_1003552012 128
18 3300005436 Ga0070713_100997355 Ga0070713_1009973552 128
19 3300005438 Ga0070701_10215324 Ga0070701_102153242 128
20 3300005577 Ga0068857_102522078 Ga0068857_1025220781 128
21 3300005844 Ga0068862_101047375 Ga0068862_1010473751 128
22 3300006028 Ga0070717_10137815 Ga0070717_101378152 128
23 3300006028 Ga0070717_10903056 Ga0070717_109030562 128
24 3300006038 Ga0075365_10773509 Ga0075365_107735091 128
25 3300006844 Ga0075428_100197448 Ga0075428_1001974482 128
26 3300006847 Ga0075431_100069037 Ga0075431_1000690373 128
27 3300006880 Ga0075429_100060227 Ga0075429_1000602272 128
28 3300009094 Ga0111539_10340887 Ga0111539_103408872 128
29 3300009098 Ga0105245_11564615 Ga0105245_115646151 128
30 3300009147 Ga0114129_10900979 Ga0114129_109009791 128
31 3300009553 Ga0105249_12651031 Ga0105249_126510312 128
32 3300025928 Ga0207700_11506220 Ga0207700_115062201 128
33 3300025929 Ga0207664_10290741 Ga0207664_102907412 128
34 3300028800 Ga0265338_10058563 Ga0265338_100585633 128
35 3300031251 Ga0265327_10041625 Ga0265327_100416252 128
36 3300031548 Ga0307408_101524093 Ga0307408_1015240932 128
37 3300037068 Ga0373925_1540932 Ga0373925_1540932_38_442 128
38 3300037466 Ga0395898_0144043 Ga0395898_0144043_1092_1478 128
39 3300037471 Ga0395905_0761459 Ga0395905_0761459_228_614 128
40 3300038443 Ga0395901_0062504 Ga0395901_0062504_855_1241 128
41 3300038443 Ga0395901_0531322 Ga0395901_0531322_47_433 128
42 3300044684 Ga0466966_0014526 Ga0466966_0014526_1367_1753 128
43 3300044694 Ga0466963_0391912 Ga0466963_0391912_206_592 128
44 3300044694 Ga0466963_0668341 Ga0466963_0668341_81_467 128
45 3300044706 Ga0466964_0050800 Ga0466964_0050800_256_642 128
46 3300044842 Ga0466957_0856292 Ga0466957_0856292_242_628 128
47 3300045976 Ga0466967_0014809 Ga0466967_0014809_3069_3455 128
48 3300045976 Ga0466967_0076628 Ga0466967_0076628_1524_1910 128
49 3300045976 Ga0466967_0368824 Ga0466967_0368824_802_1188 128
50 3300045976 Ga0466967_0998247 Ga0466967_0998247_229_615 128
51 3300046529 Ga0495652_0032517 Ga0495652_0032517_3907_4293 128
52 3300046533 Ga0495640_0402125 Ga0495640_0402125_245_631 128
53 3300047317 Ga0495604_0227841 Ga0495604_0227841_85_471 128
54 3300047319 Ga0495674_0359452 Ga0495674_0359452_590_976 128
55 3300048911 Ga0496108_1278747 Ga0496108_1278747_101_487 128
56 3300049577 Ga0501041_0948201 Ga0501041_0948201_57_443 128
57 3300049586 Ga0501070_0426576 Ga0501070_0426576_71_457 128
58 3300050508 nmdc:mga09592_116073_c1 nmdc:mga09592_116073_c1_968_1354 128
59 3300005328 Ga0070676_11254101 Ga0070676_112541011 129
60 3300005337 Ga0070682_100000102 Ga0070682_10000010214 129
61 3300005338 Ga0068868_100446517 Ga0068868_1004465172 129
62 3300005355 Ga0070671_101173324 Ga0070671_1011733241 129
63 3300005441 Ga0070700_100252763 Ga0070700_1002527633 129
64 3300005441 Ga0070700_100856057 Ga0070700_1008560571 129
65 3300005445 Ga0070708_100865377 Ga0070708_1008653771 129
66 3300005456 Ga0070678_100273282 Ga0070678_1002732823 129
67 3300005459 Ga0068867_101784919 Ga0068867_1017849191 129
68 3300005535 Ga0070684_100272721 Ga0070684_1002727213 129
69 3300005544 Ga0070686_100163727 Ga0070686_1001637272 129
70 3300005937 Ga0081455_10005348 Ga0081455_1000534816 129
71 3300005937 Ga0081455_10373728 Ga0081455_103737281 129
72 3300005937 Ga0081455_10487734 Ga0081455_104877342 129
73 3300005937 Ga0081455_10971933 Ga0081455_109719332 129
74 3300005981 Ga0081538_10006594 Ga0081538_100065947 129
75 3300005983 Ga0081540_1004791 Ga0081540_10047913 129
76 3300005985 Ga0081539_10010873 Ga0081539_100108735 129
77 3300006028 Ga0070717_10000013 Ga0070717_10000013188 129
78 3300006051 Ga0075364_10665087 Ga0075364_106650871 129
79 3300006175 Ga0070712_100017262 Ga0070712_1000172625 129
80 3300006175 Ga0070712_101395514 Ga0070712_1013955142 129
81 3300006175 Ga0070712_101833638 Ga0070712_1018336381 129
82 3300006844 Ga0075428_101112506 Ga0075428_1011125062 129
83 3300006846 Ga0075430_101378774 Ga0075430_1013787742 129
84 3300006871 Ga0075434_100222966 Ga0075434_1002229663 129
85 3300006881 Ga0068865_100430403 Ga0068865_1004304031 129
86 3300007076 Ga0075435_100378940 Ga0075435_1003789402 129
87 3300009094 Ga0111539_10723713 Ga0111539_107237132 129
88 3300009094 Ga0111539_12360084 Ga0111539_123600841 129
89 3300009098 Ga0105245_10461723 Ga0105245_104617232 129
90 3300009147 Ga0114129_11255963 Ga0114129_112559632 129
91 3300009148 Ga0105243_10637022 Ga0105243_106370222 129
92 3300009148 Ga0105243_12237903 Ga0105243_122379031 129
93 3300009177 Ga0105248_10208658 Ga0105248_102086586 129
94 3300009553 Ga0105249_10607443 Ga0105249_106074432 129
95 3300010375 Ga0105239_10841031 Ga0105239_108410313 129
96 3300013105 Ga0157369_10604506 Ga0157369_106045062 129
97 3300013297 Ga0157378_10685473 Ga0157378_106854732 129
98 3300013306 Ga0163162_10937435 Ga0163162_109374353 129
99 3300013308 Ga0157375_11529123 Ga0157375_115291232 129
100 3300020082 Ga0206353_11714800 Ga0206353_117148002 129
101 3300025898 Ga0207692_10124574 Ga0207692_101245742 129
102 3300025934 Ga0207686_10572334 Ga0207686_105723342 129
103 3300025935 Ga0207709_10258934 Ga0207709_102589342 129
104 3300025942 Ga0207689_10483906 Ga0207689_104839062 129
105 3300025961 Ga0207712_10566906 Ga0207712_105669062 129
106 3300025972 Ga0207668_10720668 Ga0207668_107206682 129
107 3300025986 Ga0207658_11272369 Ga0207658_112723692 129
108 3300026023 Ga0207677_10421255 Ga0207677_104212552 129
109 3300026023 Ga0207677_11839262 Ga0207677_118392621 129
110 3300026041 Ga0207639_12106443 Ga0207639_121064431 129
111 3300026075 Ga0207708_10568481 Ga0207708_105684813 129
112 3300026075 Ga0207708_11089904 Ga0207708_110899042 129
113 3300026089 Ga0207648_10122765 Ga0207648_101227652 129
114 3300026118 Ga0207675_100209464 Ga0207675_1002094643 129
115 3300026118 Ga0207675_102306091 Ga0207675_1023060911 129
116 3300026142 Ga0207698_11186115 Ga0207698_111861152 129
117 3300028379 Ga0268266_12378025 Ga0268266_123780251 129
118 3300028380 Ga0268265_10929158 Ga0268265_109291581 129
119 3300028380 Ga0268265_11200307 Ga0268265_112003072 129
120 3300028381 Ga0268264_11542186 Ga0268264_115421862 129
121 3300031548 Ga0307408_100180386 Ga0307408_1001803862 129
122 3300031731 Ga0307405_10009225 Ga0307405_100092257 129
123 3300031731 Ga0307405_10053413 Ga0307405_100534134 129
124 3300031824 Ga0307413_10005387 Ga0307413_100053874 129
125 3300031852 Ga0307410_10643787 Ga0307410_106437872 129
126 3300031901 Ga0307406_10028709 Ga0307406_100287093 129
127 3300031901 Ga0307406_10060060 Ga0307406_100600604 129
128 3300031901 Ga0307406_10070702 Ga0307406_100707023 129
129 3300031903 Ga0307407_10088109 Ga0307407_100881092 129
130 3300031903 Ga0307407_10298198 Ga0307407_102981982 129
131 3300031995 Ga0307409_100003626 Ga0307409_1000036264 129
132 3300031995 Ga0307409_100984074 Ga0307409_1009840742 129
133 3300031995 Ga0307409_101249007 Ga0307409_1012490072 129
134 3300032002 Ga0307416_100011045 Ga0307416_1000110453 129
135 3300032002 Ga0307416_100127501 Ga0307416_1001275013 129
136 3300032002 Ga0307416_100151709 Ga0307416_1001517092 129
137 3300032004 Ga0307414_10016127 Ga0307414_100161274 129
138 3300032004 Ga0307414_10779146 Ga0307414_107791462 129
139 3300032005 Ga0307411_10044221 Ga0307411_100442212 129
140 3300032005 Ga0307411_10215749 Ga0307411_102157492 129
141 3300037418 Ga0395900_0066709 Ga0395900_0066709_714_1103 129
142 3300037418 Ga0395900_0101062 Ga0395900_0101062_2189_2578 129
143 3300037466 Ga0395898_0044716 Ga0395898_0044716_3506_3895 129
144 3300037466 Ga0395898_0215493 Ga0395898_0215493_1360_1749 129
145 3300037471 Ga0395905_0344317 Ga0395905_0344317_689_1078 129
146 3300037471 Ga0395905_1420854 Ga0395905_1420854_67_456 129
147 3300038443 Ga0395901_0006092 Ga0395901_0006092_3596_3985 129
148 3300038443 Ga0395901_0448819 Ga0395901_0448819_631_1020 129
149 3300038443 Ga0395901_1610976 Ga0395901_1610976_66_455 129
150 3300039450 Ga0436363_0615274 Ga0436363_0615274_1902_2291 129
151 3300039450 Ga0436363_1629480 Ga0436363_1629480_97_486 129
152 3300039453 Ga0436362_0617194 Ga0436362_0617194_283_672 129
153 3300041512 Ga0451853_2252391 Ga0451853_2252391_44_433 129
154 3300045976 Ga0466967_0118110 Ga0466967_0118110_1452_1841 129
155 3300046459 Ga0495629_0091491 Ga0495629_0091491_157_546 129
156 3300046500 Ga0495596_0164976 Ga0495596_0164976_183_572 129
157 3300046517 Ga0495630_0308564 Ga0495630_0308564_120_509 129
158 3300046529 Ga0495652_0230476 Ga0495652_0230476_256_645 129
159 3300046533 Ga0495640_0451475 Ga0495640_0451475_12_401 129
160 3300046538 Ga0495609_0192250 Ga0495609_0192250_439_828 129
161 3300046615 Ga0495656_0196865 Ga0495656_0196865_24_413 129
162 3300046675 Ga0495657_0330814 Ga0495657_0330814_93_482 129
163 3300048088 Ga0495602_0802770 Ga0495602_0802770_87_476 129
164 3300048903 Ga0496100_1644745 Ga0496100_1644745_17_406 129
165 3300048904 Ga0496101_0018103 Ga0496101_0018103_716_1108 129
166 3300048904 Ga0496101_0022764 Ga0496101_0022764_1357_1746 129
167 3300048906 Ga0496103_0401372 Ga0496103_0401372_145_537 129
168 3300048907 Ga0496104_0162467 Ga0496104_0162467_1364_1753 129
169 3300048908 Ga0496105_0007781 Ga0496105_0007781_5626_6015 129
170 3300048908 Ga0496105_0463829 Ga0496105_0463829_281_670 129
171 3300048909 Ga0496106_0078002 Ga0496106_0078002_929_1321 129
172 3300048910 Ga0496107_0036475 Ga0496107_0036475_1427_1816 129
173 3300048911 Ga0496108_0175357 Ga0496108_0175357_487_879 129
174 3300048911 Ga0496108_1245936 Ga0496108_1245936_163_552 129
175 3300048912 Ga0496109_0081097 Ga0496109_0081097_2163_2552 129
176 3300048913 Ga0496110_0172244 Ga0496110_0172244_51_440 129
177 3300048914 Ga0496111_0195574 Ga0496111_0195574_655_1044 129
178 3300048915 Ga0496112_0003239 Ga0496112_0003239_11217_11606 129
179 3300048915 Ga0496112_0196479 Ga0496112_0196479_1270_1659 129
180 3300048915 Ga0496112_0231054 Ga0496112_0231054_1347_1736 129
181 3300048915 Ga0496112_0271052 Ga0496112_0271052_1185_1574 129
182 3300048915 Ga0496112_0301830 Ga0496112_0301830_474_863 129
183 3300048916 Ga0496113_0090357 Ga0496113_0090357_791_1180 129
184 3300048916 Ga0496113_0114137 Ga0496113_0114137_49_438 129
185 3300048916 Ga0496113_0202188 Ga0496113_0202188_613_1002 129
186 3300048917 Ga0496114_0016697 Ga0496114_0016697_1868_2257 129
187 3300048917 Ga0496114_0129511 Ga0496114_0129511_241_630 129
188 3300048917 Ga0496114_0442679 Ga0496114_0442679_745_1134 129
189 3300048917 Ga0496114_0484870 Ga0496114_0484870_226_624 129
190 3300048918 Ga0496115_0000070 Ga0496115_0000070_72603_73001 129
191 3300048918 Ga0496115_0653661 Ga0496115_0653661_140_532 129
192 3300049578 Ga0501042_0175732 Ga0501042_0175732_846_1235 129
193 3300049583 Ga0501067_0464171 Ga0501067_0464171_300_689 129
194 3300049652 Ga0501202_090652 Ga0501202_090652_23_412 129
195 3300049742 Ga0501080_1729834 Ga0501080_1729834_32_421 129
196 3300049822 Ga0501035_1068044 Ga0501035_1068044_119_508 129
197 3300050507 nmdc:mga05p37_1555215_c1 nmdc:mga05p37_1555215_c1_60_449 129
198 3300050511 nmdc:mga08y16_617514_c1 nmdc:mga08y16_617514_c1_612_1001 129
199 3300050512 nmdc:mga0n895_191428_c1 nmdc:mga0n895_191428_c1_777_1166 129
200 3300053083 Ga0495655_0019030 Ga0495655_0019030_537_926 129
201 3300005435 Ga0070714_100183145 Ga0070714_1001831452 130
202 3300005439 Ga0070711_100329426 Ga0070711_1003294262 130
203 3300005530 Ga0070679_101249464 Ga0070679_1012494641 130
204 3300006028 Ga0070717_10025727 Ga0070717_100257274 130
205 3300009147 Ga0114129_10361810 Ga0114129_103618103 130
206 3300009177 Ga0105248_12805778 Ga0105248_128057782 130
207 3300025916 Ga0207663_10211853 Ga0207663_102118532 130
208 3300025921 Ga0207652_11571854 Ga0207652_115718542 130
209 3300025929 Ga0207664_10379930 Ga0207664_103799302 130
210 3300031852 Ga0307410_10275180 Ga0307410_102751803 130
211 3300042016 Ga0439463_194626 Ga0439463_194626_108_500 130
212 3300044693 Ga0466961_0854428 Ga0466961_0854428_127_519 130
213 3300044706 Ga0466964_0093360 Ga0466964_0093360_164_556 130
214 3300045976 Ga0466967_0100483 Ga0466967_0100483_1277_1741 130
215 3300045976 Ga0466967_2333221 Ga0466967_2333221_78_470 130
216 3300046691 Ga0495670_0239011 Ga0495670_0239011_36_428 130
217 3300046794 Ga0495589_0070571 Ga0495589_0070571_472_864 130
218 3300046810 Ga0495660_0271647 Ga0495660_0271647_278_670 130
219 3300048904 Ga0496101_0967131 Ga0496101_0967131_82_474 130
220 3300048913 Ga0496110_0471337 Ga0496110_0471337_12_404 130
221 3300048913 Ga0496110_1682464 Ga0496110_1682464_27_419 130
222 3300049570 Ga0501033_0205521 Ga0501033_0205521_337_729 130
223 3300049576 Ga0501040_0780427 Ga0501040_0780427_122_514 130
224 3300049580 Ga0501046_0104520 Ga0501046_0104520_1588_1980 130
225 3300049582 Ga0501048_0289866 Ga0501048_0289866_79_471 130
226 3300049591 Ga0501075_0453184 Ga0501075_0453184_487_879 130
227 3300049592 Ga0501076_0431015 Ga0501076_0431015_20_412 130
228 3300049743 Ga0501081_0185299 Ga0501081_0185299_219_611 130
229 3300049824 Ga0501045_0189071 Ga0501045_0189071_221_613 130
230 3300050507 nmdc:mga05p37_1337181_c1 nmdc:mga05p37_1337181_c1_128_520 130
231 3300060353 Ga0501082_0529802 Ga0501082_0529802_361_753 130
232 3300005329 Ga0070683_100133174 Ga0070683_1001331744 131
233 3300005333 Ga0070677_10000085 Ga0070677_1000008521 131
234 3300005435 Ga0070714_100032749 Ga0070714_1000327492 131
235 3300005435 Ga0070714_101527650 Ga0070714_1015276501 131
236 3300005436 Ga0070713_100140540 Ga0070713_1001405402 131
237 3300005436 Ga0070713_100478922 Ga0070713_1004789222 131
238 3300005457 Ga0070662_101065294 Ga0070662_1010652942 131
239 3300005535 Ga0070684_102204403 Ga0070684_1022044031 131
240 3300005981 Ga0081538_10000473 Ga0081538_1000047345 131
241 3300005985 Ga0081539_10002608 Ga0081539_1000260817 131
242 3300007788 Ga0099795_10343992 Ga0099795_103439922 131
243 3300009147 Ga0114129_11428618 Ga0114129_114286182 131
244 3300009553 Ga0105249_10418206 Ga0105249_104182063 131
245 3300009982 Ga0105147_117167 Ga0105147_1171671 131
246 3300013307 Ga0157372_10237183 Ga0157372_102371832 131
247 3300013307 Ga0157372_10252754 Ga0157372_102527542 131
248 3300014968 Ga0157379_10031006 Ga0157379_100310062 131
249 3300021384 Ga0213876_10078952 Ga0213876_100789522 131
250 3300025893 Ga0207682_10000060 Ga0207682_1000006036 131
251 3300025928 Ga0207700_10004257 Ga0207700_100042578 131
252 3300025928 Ga0207700_10375793 Ga0207700_103757931 131
253 3300025928 Ga0207700_10677604 Ga0207700_106776042 131
254 3300025929 Ga0207664_10649306 Ga0207664_106493062 131
255 3300025929 Ga0207664_10858080 Ga0207664_108580801 131
256 3300025935 Ga0207709_10140480 Ga0207709_101404802 131
257 3300025944 Ga0207661_10228670 Ga0207661_102286703 131
258 3300028379 Ga0268266_10484220 Ga0268266_104842202 131
259 3300028556 Ga0265337_1075739 Ga0265337_10757392 131
260 3300028577 Ga0265318_10104302 Ga0265318_101043022 131
261 3300031240 Ga0265320_10400134 Ga0265320_104001341 131
262 3300031251 Ga0265327_10006439 Ga0265327_100064394 131
263 3300031712 Ga0265342_10684683 Ga0265342_106846832 131
264 3300031824 Ga0307413_10040665 Ga0307413_100406652 131
265 3300031852 Ga0307410_10511685 Ga0307410_105116852 131
266 3300031901 Ga0307406_10353773 Ga0307406_103537733 131
267 3300031903 Ga0307407_10190297 Ga0307407_101902973 131
268 3300032126 Ga0307415_100004673 Ga0307415_1000046733 131
269 3300032126 Ga0307415_100019141 Ga0307415_1000191413 131
270 3300032126 Ga0307415_101961905 Ga0307415_1019619051 131
271 3300037418 Ga0395900_0128360 Ga0395900_0128360_2064_2459 131
272 3300037418 Ga0395900_0145216 Ga0395900_0145216_1817_2212 131
273 3300037418 Ga0395900_1281007 Ga0395900_1281007_209_604 131
274 3300037466 Ga0395898_0007962 Ga0395898_0007962_2862_3257 131
275 3300037466 Ga0395898_0015722 Ga0395898_0015722_2201_2596 131
276 3300037466 Ga0395898_0102124 Ga0395898_0102124_2215_2610 131
277 3300037471 Ga0395905_0006109 Ga0395905_0006109_2920_3315 131
278 3300037853 Ga0436364_1123500 Ga0436364_1123500_619_1032 131
279 3300037853 Ga0436364_1336883 Ga0436364_1336883_141_581 131
280 3300038443 Ga0395901_0010090 Ga0395901_0010090_4452_4847 131
281 3300038443 Ga0395901_0032512 Ga0395901_0032512_3980_4375 131
282 3300039437 Ga0436365_0321401 Ga0436365_0321401_263_658 131
283 3300039437 Ga0436365_1602523 Ga0436365_1602523_277_678 131
284 3300039450 Ga0436363_0087396 Ga0436363_0087396_174_578 131
285 3300039450 Ga0436363_0254830 Ga0436363_0254830_27_431 131
286 3300039450 Ga0436363_0613501 Ga0436363_0613501_34_441 131
287 3300041512 Ga0451853_3840077 Ga0451853_3840077_360_758 131
288 3300044656 Ga0466969_0017109 Ga0466969_0017109_2750_3151 131
289 3300044656 Ga0466969_0341113 Ga0466969_0341113_62_463 131
290 3300044683 Ga0466965_0141638 Ga0466965_0141638_175_573 131
291 3300044683 Ga0466965_0163202 Ga0466965_0163202_725_1153 131
292 3300044684 Ga0466966_0037228 Ga0466966_0037228_2224_2631 131
293 3300044694 Ga0466963_0005479 Ga0466963_0005479_5801_6229 131
294 3300044694 Ga0466963_0584453 Ga0466963_0584453_210_611 131
295 3300044706 Ga0466964_0065917 Ga0466964_0065917_699_1127 131
296 3300044719 Ga0466971_0048400 Ga0466971_0048400_1170_1598 131
297 3300044735 Ga0466968_0012904 Ga0466968_0012904_1255_1656 131
298 3300044735 Ga0466968_0109204 Ga0466968_0109204_800_1198 131
299 3300044735 Ga0466968_0219667 Ga0466968_0219667_323_721 131
300 3300044765 Ga0466970_0099349 Ga0466970_0099349_948_1346 131
301 3300044765 Ga0466970_0189495 Ga0466970_0189495_224_625 131
302 3300044842 Ga0466957_0006576 Ga0466957_0006576_5175_5603 131
303 3300044842 Ga0466957_0288823 Ga0466957_0288823_384_785 131
304 3300044901 Ga0466960_0473624 Ga0466960_0473624_129_533 131
305 3300045049 Ga0466959_0011553 Ga0466959_0011553_3017_3418 131
306 3300045049 Ga0466959_0012873 Ga0466959_0012873_1397_1825 131
307 3300045049 Ga0466959_0032069 Ga0466959_0032069_1865_2269 131
308 3300045049 Ga0466959_0504990 Ga0466959_0504990_387_794 131
309 3300045049 Ga0466959_0746467 Ga0466959_0746467_142_540 131
310 3300045836 Ga0466958_0002757 Ga0466958_0002757_2074_2475 131
311 3300045836 Ga0466958_0003754 Ga0466958_0003754_1953_2381 131
312 3300045836 Ga0466958_0015567 Ga0466958_0015567_2292_2696 131
313 3300045836 Ga0466958_0041520 Ga0466958_0041520_886_1287 131
314 3300045836 Ga0466958_0223302 Ga0466958_0223302_547_948 131
315 3300045976 Ga0466967_0008912 Ga0466967_0008912_5801_6229 131
316 3300045976 Ga0466967_0272098 Ga0466967_0272098_459_857 131
317 3300045976 Ga0466967_1576014 Ga0466967_1576014_27_425 131
318 3300045976 Ga0466967_1843447 Ga0466967_1843447_35_448 131
319 3300046461 Ga0495641_0000440 Ga0495641_0000440_136_591 131
320 3300046500 Ga0495596_0163858 Ga0495596_0163858_248_646 131
321 3300046511 Ga0495608_0052814 Ga0495608_0052814_1277_1675 131
322 3300046543 Ga0495645_0011564 Ga0495645_0011564_1555_1974 131
323 3300046663 Ga0495635_0405795 Ga0495635_0405795_199_597 131
324 3300046678 Ga0495599_0131502 Ga0495599_0131502_287_706 131
325 3300046684 Ga0495669_0000181 Ga0495669_0000181_33950_34348 131
326 3300047322 Ga0495680_0001363 Ga0495680_0001363_16387_16785 131
327 3300048903 Ga0496100_0000006 Ga0496100_0000006_72522_72920 131
328 3300048904 Ga0496101_0000009 Ga0496101_0000009_72522_72920 131
329 3300048907 Ga0496104_0000008 Ga0496104_0000008_259446_259844 131
330 3300048908 Ga0496105_0000003 Ga0496105_0000003_259446_259844 131
331 3300048909 Ga0496106_0000013 Ga0496106_0000013_124188_124604 131
332 3300048909 Ga0496106_0000064 Ga0496106_0000064_53420_53818 131
333 3300048910 Ga0496107_0000002 Ga0496107_0000002_289447_289845 131
334 3300048910 Ga0496107_0506313 Ga0496107_0506313_198_614 131
335 3300048911 Ga0496108_0000004 Ga0496108_0000004_312403_312801 131
336 3300048912 Ga0496109_0000031 Ga0496109_0000031_158616_159014 131
337 3300048922 Ga0496119_0170082 Ga0496119_0170082_685_1098 131
338 3300048928 Ga0496125_0087147 Ga0496125_0087147_1063_1461 131
339 3300049583 Ga0501067_0324855 Ga0501067_0324855_368_769 131
340 3300050507 nmdc:mga05p37_122257_c1 nmdc:mga05p37_122257_c1_2626_3030 131
341 3300053085 Ga0495619_0242556 Ga0495619_0242556_306_713 131
342 3300053123 Ga0500614_002080 Ga0500614_002080_4010_4465 131
343 3300061719 Ga0466962_0095598 Ga0466962_0095598_736_1164 131
344 3300061719 Ga0466962_0138609 Ga0466962_0138609_318_719 131
345 3300005328 Ga0070676_10221875 Ga0070676_102218752 132
346 3300005341 Ga0070691_10224925 Ga0070691_102249252 132
347 3300005347 Ga0070668_100004092 Ga0070668_1000040922 132
348 3300005457 Ga0070662_100106743 Ga0070662_1001067433 132
349 3300005545 Ga0070695_100494120 Ga0070695_1004941202 132
350 3300005546 Ga0070696_100390134 Ga0070696_1003901342 132
351 3300005546 Ga0070696_100411399 Ga0070696_1004113992 132
352 3300005615 Ga0070702_100033735 Ga0070702_1000337352 132
353 3300005618 Ga0068864_102311925 Ga0068864_1023119252 132
354 3300005719 Ga0068861_100002338 Ga0068861_1000023387 132
355 3300005843 Ga0068860_100489132 Ga0068860_1004891322 132
356 3300006844 Ga0075428_100099687 Ga0075428_1000996878 132
357 3300006844 Ga0075428_100992630 Ga0075428_1009926301 132
358 3300006846 Ga0075430_100087839 Ga0075430_1000878392 132
359 3300006847 Ga0075431_100457679 Ga0075431_1004576792 132
360 3300006847 Ga0075431_100521252 Ga0075431_1005212522 132
361 3300009094 Ga0111539_10125164 Ga0111539_101251644 132
362 3300009094 Ga0111539_13039689 Ga0111539_130396891 132
363 3300009098 Ga0105245_10010427 Ga0105245_100104278 132
364 3300009147 Ga0114129_10526274 Ga0114129_105262743 132
365 3300009147 Ga0114129_11358898 Ga0114129_113588982 132
366 3300009553 Ga0105249_10186486 Ga0105249_101864862 132
367 3300010375 Ga0105239_10605080 Ga0105239_106050802 132
368 3300013306 Ga0163162_10031767 Ga0163162_100317676 132
369 3300014326 Ga0157380_10255028 Ga0157380_102550282 132
370 3300017792 Ga0163161_10415226 Ga0163161_104152262 132
371 3300025901 Ga0207688_10146503 Ga0207688_101465031 132
372 3300025907 Ga0207645_10068654 Ga0207645_100686542 132
373 3300025933 Ga0207706_10026047 Ga0207706_100260475 132
374 3300025935 Ga0207709_10586784 Ga0207709_105867841 132
375 3300025972 Ga0207668_11345211 Ga0207668_113452112 132
376 3300025981 Ga0207640_10377330 Ga0207640_103773302 132
377 3300025981 Ga0207640_10577998 Ga0207640_105779982 132
378 3300026075 Ga0207708_10346183 Ga0207708_103461832 132
379 3300026075 Ga0207708_10485714 Ga0207708_104857142 132
380 3300026118 Ga0207675_100008394 Ga0207675_10000839411 132
381 3300027907 Ga0207428_10724219 Ga0207428_107242192 132
382 3300035691 Ga0373931_1157663 Ga0373931_1157663_26_427 132
383 3300037471 Ga0395905_0714062 Ga0395905_0714062_82_501 132
384 3300038443 Ga0395901_1060435 Ga0395901_1060435_196_594 132
385 3300046474 Ga0495605_0176410 Ga0495605_0176410_532_930 132
386 3300046518 Ga0495631_0195585 Ga0495631_0195585_367_765 132
387 3300050494 nmdc:mga06z11_576077_c1 nmdc:mga06z11_576077_c1_34_435 132
388 3300050509 nmdc:mga0qj67_81329_c1 nmdc:mga0qj67_81329_c1_591_1004 132
389 3300050510 nmdc:mga06r32_2059569_c1 nmdc:mga06r32_2059569_c1_66_464 132
390 3300050510 nmdc:mga06r32_455942_c1 nmdc:mga06r32_455942_c1_722_1135 132
391 3300050511 nmdc:mga08y16_157611_c1 nmdc:mga08y16_157611_c1_1198_1596 132
392 3300050511 nmdc:mga08y16_173205_c1 nmdc:mga08y16_173205_c1_1661_2062 132
393 3300050511 nmdc:mga08y16_1907003_c1 nmdc:mga08y16_1907003_c1_80_478 132
394 3300050511 nmdc:mga08y16_64036_c1 nmdc:mga08y16_64036_c1_3333_3734 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

12

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7805 1 115
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.7371 3 116
5a49-assembly4.cif.gz_D crystal structure of the lotus domain (aa 139-222) of drosophila oskar in c222 0.7339 7 32
5cd7-assembly1.cif.gz_B crystal structure of the ntd l199m of drosophila oskar protein 0.7334 7 31
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7138 1 116
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9281 4 123 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9131 4 123 3.30.70.1230
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8025 4 115 3.90.1150.30
af_K7KM28_9_104_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7825 102 127 1.20.1280.290
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7805 1 115 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A1C6SVR5-F1-model_v4 YjbR protein 0.9908 1 131
AF-A0A1C5IRY7-F1-model_v4 YjbR protein 0.9907 1 129
AF-A0A4R2B0V6-F1-model_v4 deleted 0.9854 1 128
AF-A0A2W6E1I1-F1-model_v4 MFS transporter 0.9841 1 130 GO:0016020
GO:0022857
AF-A0A2G7D472-F1-model_v4 deleted 0.9815 2 129

Feature Viewer

pLDDT pTM Quality
95.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map