F432778

General Info

Members Datasets Scaffolds Average Seq Length
394 250 374 275

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1002997|JGI25159J45721_10029979
Length 280
Sequence MALKSFKPITPSLRQLVIVDRSELYKGKPVKALTEGKSSSGGRNNLGRVTVRFRGGGHKRTLRLIDFKRRGKAGVPATVERIEYDPNRTAFIALIKYQDGELSYILAPQRLAVGDTVVAGDSVDVKPGNAAPMGSLPIGTIVHNVELKIGKGGALARSAGNYAQIVGRDQGYVIVRLNSGEQRLISGLCYATVGAVSNPDHMNINIGKAGRNRWLGKRPHNRGVSMNPVDHPHGGGEGRTSGGRHPVTPWGLPTKGKKTRSNKRTDTFIVSSRHARKKKN

Samples

Sample ID Description Type Environment
1 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
2 2643221733 Bosea sp. Root381 Isolate Unclassified
3 2643221734 Bosea sp. Root670 Isolate Unclassified
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2818991467 Bosea vestrisii 3192 Isolate Unclassified
6 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
7 2841760612 Bosea sp. Tri-49 Isolate Nodule
8 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
9 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
10 2844104063 Bosea sp. Tri-39 Isolate Nodule
11 2851182111 Bosea sp. Tri-44 Isolate Nodule
12 2851246043 Bosea sp. Tri-54 Isolate Nodule
13 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
14 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
15 2902330777 Methylobacterium sp. 2A Isolate Unclassified
16 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
17 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
18 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
242 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
250 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.25
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 1.78
Rhizoplane 7.61
Rhizosphere 69.54
Stem 0
Stem Tuber 0
Unclassified 8.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002997 3300002987 Bacteria 6137
2 JGI25151J46595_10000038 3300003187 Bacteria 180430
3 JGI25151J46595_10073845 3300003187 Bacteria 1019
4 JGI25406J46586_10002015 3300003203 Bacteria 9596
5 Ga0055524_1012814 3300003775 Bacteria 3199
6 JGI25405J52794_10001096 3300003911 Bacteria 4330
7 Ga0065165_1000631 3300005262 Bacteria 51108
8 Ga0070683_100048217 3300005329 Bacteria 3938
9 Ga0070680_100054740 3300005336 Bacteria 3259
10 Ga0070682_100005924 3300005337 Bacteria 6836
11 Ga0070661_100005946 3300005344 Bacteria 8403
12 Ga0070709_10376451 3300005434 Bacteria 1054
13 Ga0070714_100241439 3300005435 Bacteria 1667
14 Ga0070713_100554316 3300005436 Bacteria 1089
15 Ga0070705_100390587 3300005440 Bacteria 1027
16 Ga0070681_10323599 3300005458 Bacteria 1451
17 Ga0070679_100001504 3300005530 Bacteria 20719
18 Ga0068853_100018304 3300005539 Bacteria 5796
19 Ga0070695_100028351 3300005545 Bacteria 3474
20 Ga0070696_100202910 3300005546 Bacteria 1481
21 Ga0070704_100036333 3300005549 Bacteria 3357
22 Ga0068856_100158389 3300005614 Bacteria 2274
23 Ga0068856_100288197 3300005614 Bacteria 1659
24 Ga0068856_100543816 3300005614 Bacteria 1182
25 Ga0068863_100175261 3300005841 Bacteria 2058
26 Ga0081455_10017756 3300005937 Bacteria 6806
27 Ga0081455_10045433 3300005937 Bacteria 3821
28 Ga0081540_1001166 3300005983 Bacteria 23099
29 Ga0081540_1002979 3300005983 Bacteria 13570
30 Ga0081540_1008438 3300005983 Bacteria 7199
31 Ga0081540_1058910 3300005983 Bacteria 1847
32 Ga0081540_1102887 3300005983 Bacteria 1226
33 Ga0081539_10000072 3300005985 Bacteria 232726
34 Ga0075365_10142905 3300006038 Bacteria 1662
35 Ga0075368_10051034 3300006042 Bacteria 1644
36 Ga0075363_100045695 3300006048 Bacteria 2322
37 Ga0075364_10018996 3300006051 Bacteria 4311
38 Ga0075364_10278100 3300006051 Bacteria 1139
39 Ga0070712_100092798 3300006175 Bacteria 2215
40 Ga0075362_10030683 3300006177 Bacteria 2322
41 Ga0075362_10101966 3300006177 Bacteria 1343
42 Ga0075367_10023437 3300006178 Bacteria 3473
43 Ga0075367_10076256 3300006178 Bacteria 2023
44 Ga0075366_10052252 3300006195 Bacteria 2428
45 Ga0075370_10059976 3300006353 Bacteria 2167
46 Ga0075370_10085742 3300006353 Bacteria 1813
47 Ga0068871_100463349 3300006358 Bacteria 1138
48 Ga0068871_100522106 3300006358 Bacteria 1072
49 Ga0075428_100048564 3300006844 Bacteria 4657
50 Ga0075428_100759062 3300006844 Bacteria 1032
51 Ga0075430_100330917 3300006846 Bacteria 1259
52 Ga0075431_100206047 3300006847 Bacteria 2011
53 Ga0075431_100232077 3300006847 Bacteria 1880
54 Ga0075434_100171321 3300006871 Bacteria 2191
55 Ga0075434_100264185 3300006871 Bacteria 1740
56 Ga0075434_100297025 3300006871 Bacteria 1635
57 Ga0075434_100299829 3300006871 Bacteria 1628
58 Ga0075436_100440233 3300006914 Bacteria 948
59 Ga0075435_100017968 3300007076 Bacteria 5362
60 Ga0075435_100034006 3300007076 Bacteria 4035
61 Ga0099795_10001950 3300007788 Bacteria 4691
62 Ga0099795_10002818 3300007788 Bacteria 4190
63 Ga0111539_10146569 3300009094 Bacteria 2764
64 Ga0111539_10329258 3300009094 Bacteria 1778
65 Ga0111539_10636399 3300009094 Bacteria 1242
66 Ga0111539_10737950 3300009094 Bacteria 1146
67 Ga0105247_10184249 3300009101 Bacteria 1395
68 Ga0105241_10023779 3300009174 Bacteria 4547
69 Ga0105249_10008406 3300009553 Bacteria 8993
70 Ga0099796_10034350 3300010159 Bacteria 1674
71 Ga0157373_10078383 3300013100 Bacteria 2330
72 Ga0157370_10051498 3300013104 Bacteria 3933
73 Ga0157369_10750600 3300013105 Bacteria 1004
74 Ga0171462_1042 3300013250 Bacteria 66199
75 Ga0157374_10627755 3300013296 Bacteria 1085
76 Ga0157372_10004056 3300013307 Bacteria 15697
77 Ga0157372_10023820 3300013307 Bacteria 6641
78 Ga0157372_10101268 3300013307 Bacteria 3288
79 Ga0163161_10169715 3300017792 Bacteria 1667
80 Ga0213874_10015854 3300021377 Bacteria 1994
81 Ga0213876_10000421 3300021384 Bacteria 35344
82 Ga0213876_10035693 3300021384 Bacteria 2622
83 Ga0213876_10124936 3300021384 Bacteria 1366
84 Ga0209675_1002527 3300025291 Bacteria 9311
85 Ga0209676_1010666 3300025292 Bacteria 3791
86 Ga0209025_1020659 3300025294 Bacteria 3587
87 Ga0209025_1067347 3300025294 Bacteria 1294
88 Ga0209564_1009622 3300025295 Bacteria 4572
89 Ga0209564_1013840 3300025295 Bacteria 3394
90 Ga0209256_1000108 3300025299 Bacteria 185884
91 Ga0209256_1012507 3300025299 Bacteria 3237
92 Ga0207426_1036160 3300025302 Bacteria 1572
93 Ga0209257_1040268 3300025304 Bacteria 1396
94 Ga0207688_10212890 3300025901 Bacteria 1162
95 Ga0207699_10000164 3300025906 Bacteria 41177
96 Ga0207654_10007000 3300025911 Bacteria 5679
97 Ga0207654_10102125 3300025911 Bacteria 1768
98 Ga0207707_10004128 3300025912 Bacteria 12873
99 Ga0207671_10016535 3300025914 Bacteria 5730
100 Ga0207693_10001929 3300025915 Bacteria 18163
101 Ga0207693_10121023 3300025915 Bacteria 2056
102 Ga0207660_10028230 3300025917 Bacteria 3837
103 Ga0207649_10000194 3300025920 Bacteria 50112
104 Ga0207652_10023507 3300025921 Bacteria 5107
105 Ga0207694_10008694 3300025924 Bacteria 7666
106 Ga0207694_10024703 3300025924 Bacteria 4564
107 Ga0207700_10000295 3300025928 Bacteria 29631
108 Ga0207664_10028891 3300025929 Bacteria 4219
109 Ga0207690_10084726 3300025932 Bacteria 2222
110 Ga0207686_10366492 3300025934 Bacteria 1089
111 Ga0207686_10398993 3300025934 Bacteria 1047
112 Ga0207665_10070338 3300025939 Bacteria 2388
113 Ga0207665_10132259 3300025939 Bacteria 1772
114 Ga0207667_10006198 3300025949 Bacteria 14519
115 Ga0207639_10010763 3300026041 Bacteria 6339
116 Ga0207639_10024485 3300026041 Bacteria 4369
117 Ga0207678_10547144 3300026067 Bacteria 1012
118 Ga0207702_10000315 3300026078 Bacteria 55383
119 Ga0207702_10009824 3300026078 Bacteria 8022
120 Ga0207641_10154200 3300026088 Bacteria 2083
121 Ga0207674_10001605 3300026116 Bacteria 29115
122 Ga0207674_10431870 3300026116 Bacteria 1273
123 Ga0207428_10164487 3300027907 Bacteria 1683
124 Ga0265319_1033580 3300028563 Bacteria 1771
125 Ga0265318_10037481 3300028577 Bacteria 1857
126 Ga0307515_10058447 3300028794 Bacteria 5553
127 Ga0265330_10143525 3300031235 Bacteria 1015
128 Ga0265332_10120196 3300031238 Bacteria 1104
129 Ga0265328_10005372 3300031239 Bacteria 5487
130 Ga0265328_10012983 3300031239 Bacteria 3304
131 Ga0265328_10031036 3300031239 Bacteria 1988
132 Ga0265320_10002069 3300031240 Bacteria 14126
133 Ga0265320_10149245 3300031240 Bacteria 1056
134 Ga0265325_10001732 3300031241 Bacteria 15146
135 Ga0265325_10012680 3300031241 Bacteria 4814
136 Ga0265325_10060434 3300031241 Bacteria 1925
137 Ga0265325_10092675 3300031241 Bacteria 1487
138 Ga0265340_10034317 3300031247 Bacteria 2524
139 Ga0265339_10009282 3300031249 Bacteria 6196
140 Ga0265339_10020355 3300031249 Bacteria 3877
141 Ga0265331_10000186 3300031250 Bacteria 76149
142 Ga0265316_10312002 3300031344 Bacteria 1144
143 Ga0307513_10246553 3300031456 Bacteria 1586
144 Ga0307408_100398250 3300031548 Bacteria 1181
145 Ga0265314_10009081 3300031711 Bacteria 8445
146 Ga0265314_10011365 3300031711 Bacteria 7357
147 Ga0265314_10056950 3300031711 Bacteria 2688
148 Ga0265314_10075353 3300031711 Bacteria 2245
149 Ga0265342_10018135 3300031712 Bacteria 4565
150 Ga0265342_10190159 3300031712 Bacteria 1121
151 Ga0307412_10215875 3300031911 Bacteria 1467
152 Ga0307416_100713104 3300032002 Bacteria 1093
153 Ga0307415_100124843 3300032126 Bacteria 1938
154 Ga0373952_0069462 3300035092 Bacteria 878
155 Ga0373936_0124547 3300035113 Bacteria 1104
156 Ga0373954_0032286 3300035118 Bacteria 2420
157 Ga0373957_0118792 3300035120 Bacteria 1069
158 Ga0373957_0124230 3300035120 Bacteria 1047
159 Ga0373960_0004525 3300035121 Bacteria 3192
160 Ga0373960_0017321 3300035121 Bacteria 1866
161 Ga0373955_0017677 3300035172 Bacteria 3533
162 Ga0373955_0086334 3300035172 Bacteria 1782
163 Ga0373931_0028558 3300035691 Bacteria 2857
164 Ga0373931_0255360 3300035691 Bacteria 1067
165 Ga0373927_0029560 3300035695 Bacteria 3572
166 Ga0373927_0168305 3300035695 Bacteria 1436
167 Ga0373927_0397886 3300035695 Bacteria 909
168 Ga0373933_0215247 3300035724 Bacteria 1232
169 Ga0373947_0073289 3300035725 Bacteria 2104
170 Ga0373947_0093943 3300035725 Bacteria 1875
171 Ga0373937_0000738 3300036401 Bacteria 28294
172 Ga0373937_0031089 3300036401 Bacteria 4835
173 Ga0373937_0058492 3300036401 Bacteria 3541
174 Ga0373937_0101501 3300036401 Bacteria 2670
175 Ga0373937_0257814 3300036401 Bacteria 1644
176 Ga0316582_0431603 3300036647 Bacteria 908
177 Ga0373925_0066308 3300037068 Bacteria 2721
178 Ga0373925_0498789 3300037068 Bacteria 999
179 Ga0395899_0250880 3300037312 Bacteria 1214
180 Ga0395898_0021940 3300037466 Bacteria 6467
181 Ga0395898_0064043 3300037466 Bacteria 3567
182 Ga0395905_0096583 3300037471 Bacteria 2774
183 Ga0436364_0558119 3300037853 Bacteria 1635
184 Ga0436364_0589736 3300037853 Bacteria 935
185 Ga0395901_0123175 3300038443 Bacteria 2725
186 Ga0436365_1438629 3300039437 Bacteria 4753
187 Ga0436365_1605872 3300039437 Bacteria 2574
188 Ga0436365_1637588 3300039437 Bacteria 49130
189 Ga0436365_1651480 3300039437 Bacteria 1666
190 Ga0436361_0557120 3300039447 Bacteria 1219
191 Ga0436361_0933235 3300039447 Bacteria 1851
192 Ga0436363_0018473 3300039450 Bacteria 924
193 Ga0436363_0051045 3300039450 Bacteria 1724
194 Ga0436363_0072767 3300039450 Bacteria 7075
195 Ga0436363_1076340 3300039450 Bacteria 1043
196 Ga0436363_1187923 3300039450 Bacteria 1470
197 Ga0436363_1404294 3300039450 Bacteria 4549
198 Ga0451787_441428 3300041441 Bacteria 864
199 Ga0439434_0078611 3300042435 Bacteria 1045
200 Ga0439435_0049578 3300042436 Bacteria 1198
201 Ga0466969_0214919 3300044656 Bacteria 875
202 Ga0453684_0000204 3300044712 Bacteria 258105
203 Ga0453684_0001066 3300044712 Bacteria 87216
204 Ga0466968_0034646 3300044735 Bacteria 2108
205 Ga0466968_0056953 3300044735 Bacteria 1679
206 Ga0466960_0051465 3300044901 Bacteria 1990
207 Ga0466967_0382069 3300045976 Bacteria 1367
208 Ga0495603_0225375 3300046455 Bacteria 1081
209 Ga0495590_0018187 3300046457 Bacteria 2519
210 Ga0495638_0080377 3300046460 Bacteria 1981
211 Ga0495580_0398438 3300046472 Bacteria 928
212 Ga0495582_0013538 3300046473 Bacteria 4492
213 Ga0495639_0126597 3300046475 Bacteria 1221
214 Ga0495639_0137039 3300046475 Bacteria 1175
215 Ga0495664_0338644 3300046477 Bacteria 906
216 Ga0495584_0027107 3300046491 Bacteria 2904
217 Ga0495630_0274888 3300046517 Bacteria 1287
218 Ga0495643_0036171 3300046522 Bacteria 2714
219 Ga0495665_0072108 3300046531 Bacteria 1819
220 Ga0495587_0239270 3300046536 Bacteria 1022
221 Ga0495657_0088120 3300046675 Bacteria 1996
222 Ga0495657_0141296 3300046675 Bacteria 1500
223 Ga0495623_0050531 3300046679 Bacteria 2633
224 Ga0495658_0015745 3300046683 Bacteria 3883
225 Ga0495613_0109172 3300046689 Bacteria 1995
226 Ga0495589_0065618 3300046794 Bacteria 1779
227 Ga0495675_0033574 3300047444 Bacteria 3275
228 Ga0495684_0228459 3300047471 Bacteria 1362
229 Ga0495593_0084279 3300047673 Bacteria 1641
230 Ga0495602_0297686 3300048088 Bacteria 1182
231 Ga0496100_0007174 3300048903 Bacteria 6124
232 Ga0496101_0000949 3300048904 Bacteria 17107
233 Ga0496101_0125826 3300048904 Bacteria 1942
234 Ga0496102_0001868 3300048905 Bacteria 18139
235 Ga0496102_0188965 3300048905 Bacteria 1941
236 Ga0496102_0347755 3300048905 Bacteria 1396
237 Ga0496104_0047615 3300048907 Bacteria 4041
238 Ga0496104_0240701 3300048907 Bacteria 1722
239 Ga0496105_0004564 3300048908 Bacteria 10430
240 Ga0496105_0098094 3300048908 Bacteria 2420
241 Ga0496106_0023942 3300048909 Bacteria 4537
242 Ga0496106_0042430 3300048909 Bacteria 3412
243 Ga0496107_0000964 3300048910 Bacteria 17066
244 Ga0496107_0253130 3300048910 Bacteria 1310
245 Ga0496108_0018180 3300048911 Bacteria 5753
246 Ga0496109_0097826 3300048912 Bacteria 2720
247 Ga0496109_0556019 3300048912 Bacteria 1082
248 Ga0496110_0001009 3300048913 Bacteria 19840
249 Ga0496110_0502306 3300048913 Bacteria 1104
250 Ga0496111_0021147 3300048914 Bacteria 4539
251 Ga0496112_0121258 3300048915 Bacteria 2584
252 Ga0496113_0099927 3300048916 Bacteria 2247
253 Ga0496114_0013111 3300048917 Bacteria 6641
254 Ga0496114_0161738 3300048917 Bacteria 1947
255 Ga0496115_0044289 3300048918 Bacteria 3549
256 Ga0496115_0076081 3300048918 Bacteria 2728
257 Ga0496115_0250809 3300048918 Bacteria 1457
258 Ga0496115_0264718 3300048918 Bacteria 1413
259 Ga0496115_0281816 3300048918 Bacteria 1364
260 Ga0496117_0180277 3300048920 Bacteria 1215
261 Ga0496118_0107507 3300048921 Bacteria 1863
262 Ga0496119_0000372 3300048922 Bacteria 62094
263 Ga0496122_0041350 3300048925 Bacteria 3646
264 Ga0496123_0008564 3300048926 Bacteria 9374
265 Ga0496123_0017126 3300048926 Bacteria 5847
266 Ga0496126_0185973 3300048929 Bacteria 1762
267 Ga0501327_00309 3300049543 Bacteria 1815
268 Ga0501031_0011241 3300049568 Bacteria 5833
269 Ga0501031_0294626 3300049568 Bacteria 1052
270 Ga0501032_0028510 3300049569 Bacteria 3837
271 Ga0501033_0021359 3300049570 Bacteria 4883
272 Ga0501033_0130524 3300049570 Bacteria 1820
273 Ga0501034_0060811 3300049571 Bacteria 3794
274 Ga0501034_0081396 3300049571 Bacteria 3240
275 Ga0501036_0021849 3300049572 Bacteria 5380
276 Ga0501037_0033344 3300049573 Bacteria 3804
277 Ga0501037_0048165 3300049573 Bacteria 3123
278 Ga0501038_0069887 3300049574 Bacteria 2982
279 Ga0501038_0227511 3300049574 Bacteria 1486
280 Ga0501039_0021292 3300049575 Bacteria 4976
281 Ga0501040_0026075 3300049576 Bacteria 3932
282 Ga0501043_0021749 3300049579 Bacteria 5029
283 Ga0501043_0037798 3300049579 Bacteria 3797
284 Ga0501046_0122100 3300049580 Bacteria 1981
285 Ga0501047_0044775 3300049581 Bacteria 4277
286 Ga0501047_0076535 3300049581 Bacteria 3220
287 Ga0501047_0077925 3300049581 Bacteria 3187
288 Ga0501067_0026798 3300049583 Bacteria 3192
289 Ga0501068_0084817 3300049584 Bacteria 1949
290 Ga0501068_0171210 3300049584 Bacteria 1371
291 Ga0501070_0063119 3300049586 Bacteria 3068
292 Ga0501070_0233062 3300049586 Bacteria 1508
293 Ga0501070_0328506 3300049586 Bacteria 1243
294 Ga0501070_0415095 3300049586 Bacteria 1087
295 Ga0501071_0092379 3300049587 Bacteria 2224
296 Ga0501071_0471230 3300049587 Bacteria 962
297 Ga0501072_0008088 3300049588 Bacteria 7980
298 Ga0501072_0425531 3300049588 Bacteria 1052
299 Ga0501073_0166482 3300049589 Bacteria 1526
300 Ga0501073_0181298 3300049589 Bacteria 1457
301 Ga0501074_0041714 3300049590 Bacteria 3322
302 Ga0501074_0234931 3300049590 Bacteria 1305
303 Ga0501075_0024744 3300049591 Bacteria 4407
304 Ga0501075_0090413 3300049591 Bacteria 2322
305 Ga0501076_0008045 3300049592 Bacteria 7705
306 Ga0501076_0119530 3300049592 Bacteria 2133
307 Ga0501077_0005917 3300049593 Bacteria 7462
308 Ga0501077_0012732 3300049593 Bacteria 5269
309 Ga0501079_0016187 3300049741 Bacteria 5699
310 Ga0501079_0025432 3300049741 Bacteria 4541
311 Ga0501079_0235003 3300049741 Bacteria 1432
312 Ga0501080_0021864 3300049742 Bacteria 5924
313 Ga0501080_0075103 3300049742 Bacteria 3144
314 Ga0501080_0122901 3300049742 Bacteria 2405
315 Ga0501080_0384667 3300049742 Bacteria 1264
316 Ga0501081_0006130 3300049743 Bacteria 7794
317 Ga0501081_0071195 3300049743 Bacteria 2424
318 Ga0501081_0279647 3300049743 Bacteria 1222
319 Ga0501083_0089467 3300049744 Bacteria 2034
320 Ga0501083_0099160 3300049744 Bacteria 1922
321 Ga0501083_0425079 3300049744 Bacteria 864
322 Ga0501035_0030092 3300049822 Bacteria 4950
323 Ga0501035_0066191 3300049822 Bacteria 3207
324 Ga0501035_0310484 3300049822 Bacteria 1327
325 Ga0501044_0266901 3300049823 Bacteria 1648
326 Ga0501044_0528398 3300049823 Bacteria 1079
327 nmdc:mga03683_18198_c1 3300050489 Bacteria 2667
328 nmdc:mga03683_55888_c1 3300050489 Bacteria 1328
329 nmdc:mga03n38_20527_c1 3300050490 Bacteria 2644
330 nmdc:mga03n38_73225_c1 3300050490 Bacteria 1590
331 nmdc:mga0yw44_19482_c1 3300050492 Bacteria 3743
332 nmdc:mga0yw44_322025_c1 3300050492 Bacteria 1038
333 nmdc:mga0k408_102831_c1 3300050493 Bacteria 1685
334 nmdc:mga0k408_61824_c1 3300050493 Bacteria 2177
335 nmdc:mga06z11_162159_c1 3300050494 Bacteria 1278
336 nmdc:mga06z11_7008_c1 3300050494 Bacteria 4623
337 nmdc:mga04h51_11959_c1 3300050495 Bacteria 2424
338 nmdc:mga07m45_109470_c1 3300050496 Bacteria 1590
339 nmdc:mga0qj67_44746_c1 3300050509 Bacteria 3491
340 nmdc:mga08y16_136821_c1 3300050511 Bacteria 2546
341 nmdc:mga0n895_129615_c1 3300050512 Bacteria 2547
342 nmdc:mga0n895_189483_c1 3300050512 Bacteria 2088
343 nmdc:mga0n895_5268_c1 3300050512 Bacteria 10768
344 nmdc:mga0n895_77293_c1 3300050512 Bacteria 3311
345 nmdc:mga0rr50_173981_c1 3300050513 Bacteria 1756
346 nmdc:mga0rr50_56004_c1 3300050513 Bacteria 2944
347 nmdc:mga0rr50_94274_c2 3300050513 Bacteria 2026
348 nmdc:mga08x19_14934_c1 3300050514 Bacteria 4717
349 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
350 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
351 nmdc:mga08x19_304299_c1 3300050514 Bacteria 1107
352 nmdc:mga0a205_138806_c1 3300050515 Bacteria 2331
353 nmdc:mga0a205_66873_c1 3300050515 Bacteria 3472
354 nmdc:mga0sz30_15892_c1 3300050516 Bacteria 2979
355 Ga0495595_0065981 3300053084 Bacteria 1703
356 Ga0495619_0044655 3300053085 Bacteria 2909
357 Ga0500583_0130073 3300053092 Bacteria 1248
358 Ga0500556_0000009 3300053104 Bacteria 288111
359 Ga0500608_041660 3300053122 Bacteria 2203
360 Ga0500604_0014568 3300053151 Bacteria 2142
361 Ga0500622_0008990 3300053156 Bacteria 5552
362 Ga0500639_089670 3300053163 Bacteria 1534
363 Ga0500636_0009188 3300053177 Bacteria 5746
364 Ga0500636_0106904 3300053177 Bacteria 1585
365 Ga0501084_0004756 3300054114 Bacteria 11097
366 Ga0501084_0022460 3300054114 Bacteria 5264
367 Ga0501084_0102026 3300054114 Bacteria 2409
368 Ga0501082_0008238 3300060353 Bacteria 8988
369 Ga0501082_0049682 3300060353 Bacteria 3617
370 Ga0501082_0246759 3300060353 Bacteria 1554
371 Ga0501082_0710547 3300060353 Bacteria 880
372 Ga0530510_0059077 3300061734 Bacteria 2774
373 Ga0530510_0096970 3300061734 Bacteria 2155
374 Ga0530510_0431731 3300061734 Bacteria 995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10398993 Ga0207686_103989932 226
2 3300048910 Ga0496107_0253130 Ga0496107_0253130_599_1285 228
3 3300048912 Ga0496109_0556019 Ga0496109_0556019_386_1072 228
4 3300050492 nmdc:mga0yw44_322025_c1 nmdc:mga0yw44_322025_c1_317_1003 228
5 3300046472 Ga0495580_0398438 Ga0495580_0398438_225_917 230
6 3300049543 Ga0501327_00309 Ga0501327_00309_35_736 233
7 iso_pu_bacteria 2876808645 2876810433 236
8 3300035695 Ga0373927_0168305 Ga0373927_0168305_684_1424 246
9 3300035092 Ga0373952_0069462 Ga0373952_0069462_27_776 249
10 3300049573 Ga0501037_0048165 Ga0501037_0048165_2362_3111 249
11 3300026116 Ga0207674_10431870 Ga0207674_104318702 252
12 3300041441 Ga0451787_441428 Ga0451787_441428_21_842 252
13 3300046794 Ga0495589_0065618 Ga0495589_0065618_664_1437 256
14 3300048917 Ga0496114_0161738 Ga0496114_0161738_10_789 259
15 3300050513 nmdc:mga0rr50_94274_c2 nmdc:mga0rr50_94274_c2_1222_2004 260
16 3300060353 Ga0501082_0710547 Ga0501082_0710547_52_837 261
17 3300035695 Ga0373927_0397886 Ga0373927_0397886_100_888 262
18 3300039450 Ga0436363_0018473 Ga0436363_0018473_20_808 262
19 3300035695 Ga0373927_0029560 Ga0373927_0029560_2023_2856 264
20 3300046457 Ga0495590_0018187 Ga0495590_0018187_612_1445 264
21 3300046473 Ga0495582_0013538 Ga0495582_0013538_265_1098 264
22 3300046475 Ga0495639_0126597 Ga0495639_0126597_300_1133 264
23 3300046477 Ga0495664_0338644 Ga0495664_0338644_37_831 264
24 3300046531 Ga0495665_0072108 Ga0495665_0072108_869_1702 264
25 3300046683 Ga0495658_0015745 Ga0495658_0015745_2383_3216 264
26 3300037068 Ga0373925_0066308 Ga0373925_0066308_176_1012 265
27 3300046455 Ga0495603_0225375 Ga0495603_0225375_126_962 265
28 3300049586 Ga0501070_0415095 Ga0501070_0415095_130_960 265
29 3300005983 Ga0081540_1008438 Ga0081540_100843815 266
30 3300006871 Ga0075434_100299829 Ga0075434_1002998292 266
31 3300009094 Ga0111539_10146569 Ga0111539_101465694 266
32 3300027907 Ga0207428_10164487 Ga0207428_101644872 266
33 3300035725 Ga0373947_0093943 Ga0373947_0093943_204_1037 266
34 3300050494 nmdc:mga06z11_162159_c1 nmdc:mga06z11_162159_c1_335_1174 266
35 3300050511 nmdc:mga08y16_136821_c1 nmdc:mga08y16_136821_c1_541_1380 266
36 3300050512 nmdc:mga0n895_189483_c1 nmdc:mga0n895_189483_c1_1227_2066 266
37 3300050515 nmdc:mga0a205_66873_c1 nmdc:mga0a205_66873_c1_1514_2353 266
38 3300044712 Ga0453684_0000204 Ga0453684_0000204_2158_2994 268
39 3300049742 Ga0501080_0075103 Ga0501080_0075103_906_1745 268
40 3300026067 Ga0207678_10547144 Ga0207678_105471441 269
41 3300044735 Ga0466968_0034646 Ga0466968_0034646_893_1729 269
42 3300049586 Ga0501070_0233062 Ga0501070_0233062_383_1219 269
43 3300031241 Ga0265325_10012680 Ga0265325_100126805 270
44 3300031712 Ga0265342_10190159 Ga0265342_101901592 270
45 3300039447 Ga0436361_0933235 Ga0436361_0933235_802_1638 270
46 3300009553 Ga0105249_10008406 Ga0105249_1000840615 271
47 3300013105 Ga0157369_10750600 Ga0157369_107506001 271
48 3300049741 Ga0501079_0235003 Ga0501079_0235003_310_1143 271
49 3300005344 Ga0070661_100005946 Ga0070661_10000594615 272
50 3300005614 Ga0068856_100158389 Ga0068856_1001583893 272
51 3300006178 Ga0075367_10076256 Ga0075367_100762563 272
52 3300025920 Ga0207649_10000194 Ga0207649_1000019466 272
53 3300031240 Ga0265320_10002069 Ga0265320_1000206923 272
54 3300031241 Ga0265325_10060434 Ga0265325_100604343 272
55 3300031711 Ga0265314_10075353 Ga0265314_100753534 272
56 3300035118 Ga0373954_0032286 Ga0373954_0032286_1053_1889 272
57 3300035120 Ga0373957_0124230 Ga0373957_0124230_170_1006 272
58 3300035724 Ga0373933_0215247 Ga0373933_0215247_366_1202 272
59 3300036401 Ga0373937_0101501 Ga0373937_0101501_1568_2404 272
60 3300044712 Ga0453684_0001066 Ga0453684_0001066_2128_2964 272
61 3300047471 Ga0495684_0228459 Ga0495684_0228459_183_1019 272
62 3300049569 Ga0501032_0028510 Ga0501032_0028510_2139_2975 272
63 3300049570 Ga0501033_0130524 Ga0501033_0130524_594_1430 272
64 3300049571 Ga0501034_0081396 Ga0501034_0081396_2051_2887 272
65 3300049572 Ga0501036_0021849 Ga0501036_0021849_1317_2153 272
66 3300049573 Ga0501037_0033344 Ga0501037_0033344_2410_3246 272
67 3300049574 Ga0501038_0069887 Ga0501038_0069887_155_991 272
68 3300049579 Ga0501043_0021749 Ga0501043_0021749_728_1564 272
69 3300049580 Ga0501046_0122100 Ga0501046_0122100_64_900 272
70 3300049581 Ga0501047_0076535 Ga0501047_0076535_2047_2883 272
71 3300049584 Ga0501068_0084817 Ga0501068_0084817_155_991 272
72 3300049586 Ga0501070_0063119 Ga0501070_0063119_1292_2128 272
73 3300049744 Ga0501083_0089467 Ga0501083_0089467_825_1661 272
74 3300049822 Ga0501035_0030092 Ga0501035_0030092_2091_2927 272
75 3300003911 JGI25405J52794_10001096 JGI25405J52794_100010967 273
76 3300006358 Ga0068871_100463349 Ga0068871_1004633492 273
77 3300006358 Ga0068871_100522106 Ga0068871_1005221061 273
78 3300009094 Ga0111539_10329258 Ga0111539_103292581 273
79 3300013307 Ga0157372_10023820 Ga0157372_100238207 273
80 3300013307 Ga0157372_10101268 Ga0157372_101012687 273
81 3300021384 Ga0213876_10000421 Ga0213876_100004217 273
82 3300031250 Ga0265331_10000186 Ga0265331_1000018629 273
83 3300039437 Ga0436365_1637588 Ga0436365_1637588_29981_30820 273
84 3300039450 Ga0436363_1404294 Ga0436363_1404294_430_1269 273
85 3300049576 Ga0501040_0026075 Ga0501040_0026075_2325_3146 273
86 3300049590 Ga0501074_0041714 Ga0501074_0041714_1562_2383 273
87 3300049591 Ga0501075_0090413 Ga0501075_0090413_419_1240 273
88 3300049592 Ga0501076_0008045 Ga0501076_0008045_2154_2975 273
89 3300049593 Ga0501077_0012732 Ga0501077_0012732_1856_2677 273
90 3300049741 Ga0501079_0016187 Ga0501079_0016187_2397_3218 273
91 3300049742 Ga0501080_0021864 Ga0501080_0021864_2161_2982 273
92 3300049744 Ga0501083_0099160 Ga0501083_0099160_145_966 273
93 3300054114 Ga0501084_0004756 Ga0501084_0004756_9108_9929 273
94 3300060353 Ga0501082_0008238 Ga0501082_0008238_6523_7344 273
95 3300061734 Ga0530510_0096970 Ga0530510_0096970_764_1585 273
96 iso_pu_bacteria 2828305725 2828310149 273
97 iso_pu_bacteria 2919450847 2919456084 273
98 iso_pu_bacteria 8001845381 8001845399 273
99 3300031238 Ga0265332_10120196 Ga0265332_101201962 274
100 3300031241 Ga0265325_10092675 Ga0265325_100926752 274
101 3300031247 Ga0265340_10034317 Ga0265340_100343172 274
102 3300031712 Ga0265342_10018135 Ga0265342_100181358 274
103 3300049588 Ga0501072_0008088 Ga0501072_0008088_92_916 274
104 3300054114 Ga0501084_0102026 Ga0501084_0102026_1166_1990 274
105 iso_pu_bacteria 2595698237 2596374055 274
106 iso_pu_bacteria 2889306138 2889311568 274
107 iso_pu_bacteria 2902330777 2902334108 274
108 iso_pu_bacteria 2928125067 2928129946 274
109 3300006844 Ga0075428_100759062 Ga0075428_1007590621 275
110 3300009094 Ga0111539_10737950 Ga0111539_107379502 275
111 3300006048 Ga0075363_100045695 Ga0075363_1000456954 276
112 3300006871 Ga0075434_100264185 Ga0075434_1002641853 276
113 3300007076 Ga0075435_100034006 Ga0075435_1000340068 276
114 3300021384 Ga0213876_10035693 Ga0213876_100356933 276
115 3300035113 Ga0373936_0124547 Ga0373936_0124547_32_862 276
116 3300035121 Ga0373960_0017321 Ga0373960_0017321_1009_1839 276
117 3300039437 Ga0436365_1438629 Ga0436365_1438629_2869_3702 276
118 3300046675 Ga0495657_0088120 Ga0495657_0088120_308_1138 276
119 3300046689 Ga0495613_0109172 Ga0495613_0109172_336_1166 276
120 3300047673 Ga0495593_0084279 Ga0495593_0084279_475_1305 276
121 3300049568 Ga0501031_0011241 Ga0501031_0011241_671_1501 276
122 3300049570 Ga0501033_0021359 Ga0501033_0021359_2281_3111 276
123 3300049571 Ga0501034_0060811 Ga0501034_0060811_657_1487 276
124 3300049575 Ga0501039_0021292 Ga0501039_0021292_3379_4209 276
125 3300049579 Ga0501043_0037798 Ga0501043_0037798_2880_3710 276
126 3300049581 Ga0501047_0077925 Ga0501047_0077925_1834_2664 276
127 3300049584 Ga0501068_0171210 Ga0501068_0171210_67_903 276
128 3300049587 Ga0501071_0092379 Ga0501071_0092379_904_1734 276
129 3300049822 Ga0501035_0066191 Ga0501035_0066191_2302_3132 276
130 3300049823 Ga0501044_0266901 Ga0501044_0266901_276_1106 276
131 3300050490 nmdc:mga03n38_20527_c1 nmdc:mga03n38_20527_c1_533_1366 276
132 3300050496 nmdc:mga07m45_109470_c1 nmdc:mga07m45_109470_c1_261_1094 276
133 3300050514 nmdc:mga08x19_304299_c1 nmdc:mga08x19_304299_c1_261_1091 276
134 iso_pu_bacteria 2643221733 2644729054 276
135 iso_pu_bacteria 2643221734 2644735410 276
136 iso_pu_bacteria 2643221736 2644747755 276
137 iso_pu_bacteria 2818991467 2819720923 276
138 iso_pu_bacteria 2841760612 2841761379 276
139 iso_pu_bacteria 2841911363 2841913382 276
140 iso_pu_bacteria 2841917233 2841919129 276
141 iso_pu_bacteria 2844104063 2844104404 276
142 iso_pu_bacteria 2851182111 2851184451 276
143 iso_pu_bacteria 2851246043 2851247392 276
144 iso_pu_bacteria 2917699015 2917699268 276
145 iso_pu_bacteria 8057529695 8057530438 276
146 3300005434 Ga0070709_10376451 Ga0070709_103764511 277
147 3300005614 Ga0068856_100288197 Ga0068856_1002881971 277
148 3300005614 Ga0068856_100543816 Ga0068856_1005438162 277
149 3300009101 Ga0105247_10184249 Ga0105247_101842492 277
150 3300013296 Ga0157374_10627755 Ga0157374_106277552 277
151 3300017792 Ga0163161_10169715 Ga0163161_101697152 277
152 3300037466 Ga0395898_0021940 Ga0395898_0021940_3339_4172 277
153 3300037466 Ga0395898_0064043 Ga0395898_0064043_1480_2313 277
154 3300039450 Ga0436363_1076340 Ga0436363_1076340_35_868 277
155 3300042435 Ga0439434_0078611 Ga0439434_0078611_22_855 277
156 3300042436 Ga0439435_0049578 Ga0439435_0049578_130_963 277
157 3300045976 Ga0466967_0382069 Ga0466967_0382069_96_929 277
158 3300048903 Ga0496100_0007174 Ga0496100_0007174_1136_1969 277
159 3300048904 Ga0496101_0000949 Ga0496101_0000949_16099_16932 277
160 3300048905 Ga0496102_0001868 Ga0496102_0001868_14792_15625 277
161 3300048907 Ga0496104_0047615 Ga0496104_0047615_1537_2370 277
162 3300048908 Ga0496105_0004564 Ga0496105_0004564_9220_10053 277
163 3300048909 Ga0496106_0023942 Ga0496106_0023942_1397_2230 277
164 3300048910 Ga0496107_0000964 Ga0496107_0000964_13252_14085 277
165 3300048911 Ga0496108_0018180 Ga0496108_0018180_3586_4419 277
166 3300048912 Ga0496109_0097826 Ga0496109_0097826_21_854 277
167 3300048913 Ga0496110_0001009 Ga0496110_0001009_4500_5333 277
168 3300048914 Ga0496111_0021147 Ga0496111_0021147_2770_3603 277
169 3300048915 Ga0496112_0121258 Ga0496112_0121258_1641_2474 277
170 3300048916 Ga0496113_0099927 Ga0496113_0099927_390_1223 277
171 3300048918 Ga0496115_0044289 Ga0496115_0044289_2283_3116 277
172 3300048922 Ga0496119_0000372 Ga0496119_0000372_34026_34859 277
173 3300048925 Ga0496122_0041350 Ga0496122_0041350_2249_3082 277
174 3300048926 Ga0496123_0017126 Ga0496123_0017126_2209_3042 277
175 3300049568 Ga0501031_0294626 Ga0501031_0294626_107_940 277
176 3300049583 Ga0501067_0026798 Ga0501067_0026798_444_1277 277
177 3300049744 Ga0501083_0425079 Ga0501083_0425079_11_844 277
178 3300050493 nmdc:mga0k408_102831_c1 nmdc:mga0k408_102831_c1_339_1172 277
179 3300050512 nmdc:mga0n895_5268_c1 nmdc:mga0n895_5268_c1_5291_6124 277
180 3300053104 Ga0500556_0000009 Ga0500556_0000009_150390_151223 277
181 3300053163 Ga0500639_089670 Ga0500639_089670_179_1012 277
182 3300060353 Ga0501082_0246759 Ga0501082_0246759_657_1490 277
183 3300003203 JGI25406J46586_10002015 JGI25406J46586_100020156 278
184 3300005329 Ga0070683_100048217 Ga0070683_1000482174 278
185 3300005440 Ga0070705_100390587 Ga0070705_1003905871 278
186 3300005841 Ga0068863_100175261 Ga0068863_1001752612 278
187 3300005937 Ga0081455_10017756 Ga0081455_100177566 278
188 3300005937 Ga0081455_10045433 Ga0081455_100454332 278
189 3300005983 Ga0081540_1001166 Ga0081540_100116618 278
190 3300005983 Ga0081540_1002979 Ga0081540_100297918 278
191 3300005983 Ga0081540_1102887 Ga0081540_11028872 278
192 3300005985 Ga0081539_10000072 Ga0081539_100000726 278
193 3300006038 Ga0075365_10142905 Ga0075365_101429053 278
194 3300006042 Ga0075368_10051034 Ga0075368_100510343 278
195 3300006051 Ga0075364_10018996 Ga0075364_100189968 278
196 3300006177 Ga0075362_10030683 Ga0075362_100306833 278
197 3300006177 Ga0075362_10101966 Ga0075362_101019662 278
198 3300006178 Ga0075367_10023437 Ga0075367_100234375 278
199 3300006195 Ga0075366_10052252 Ga0075366_100522523 278
200 3300006353 Ga0075370_10059976 Ga0075370_100599762 278
201 3300006353 Ga0075370_10085742 Ga0075370_100857422 278
202 3300006847 Ga0075431_100232077 Ga0075431_1002320773 278
203 3300006871 Ga0075434_100171321 Ga0075434_1001713214 278
204 3300006914 Ga0075436_100440233 Ga0075436_1004402331 278
205 3300007076 Ga0075435_100017968 Ga0075435_1000179688 278
206 3300007788 Ga0099795_10002818 Ga0099795_100028182 278
207 3300021377 Ga0213874_10015854 Ga0213874_100158544 278
208 3300021384 Ga0213876_10124936 Ga0213876_101249363 278
209 3300025906 Ga0207699_10000164 Ga0207699_1000016434 278
210 3300025911 Ga0207654_10102125 Ga0207654_101021253 278
211 3300025914 Ga0207671_10016535 Ga0207671_100165356 278
212 3300025915 Ga0207693_10001929 Ga0207693_1000192927 278
213 3300025924 Ga0207694_10008694 Ga0207694_1000869413 278
214 3300025924 Ga0207694_10024703 Ga0207694_100247033 278
215 3300025928 Ga0207700_10000295 Ga0207700_100002956 278
216 3300025929 Ga0207664_10028891 Ga0207664_100288913 278
217 3300025934 Ga0207686_10366492 Ga0207686_103664922 278
218 3300025939 Ga0207665_10070338 Ga0207665_100703383 278
219 3300025949 Ga0207667_10006198 Ga0207667_100061987 278
220 3300026041 Ga0207639_10010763 Ga0207639_100107637 278
221 3300026078 Ga0207702_10000315 Ga0207702_1000031545 278
222 3300026078 Ga0207702_10009824 Ga0207702_100098246 278
223 3300026088 Ga0207641_10154200 Ga0207641_101542002 278
224 3300026116 Ga0207674_10001605 Ga0207674_1000160535 278
225 3300028563 Ga0265319_1033580 Ga0265319_10335801 278
226 3300028577 Ga0265318_10037481 Ga0265318_100374812 278
227 3300031240 Ga0265320_10149245 Ga0265320_101492452 278
228 3300031249 Ga0265339_10020355 Ga0265339_100203555 278
229 3300031344 Ga0265316_10312002 Ga0265316_103120022 278
230 3300031456 Ga0307513_10246553 Ga0307513_102465532 278
231 3300031548 Ga0307408_100398250 Ga0307408_1003982502 278
232 3300031711 Ga0265314_10011365 Ga0265314_100113655 278
233 3300031711 Ga0265314_10056950 Ga0265314_100569505 278
234 3300031911 Ga0307412_10215875 Ga0307412_102158752 278
235 3300032126 Ga0307415_100124843 Ga0307415_1001248432 278
236 3300035120 Ga0373957_0118792 Ga0373957_0118792_131_967 278
237 3300035121 Ga0373960_0004525 Ga0373960_0004525_1087_1923 278
238 3300035172 Ga0373955_0017677 Ga0373955_0017677_1722_2558 278
239 3300035172 Ga0373955_0086334 Ga0373955_0086334_123_959 278
240 3300035691 Ga0373931_0028558 Ga0373931_0028558_1031_1867 278
241 3300035691 Ga0373931_0255360 Ga0373931_0255360_202_1038 278
242 3300035725 Ga0373947_0073289 Ga0373947_0073289_506_1342 278
243 3300036401 Ga0373937_0000738 Ga0373937_0000738_23506_24342 278
244 3300036401 Ga0373937_0031089 Ga0373937_0031089_1349_2185 278
245 3300036401 Ga0373937_0058492 Ga0373937_0058492_1701_2537 278
246 3300036401 Ga0373937_0257814 Ga0373937_0257814_443_1282 278
247 3300037312 Ga0395899_0250880 Ga0395899_0250880_296_1132 278
248 3300037471 Ga0395905_0096583 Ga0395905_0096583_189_1028 278
249 3300037853 Ga0436364_0558119 Ga0436364_0558119_601_1437 278
250 3300038443 Ga0395901_0123175 Ga0395901_0123175_113_949 278
251 3300039437 Ga0436365_1651480 Ga0436365_1651480_638_1474 278
252 3300039450 Ga0436363_0051045 Ga0436363_0051045_797_1633 278
253 3300039450 Ga0436363_0072767 Ga0436363_0072767_3766_4602 278
254 3300044656 Ga0466969_0214919 Ga0466969_0214919_11_847 278
255 3300044735 Ga0466968_0056953 Ga0466968_0056953_586_1422 278
256 3300044901 Ga0466960_0051465 Ga0466960_0051465_467_1303 278
257 3300046475 Ga0495639_0137039 Ga0495639_0137039_315_1151 278
258 3300046491 Ga0495584_0027107 Ga0495584_0027107_135_971 278
259 3300046517 Ga0495630_0274888 Ga0495630_0274888_385_1221 278
260 3300046536 Ga0495587_0239270 Ga0495587_0239270_165_1001 278
261 3300046675 Ga0495657_0141296 Ga0495657_0141296_292_1128 278
262 3300046679 Ga0495623_0050531 Ga0495623_0050531_1429_2265 278
263 3300047444 Ga0495675_0033574 Ga0495675_0033574_379_1215 278
264 3300048088 Ga0495602_0297686 Ga0495602_0297686_193_1029 278
265 3300048904 Ga0496101_0125826 Ga0496101_0125826_558_1394 278
266 3300048905 Ga0496102_0188965 Ga0496102_0188965_673_1509 278
267 3300048905 Ga0496102_0347755 Ga0496102_0347755_295_1131 278
268 3300048908 Ga0496105_0098094 Ga0496105_0098094_881_1717 278
269 3300048909 Ga0496106_0042430 Ga0496106_0042430_1611_2447 278
270 3300048913 Ga0496110_0502306 Ga0496110_0502306_79_915 278
271 3300048918 Ga0496115_0076081 Ga0496115_0076081_1248_2084 278
272 3300048918 Ga0496115_0250809 Ga0496115_0250809_294_1130 278
273 3300048918 Ga0496115_0264718 Ga0496115_0264718_495_1334 278
274 3300048918 Ga0496115_0281816 Ga0496115_0281816_367_1203 278
275 3300049581 Ga0501047_0044775 Ga0501047_0044775_2380_3216 278
276 3300049587 Ga0501071_0471230 Ga0501071_0471230_115_951 278
277 3300049588 Ga0501072_0425531 Ga0501072_0425531_32_868 278
278 3300049589 Ga0501073_0166482 Ga0501073_0166482_163_999 278
279 3300049742 Ga0501080_0122901 Ga0501080_0122901_1129_1965 278
280 3300049743 Ga0501081_0279647 Ga0501081_0279647_200_1036 278
281 3300050489 nmdc:mga03683_18198_c1 nmdc:mga03683_18198_c1_1081_1917 278
282 3300050489 nmdc:mga03683_55888_c1 nmdc:mga03683_55888_c1_156_992 278
283 3300050490 nmdc:mga03n38_73225_c1 nmdc:mga03n38_73225_c1_693_1529 278
284 3300050492 nmdc:mga0yw44_19482_c1 nmdc:mga0yw44_19482_c1_2510_3346 278
285 3300050493 nmdc:mga0k408_61824_c1 nmdc:mga0k408_61824_c1_706_1542 278
286 3300050494 nmdc:mga06z11_7008_c1 nmdc:mga06z11_7008_c1_2756_3592 278
287 3300050495 nmdc:mga04h51_11959_c1 nmdc:mga04h51_11959_c1_297_1133 278
288 3300050512 nmdc:mga0n895_129615_c1 nmdc:mga0n895_129615_c1_705_1541 278
289 3300050512 nmdc:mga0n895_77293_c1 nmdc:mga0n895_77293_c1_1312_2148 278
290 3300050513 nmdc:mga0rr50_173981_c1 nmdc:mga0rr50_173981_c1_831_1667 278
291 3300050513 nmdc:mga0rr50_56004_c1 nmdc:mga0rr50_56004_c1_710_1546 278
292 3300050514 nmdc:mga08x19_14934_c1 nmdc:mga08x19_14934_c1_2107_2943 278
293 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_19820_20656 278
294 3300050515 nmdc:mga0a205_138806_c1 nmdc:mga0a205_138806_c1_499_1335 278
295 3300050516 nmdc:mga0sz30_15892_c1 nmdc:mga0sz30_15892_c1_1351_2187 278
296 3300053092 Ga0500583_0130073 Ga0500583_0130073_23_859 278
297 3300053151 Ga0500604_0014568 Ga0500604_0014568_888_1724 278
298 3300053177 Ga0500636_0106904 Ga0500636_0106904_22_861 278
299 3300061734 Ga0530510_0431731 Ga0530510_0431731_103_939 278
300 3300005336 Ga0070680_100054740 Ga0070680_1000547402 279
301 3300005337 Ga0070682_100005924 Ga0070682_10000592410 279
302 3300005435 Ga0070714_100241439 Ga0070714_1002414392 279
303 3300005436 Ga0070713_100554316 Ga0070713_1005543161 279
304 3300005458 Ga0070681_10323599 Ga0070681_103235992 279
305 3300005530 Ga0070679_100001504 Ga0070679_1000015045 279
306 3300005539 Ga0068853_100018304 Ga0068853_1000183048 279
307 3300005545 Ga0070695_100028351 Ga0070695_1000283513 279
308 3300005546 Ga0070696_100202910 Ga0070696_1002029102 279
309 3300005549 Ga0070704_100036333 Ga0070704_1000363334 279
310 3300005983 Ga0081540_1058910 Ga0081540_10589103 279
311 3300006051 Ga0075364_10278100 Ga0075364_102781002 279
312 3300006175 Ga0070712_100092798 Ga0070712_1000927983 279
313 3300006844 Ga0075428_100048564 Ga0075428_1000485642 279
314 3300006846 Ga0075430_100330917 Ga0075430_1003309172 279
315 3300006847 Ga0075431_100206047 Ga0075431_1002060472 279
316 3300006871 Ga0075434_100297025 Ga0075434_1002970252 279
317 3300007788 Ga0099795_10001950 Ga0099795_100019506 279
318 3300009094 Ga0111539_10636399 Ga0111539_106363992 279
319 3300009174 Ga0105241_10023779 Ga0105241_100237796 279
320 3300010159 Ga0099796_10034350 Ga0099796_100343503 279
321 3300013100 Ga0157373_10078383 Ga0157373_100783832 279
322 3300013104 Ga0157370_10051498 Ga0157370_100514983 279
323 3300013307 Ga0157372_10004056 Ga0157372_1000405625 279
324 3300025901 Ga0207688_10212890 Ga0207688_102128902 279
325 3300025911 Ga0207654_10007000 Ga0207654_100070005 279
326 3300025912 Ga0207707_10004128 Ga0207707_100041286 279
327 3300025915 Ga0207693_10121023 Ga0207693_101210233 279
328 3300025917 Ga0207660_10028230 Ga0207660_100282306 279
329 3300025921 Ga0207652_10023507 Ga0207652_100235076 279
330 3300025932 Ga0207690_10084726 Ga0207690_100847264 279
331 3300025939 Ga0207665_10132259 Ga0207665_101322592 279
332 3300026041 Ga0207639_10024485 Ga0207639_100244852 279
333 3300031235 Ga0265330_10143525 Ga0265330_101435252 279
334 3300031239 Ga0265328_10005372 Ga0265328_100053726 279
335 3300031239 Ga0265328_10012983 Ga0265328_100129833 279
336 3300031239 Ga0265328_10031036 Ga0265328_100310362 279
337 3300031241 Ga0265325_10001732 Ga0265325_100017328 279
338 3300031249 Ga0265339_10009282 Ga0265339_100092826 279
339 3300031711 Ga0265314_10009081 Ga0265314_1000908111 279
340 3300036647 Ga0316582_0431603 Ga0316582_0431603_32_871 279
341 3300037068 Ga0373925_0498789 Ga0373925_0498789_129_968 279
342 3300037853 Ga0436364_0589736 Ga0436364_0589736_12_851 279
343 3300039437 Ga0436365_1605872 Ga0436365_1605872_874_1716 279
344 3300039447 Ga0436361_0557120 Ga0436361_0557120_265_1104 279
345 3300039450 Ga0436363_1187923 Ga0436363_1187923_552_1391 279
346 3300048907 Ga0496104_0240701 Ga0496104_0240701_590_1429 279
347 3300048917 Ga0496114_0013111 Ga0496114_0013111_4009_4848 279
348 3300048929 Ga0496126_0185973 Ga0496126_0185973_452_1291 279
349 3300049586 Ga0501070_0328506 Ga0501070_0328506_186_1025 279
350 3300049589 Ga0501073_0181298 Ga0501073_0181298_374_1213 279
351 3300049590 Ga0501074_0234931 Ga0501074_0234931_28_867 279
352 3300049591 Ga0501075_0024744 Ga0501075_0024744_2640_3479 279
353 3300049592 Ga0501076_0119530 Ga0501076_0119530_130_969 279
354 3300049593 Ga0501077_0005917 Ga0501077_0005917_4251_5090 279
355 3300049741 Ga0501079_0025432 Ga0501079_0025432_2539_3378 279
356 3300049742 Ga0501080_0384667 Ga0501080_0384667_311_1150 279
357 3300049743 Ga0501081_0006130 Ga0501081_0006130_2827_3666 279
358 3300049743 Ga0501081_0071195 Ga0501081_0071195_418_1257 279
359 3300050509 nmdc:mga0qj67_44746_c1 nmdc:mga0qj67_44746_c1_2216_3055 279
360 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_113878_114717 279
361 3300053084 Ga0495595_0065981 Ga0495595_0065981_15_854 279
362 3300053085 Ga0495619_0044655 Ga0495619_0044655_1038_1877 279
363 3300054114 Ga0501084_0022460 Ga0501084_0022460_2027_2866 279
364 3300060353 Ga0501082_0049682 Ga0501082_0049682_847_1686 279
365 3300061734 Ga0530510_0059077 Ga0530510_0059077_1441_2280 279
366 3300002987 JGI25159J45721_1002997 JGI25159J45721_10029979 280
367 3300003187 JGI25151J46595_10000038 JGI25151J46595_100000386 280
368 3300003187 JGI25151J46595_10073845 JGI25151J46595_100738451 280
369 3300003775 Ga0055524_1012814 Ga0055524_10128141 280
370 3300005262 Ga0065165_1000631 Ga0065165_10006316 280
371 3300013250 Ga0171462_1042 Ga0171462_104270 280
372 3300025291 Ga0209675_1002527 Ga0209675_10025273 280
373 3300025292 Ga0209676_1010666 Ga0209676_10106664 280
374 3300025294 Ga0209025_1020659 Ga0209025_10206593 280
375 3300025294 Ga0209025_1067347 Ga0209025_10673471 280
376 3300025295 Ga0209564_1009622 Ga0209564_10096224 280
377 3300025295 Ga0209564_1013840 Ga0209564_10138406 280
378 3300025299 Ga0209256_1000108 Ga0209256_1000108196 280
379 3300025299 Ga0209256_1012507 Ga0209256_10125071 280
380 3300025302 Ga0207426_1036160 Ga0207426_10361603 280
381 3300025304 Ga0209257_1040268 Ga0209257_10402682 280
382 3300028794 Ga0307515_10058447 Ga0307515_100584473 280
383 3300032002 Ga0307416_100713104 Ga0307416_1007131041 280
384 3300046460 Ga0495638_0080377 Ga0495638_0080377_183_1025 280
385 3300046522 Ga0495643_0036171 Ga0495643_0036171_1690_2532 280
386 3300048920 Ga0496117_0180277 Ga0496117_0180277_349_1191 280
387 3300048921 Ga0496118_0107507 Ga0496118_0107507_171_1013 280
388 3300048926 Ga0496123_0008564 Ga0496123_0008564_2667_3509 280
389 3300049574 Ga0501038_0227511 Ga0501038_0227511_87_929 280
390 3300049822 Ga0501035_0310484 Ga0501035_0310484_26_868 280
391 3300049823 Ga0501044_0528398 Ga0501044_0528398_225_1067 280
392 3300053122 Ga0500608_041660 Ga0500608_041660_834_1676 280
393 3300053156 Ga0500622_0008990 Ga0500622_0008990_2315_3157 280
394 3300053177 Ga0500636_0009188 Ga0500636_0009188_2572_3414 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03947

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain

126

251

0.99

PF00181

Ribosomal_L2

Ribosomal Proteins L2, RNA binding domain

42

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.9421 63 194
1c04-assembly1.cif.gz_A identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui 0.9089 63 194
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.8828 23 201
8c91-assembly1.cif.gz_C cryo-em captures early ribosome assembly in action 0.8616 23 201
1w9i-assembly1.cif.gz_A myosin ii dictyostelium discoideum motor domain s456y bound with mgadp-befx 0.8574 162 186
ID Description Score Start End Superfamily
3dllA02 Mainly Beta;Roll;SH3 type barrels.; 0.9517 129 194 2.30.30.30
af_Q25807_101_178_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9515 124 195 2.30.30.30
3i8iD02 Mainly Beta;Roll;SH3 type barrels.; 0.9515 119 196 2.30.30.30
af_A4HTH9_204_277_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9491 126 195 2.30.30.30
af_P92812_354_429_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9489 123 194 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7W2FUX9-F1-model_v4 50S ribosomal protein L2 0.9749 74 186 GO:0002181
GO:0003723
GO:0003735
GO:0005840
GO:1990904
AF-A0A535DLC6-F1-model_v4 50S ribosomal protein L2 0.9693 90 183 GO:0002181
GO:0003723
GO:0003735
GO:0005840
GO:1990904
AF-A0A0F2I9X1-F1-model_v4 50S ribosomal protein L2 0.9647 62 188 GO:0002181
GO:0003723
GO:0003735
GO:0015934
GO:0016740
AF-A0A354W3A1-F1-model_v4 deleted 0.9591 83 185
AF-A0A3D1RTI2-F1-model_v4 50S ribosomal protein L2 0.9568 69 169 GO:0002181
GO:0003723
GO:0003735
GO:0005840
GO:1990904

Feature Viewer

pLDDT pTM Quality
68.37 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map