F432619

General Info

Members Datasets Scaffolds Average Seq Length
393 246 380 420

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10007858|Ga0207683_100078582
Length 493
Sequence MPSPLISAYDNDSATTLGPNRHAASRLKCTLEAGLALADANRPAHPCRSRAAIQAHDADDDVSTPGVASASTLPWASGSVRWRVCAMLLCATTINYIDRQVLGVLAPFLQEQIGWNEIEYGYIVTAFQAAYAIGLLCAGAIIDRFGTRIGYALAIGVWSVAAMSHALXXXXVGFXAARFALGLGEAGNFPAAIKVVAEWFPRRERALATGIFNSGSNIGAIVAPLLVPIVAIRWGWQAAFLCTGVLSAAWLTWWLLRYRSPEQHPRVSSTELDYIRSDPAEPGARIPWRTILLHRQAWAFVAAKFMTDPIWWFFLFWLPKFLHSEYGLTLLGLGAPLIAIFICADVGSIAGGWLAGHLIRRGYSVNRARKTAMAVCALAVVPIVFAAKADNLWVAVALIGLATAGHQGWSANVFTLASDLFPRAAVASVVGVGGFAGAVGGMLIANFVGFLLQATGSYVPVFMVAGSAYLLALAVVHTLTPRLEPAQLEPTAQ

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
3 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
4 2818991457 Xanthomonas translucens 569 Isolate Unclassified
5 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
6 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
7 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
8 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
9 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
10 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
11 2928963466 Dyella japonica 1073 Isolate Unclassified
12 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
92 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
182 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
187 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
241 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.24
Nodule 0
Rhizoplane 1.02
Rhizosphere 62.34
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10007404 3300002067 Bacteria 3582
2 JGI25156J39149_1002556 3300002705 Bacteria 6458
3 JGI25156J39149_1004959 3300002705 Bacteria 3935
4 JGI25162J39368_1000115 3300002737 Bacteria 88006
5 JGI25162J39368_1000819 3300002737 Bacteria 20536
6 JGI25157J39369_1000132 3300002741 Bacteria 62647
7 JGI25157J39369_1000882 3300002741 Bacteria 14441
8 JGI25157J39369_1001714 3300002741 Bacteria 7350
9 JGI25163J39215_1000228 3300002771 Bacteria 21041
10 JGI25164J39214_1000090 3300002772 Bacteria 90565
11 JGI25164J39214_1000111 3300002772 Bacteria 78179
12 JGI25152J39213_1000218 3300002773 Bacteria 38987
13 JGI25150J39212_1000154 3300002774 Bacteria 38905
14 JGI25151J46595_10000133 3300003187 Bacteria 99030
15 JGI25165J46597_1000103 3300003214 Bacteria 153193
16 JGI25165J46597_1000194 3300003214 Bacteria 91012
17 JGI25153J46596_10000058 3300003215 Bacteria 132614
18 rootH2_10168912 3300003320 Bacteria 3579
19 Ga0055538_1001042 3300003751 Bacteria 6240
20 Ga0055539_1002337 3300003752 Bacteria 2960
21 Ga0055533_1000327 3300003756 Bacteria 21160
22 Ga0055533_1001399 3300003756 Bacteria 6396
23 Ga0055525_1000027 3300003759 Bacteria 340506
24 Ga0055527_1000031 3300003760 Bacteria 159089
25 Ga0055527_1000229 3300003760 Bacteria 35558
26 Ga0055527_1001230 3300003760 Bacteria 5680
27 Ga0055535_1000065 3300003761 Bacteria 115893
28 Ga0055535_1000106 3300003761 Bacteria 90565
29 Ga0055535_1000283 3300003761 Bacteria 53525
30 Ga0055535_1000312 3300003761 Bacteria 49164
31 Ga0055542_1000083 3300003762 Bacteria 126426
32 Ga0055542_1000088 3300003762 Bacteria 123491
33 Ga0055542_1000093 3300003762 Bacteria 120262
34 Ga0055542_1000100 3300003762 Bacteria 117410
35 Ga0055542_1000150 3300003762 Bacteria 88006
36 Ga0055542_1000217 3300003762 Bacteria 70030
37 Ga0055529_1000034 3300003763 Bacteria 244657
38 Ga0055529_1000067 3300003763 Bacteria 165941
39 Ga0055529_1000073 3300003763 Bacteria 159093
40 Ga0055529_1000168 3300003763 Bacteria 90565
41 Ga0055529_1000178 3300003763 Bacteria 86969
42 Ga0055529_1000654 3300003763 Bacteria 24888
43 Ga0055524_1004490 3300003775 Bacteria 6430
44 Ga0055536_1008763 3300003781 Bacteria 4290
45 Ga0055531_10001188 3300003794 Bacteria 19993
46 Ga0055531_10001537 3300003794 Bacteria 16900
47 Ga0058692_1000057 3300003856 Bacteria 103718
48 Ga0065704_10077052 3300005289 Bacteria 4872
49 Ga0065707_10081717 3300005295 Bacteria 68156
50 Ga0070683_100007330 3300005329 Bacteria 9314
51 Ga0070683_100044281 3300005329 Bacteria 4104
52 Ga0070683_100150611 3300005329 Bacteria 2205
53 Ga0070690_100046273 3300005330 Bacteria 2766
54 Ga0070690_100046321 3300005330 Bacteria 2764
55 Ga0070670_100000697 3300005331 Bacteria 26100
56 Ga0070680_100024927 3300005336 Bacteria 4781
57 Ga0070691_10001935 3300005341 Bacteria 9109
58 Ga0070691_10007547 3300005341 Bacteria 4986
59 Ga0070661_100141754 3300005344 Bacteria 1812
60 Ga0070673_100032984 3300005364 Bacteria 3905
61 Ga0070714_100102244 3300005435 Bacteria 2526
62 Ga0070713_100133934 3300005436 Unclassified 2188
63 Ga0070678_100074520 3300005456 Bacteria 2551
64 Ga0070662_100001369 3300005457 Bacteria 14981
65 Ga0070681_10002128 3300005458 Bacteria 17991
66 Ga0070685_10048236 3300005466 Bacteria 2452
67 Ga0070679_100000639 3300005530 Bacteria 29746
68 Ga0070684_100002610 3300005535 Bacteria 13313
69 Ga0068853_100292366 3300005539 Bacteria 1504
70 Ga0068855_100016565 3300005563 Bacteria 8865
71 Ga0068855_100030223 3300005563 Bacteria 6480
72 Ga0068855_100208191 3300005563 Bacteria 2199
73 Ga0068857_100000258 3300005577 Bacteria 35751
74 Ga0068857_100035682 3300005577 Bacteria 4404
75 Ga0068856_100030815 3300005614 Bacteria 5245
76 Ga0068856_100065698 3300005614 Bacteria 3585
77 Ga0068856_100125180 3300005614 Bacteria 2573
78 Ga0068852_100046611 3300005616 Bacteria 3694
79 Ga0068863_100011508 3300005841 Bacteria 8557
80 Ga0068863_100129357 3300005841 Bacteria 2410
81 Ga0068858_100070970 3300005842 Bacteria 3229
82 Ga0068862_100039426 3300005844 Bacteria 4012
83 Ga0081539_10000206 3300005985 Bacteria 137177
84 Ga0081539_10050503 3300005985 Bacteria 2353
85 Ga0070717_10087882 3300006028 Bacteria 2619
86 Ga0075364_10000136 3300006051 Bacteria 31432
87 Ga0097621_100013771 3300006237 Bacteria 6038
88 Ga0097621_100069723 3300006237 Bacteria 2903
89 Ga0068871_100022937 3300006358 Bacteria 4819
90 Ga0075436_100001089 3300006914 Bacteria 18302
91 Ga0075436_100015674 3300006914 Bacteria 5188
92 Ga0097620_100049249 3300006931 Bacteria 4231
93 Ga0105251_10000008 3300009011 Bacteria 213669
94 Ga0105240_10003712 3300009093 Bacteria 23598
95 Ga0105240_10018301 3300009093 Bacteria 9416
96 Ga0105240_10029764 3300009093 Bacteria 7106
97 Ga0105240_10109778 3300009093 Unclassified 3340
98 Ga0105240_10212662 3300009093 Bacteria 2258
99 Ga0105245_10000992 3300009098 Bacteria 25809
100 Ga0105245_10010930 3300009098 Bacteria 7898
101 Ga0105245_10034702 3300009098 Bacteria 4475
102 Ga0105243_10000184 3300009148 Bacteria 72611
103 Ga0105241_10002675 3300009174 Bacteria 13357
104 Ga0105241_10005011 3300009174 Bacteria 9778
105 Ga0105242_10007238 3300009176 Bacteria 8555
106 Ga0105248_10003926 3300009177 Bacteria 16437
107 Ga0105248_10028396 3300009177 Bacteria 6233
108 Ga0105237_10002229 3300009545 Bacteria 24232
109 Ga0105237_10008681 3300009545 Bacteria 10977
110 Ga0105237_10048040 3300009545 Bacteria 4290
111 Ga0105238_10000501 3300009551 Bacteria 41211
112 Ga0105238_10013136 3300009551 Bacteria 8356
113 Ga0105238_10079026 3300009551 Bacteria 3279
114 Ga0105238_10163661 3300009551 Bacteria 2200
115 Ga0105249_10142007 3300009553 Bacteria 2304
116 Ga0105239_10008026 3300010375 Bacteria 12052
117 Ga0105239_10030497 3300010375 Bacteria 5928
118 Ga0105246_10015448 3300011119 Bacteria 4825
119 Ga0157370_10113311 3300013104 Bacteria 2534
120 Ga0157369_10005007 3300013105 Bacteria 15517
121 Ga0157369_10105453 3300013105 Bacteria 3001
122 Ga0157369_10137881 3300013105 Bacteria 2582
123 Ga0157369_10182524 3300013105 Bacteria 2207
124 Ga0157374_10146793 3300013296 Bacteria 2291
125 Ga0157374_10153097 3300013296 Bacteria 2243
126 Ga0157374_10264279 3300013296 Unclassified 1695
127 Ga0163162_10051559 3300013306 Bacteria 4129
128 Ga0157372_10001007 3300013307 Bacteria 30798
129 Ga0157372_10015918 3300013307 Bacteria 8066
130 Ga0157372_10090294 3300013307 Bacteria 3483
131 Ga0157372_10141473 3300013307 Unclassified 2772
132 Ga0157372_10205708 3300013307 Bacteria 2281
133 Ga0157375_10010186 3300013308 Bacteria 8275
134 Ga0157375_10034224 3300013308 Bacteria 4838
135 Ga0163163_10013122 3300014325 Bacteria 7570
136 Ga0163163_10032221 3300014325 Bacteria 5062
137 Ga0157380_10000275 3300014326 Bacteria 30843
138 Ga0157379_10169884 3300014968 Unclassified 1968
139 Ga0182006_1012205 3300015261 Bacteria 3761
140 Ga0183368_1002 3300015687 Bacteria 1865598
141 Ga0209784_100053 3300025224 Bacteria 182075
142 Ga0209674_100014 3300025226 Bacteria 704989
143 Ga0209674_100187 3300025226 Bacteria 67758
144 Ga0209672_100005 3300025228 Bacteria 1069303
145 Ga0209672_100016 3300025228 Bacteria 522604
146 Ga0209672_100212 3300025228 Bacteria 45556
147 Ga0209672_100580 3300025228 Bacteria 19421
148 Ga0209563_100023 3300025230 Bacteria 636844
149 Ga0207427_100061 3300025231 Bacteria 182815
150 Ga0207427_100155 3300025231 Bacteria 78235
151 Ga0207427_101163 3300025231 Bacteria 10283
152 Ga0209437_100037 3300025233 Bacteria 459730
153 Ga0209437_100186 3300025233 Bacteria 126133
154 Ga0209437_100279 3300025233 Bacteria 75208
155 Ga0209258_100006 3300025242 Bacteria 1069303
156 Ga0209258_100012 3300025242 Bacteria 825544
157 Ga0209258_100057 3300025242 Bacteria 334259
158 Ga0209258_100106 3300025242 Bacteria 206622
159 Ga0209258_100138 3300025242 Bacteria 167495
160 Ga0207425_1000011 3300025245 Bacteria 550735
161 Ga0209646_1001187 3300025246 Bacteria 7541
162 Ga0209026_1000104 3300025250 Bacteria 152614
163 Ga0209026_1000108 3300025250 Bacteria 148837
164 Ga0209026_1000618 3300025250 Bacteria 22441
165 Ga0209677_102988 3300025253 Bacteria 5851
166 Ga0209148_1000001 3300025254 Bacteria 2545271
167 Ga0209148_1000002 3300025254 Bacteria 2399500
168 Ga0209148_1000012 3300025254 Bacteria 1069303
169 Ga0209148_1000014 3300025254 Bacteria 925277
170 Ga0209148_1000042 3300025254 Bacteria 464111
171 Ga0209148_1000068 3300025254 Bacteria 335510
172 Ga0209148_1000093 3300025254 Bacteria 245339
173 Ga0209759_1000220 3300025256 Bacteria 87504
174 Ga0209759_1000501 3300025256 Bacteria 42882
175 Ga0209759_1004617 3300025256 Bacteria 5070
176 Ga0209759_1004637 3300025256 Bacteria 5052
177 Ga0209129_1000031 3300025258 Bacteria 383039
178 Ga0209233_1000002 3300025261 Bacteria 2501366
179 Ga0209233_1000265 3300025261 Bacteria 78235
180 Ga0209455_1000008 3300025272 Bacteria 1069303
181 Ga0209455_1000014 3300025272 Bacteria 806601
182 Ga0209455_1000016 3300025272 Bacteria 753097
183 Ga0209455_1000045 3300025272 Bacteria 383329
184 Ga0209455_1000079 3300025272 Bacteria 268778
185 Ga0209673_1001757 3300025273 Bacteria 18061
186 Ga0209130_1002731 3300025284 Bacteria 8359
187 Ga0209675_1005956 3300025291 Bacteria 4996
188 Ga0209675_1006346 3300025291 Bacteria 4762
189 Ga0209676_1001455 3300025292 Bacteria 22206
190 Ga0209676_1001475 3300025292 Bacteria 21773
191 Ga0209676_1001734 3300025292 Bacteria 18714
192 Ga0209676_1003116 3300025292 Bacteria 10649
193 Ga0209676_1009163 3300025292 Bacteria 4306
194 Ga0209025_1000012 3300025294 Bacteria 924362
195 Ga0209025_1000802 3300025294 Bacteria 50981
196 Ga0209025_1044984 3300025294 Bacteria 1837
197 Ga0209758_1000143 3300025297 Bacteria 171093
198 Ga0209758_1013289 3300025297 Bacteria 4507
199 Ga0209050_1001338 3300025298 Bacteria 27306
200 Ga0209050_1002871 3300025298 Bacteria 13629
201 Ga0209256_1000752 3300025299 Bacteria 42238
202 Ga0209256_1001211 3300025299 Bacteria 28793
203 Ga0209256_1001259 3300025299 Bacteria 27751
204 Ga0209257_1000712 3300025304 Bacteria 51443
205 Ga0209257_1000822 3300025304 Bacteria 45027
206 Ga0209257_1001291 3300025304 Bacteria 30556
207 Ga0209257_1001499 3300025304 Bacteria 27430
208 Ga0209257_1001585 3300025304 Bacteria 26112
209 Ga0209257_1025654 3300025304 Bacteria 2008
210 Ga0207713_1000100 3300025735 Bacteria 140917
211 Ga0207692_10065543 3300025898 Bacteria 1895
212 Ga0207647_10003922 3300025904 Bacteria 11113
213 Ga0207699_10156854 3300025906 Bacteria 1512
214 Ga0207654_10003431 3300025911 Bacteria 8014
215 Ga0207654_10016969 3300025911 Unclassified 3799
216 Ga0207654_10051451 3300025911 Bacteria 2371
217 Ga0207707_10000239 3300025912 Bacteria 59651
218 Ga0207695_10001615 3300025913 Bacteria 36561
219 Ga0207695_10001734 3300025913 Bacteria 34698
220 Ga0207695_10023665 3300025913 Bacteria 6932
221 Ga0207695_10154219 3300025913 Bacteria 2233
222 Ga0207695_10170636 3300025913 Bacteria 2101
223 Ga0207671_10025313 3300025914 Bacteria 4457
224 Ga0207671_10068867 3300025914 Bacteria 2637
225 Ga0207660_10027513 3300025917 Bacteria 3881
226 Ga0207649_10066249 3300025920 Bacteria 2289
227 Ga0207652_10013549 3300025921 Bacteria 6595
228 Ga0207694_10004582 3300025924 Bacteria 10770
229 Ga0207694_10105526 3300025924 Bacteria 2237
230 Ga0207650_10002042 3300025925 Bacteria 14130
231 Ga0207659_10027097 3300025926 Bacteria 3876
232 Ga0207687_10012315 3300025927 Bacteria 5592
233 Ga0207687_10020199 3300025927 Bacteria 4418
234 Ga0207664_10098164 3300025929 Bacteria 2415
235 Ga0207706_10003484 3300025933 Bacteria 15020
236 Ga0207686_10009052 3300025934 Bacteria 5391
237 Ga0207709_10000466 3300025935 Bacteria 37282
238 Ga0207711_10006254 3300025941 Bacteria 10046
239 Ga0207711_10037382 3300025941 Bacteria 4123
240 Ga0207711_10086428 3300025941 Bacteria 2749
241 Ga0207661_10014859 3300025944 Bacteria 5711
242 Ga0207661_10019019 3300025944 Bacteria 5112
243 Ga0207667_10002815 3300025949 Bacteria 21563
244 Ga0207667_10015480 3300025949 Bacteria 8661
245 Ga0207640_10142469 3300025981 Bacteria 1749
246 Ga0207639_10133079 3300026041 Bacteria 2061
247 Ga0207678_10034859 3300026067 Bacteria 4382
248 Ga0207702_10000204 3300026078 Bacteria 70128
249 Ga0207702_10004066 3300026078 Bacteria 13128
250 Ga0207702_10085803 3300026078 Bacteria 2744
251 Ga0207641_10048856 3300026088 Bacteria 3573
252 Ga0207648_10100900 3300026089 Bacteria 2529
253 Ga0207674_10000035 3300026116 Bacteria 136262
254 Ga0207674_10001346 3300026116 Bacteria 31774
255 Ga0207683_10007858 3300026121 Bacteria 9127
256 Ga0207683_10302931 3300026121 Bacteria 1462
257 Ga0209371_1000156 3300027312 Bacteria 106826
258 Ga0268265_10137278 3300028380 Bacteria 2042
259 Ga0265338_10000009 3300028800 Bacteria 448611
260 Ga0265338_10001092 3300028800 Bacteria 45086
261 Ga0265338_10010043 3300028800 Bacteria 11186
262 Ga0265338_10013083 3300028800 Bacteria 9404
263 Ga0265324_10000844 3300029957 Bacteria 19740
264 Ga0265324_10001351 3300029957 Bacteria 14327
265 Ga0265324_10010355 3300029957 Bacteria 3599
266 Ga0268256_1000130 3300030500 Bacteria 106825
267 Ga0314311_1143704 3300030733 Bacteria 4839
268 Ga0265340_10009853 3300031247 Bacteria 5121
269 Ga0265316_10111458 3300031344 Bacteria 2072
270 Ga0307513_10002543 3300031456 Bacteria 25210
271 Ga0307408_100031300 3300031548 Bacteria 3704
272 Ga0265313_10002051 3300031595 Bacteria 18074
273 Ga0265314_10002451 3300031711 Bacteria 18978
274 Ga0307413_10009728 3300031824 Bacteria 4618
275 Ga0307510_10035987 3300033180 Bacteria 5518
276 Ga0373930_0001575 3300034816 Bacteria 3423
277 Ga0373928_0000114 3300035084 Bacteria 14872
278 Ga0373929_0002461 3300035085 Bacteria 3405
279 Ga0373944_0000255 3300035089 Bacteria 11743
280 Ga0373949_0000516 3300035090 Bacteria 12804
281 Ga0373951_0001189 3300035091 Bacteria 6876
282 Ga0373932_0000004 3300035112 Bacteria 412176
283 Ga0373945_0001362 3300035116 Bacteria 7427
284 Ga0373943_0081806 3300035170 Bacteria 1657
285 Ga0373962_0000028 3300035242 Bacteria 37722
286 Ga0373931_0000009 3300035691 Bacteria 349854
287 Ga0373935_0039746 3300035692 Bacteria 2950
288 Ga0373927_0017376 3300035695 Bacteria 4734
289 Ga0373927_0018448 3300035695 Bacteria 4586
290 Ga0373933_0034377 3300035724 Bacteria 2954
291 Ga0373937_0026628 3300036401 Bacteria 5225
292 Ga0373937_0107469 3300036401 Bacteria 2594
293 Ga0373925_0001919 3300037068 Bacteria 17213
294 Ga0373925_0006033 3300037068 Bacteria 8967
295 Ga0373925_0023758 3300037068 Bacteria 4472
296 Ga0395899_0000321 3300037312 Bacteria 60941
297 Ga0395899_0033909 3300037312 Bacteria 3833
298 Ga0395899_0228185 3300037312 Bacteria 1287
299 Ga0395900_0000144 3300037418 Bacteria 119971
300 Ga0395898_0000018 3300037466 Bacteria 418600
301 Ga0395898_0000336 3300037466 Bacteria 106457
302 Ga0395901_0051736 3300038443 Bacteria 4270
303 Ga0237819_00271 3300038705 Bacteria 18938
304 Ga0439439_0004210 3300041406 Bacteria 3226
305 Ga0439461_0001086 3300041410 Bacteria 4100
306 Ga0439465_0000057 3300041413 Bacteria 23919
307 Ga0439465_0002438 3300041413 Bacteria 6086
308 Ga0451791_0598715 3300041451 Bacteria 1732
309 Ga0451798_0976735 3300041458 Bacteria 2746
310 Ga0451800_0052964 3300041459 Bacteria 13291
311 Ga0451843_1731494 3300041509 Bacteria 2787
312 Ga0439449_0002182 3300042007 Bacteria 7689
313 Ga0439457_006317 3300042014 Bacteria 2911
314 Ga0439462_0002986 3300042015 Bacteria 4013
315 Ga0439434_0016877 3300042435 Bacteria 2182
316 Ga0466969_0004303 3300044656 Bacteria 7574
317 Ga0466961_0000103 3300044693 Bacteria 55501
318 Ga0466964_0012742 3300044706 Bacteria 3184
319 Ga0466970_0007040 3300044765 Bacteria 5627
320 Ga0466970_0009117 3300044765 Bacteria 5007
321 Ga0466959_0000042 3300045049 Bacteria 98655
322 Ga0466959_0019037 3300045049 Bacteria 5046
323 Ga0466958_0014101 3300045836 Bacteria 4560
324 Ga0466958_0023416 3300045836 Bacteria 3626
325 Ga0495627_008304 3300046453 Bacteria 3906
326 Ga0495592_0018145 3300046454 Bacteria 5347
327 Ga0495638_0000015 3300046460 Bacteria 414645
328 Ga0495638_0007680 3300046460 Bacteria 7708
329 Ga0495638_0081521 3300046460 Bacteria 1964
330 Ga0495650_0000091 3300046471 Bacteria 228697
331 Ga0495580_0021984 3300046472 Bacteria 4701
332 Ga0495583_0000364 3300046506 Bacteria 70975
333 Ga0495632_0016867 3300046519 Bacteria 4049
334 Ga0495652_0194729 3300046529 Bacteria 1544
335 Ga0495586_0044236 3300046535 Bacteria 2398
336 Ga0495587_0001148 3300046536 Bacteria 17383
337 Ga0495656_0002359 3300046615 Bacteria 6255
338 Ga0495611_0027295 3300046648 Bacteria 2495
339 Ga0495625_0002895 3300046660 Bacteria 17930
340 Ga0495661_0015567 3300046665 Bacteria 5073
341 Ga0495669_0047842 3300046684 Bacteria 1912
342 Ga0495670_0000025 3300046691 Bacteria 91556
343 Ga0495675_0049175 3300047444 Bacteria 2681
344 Ga0495686_0003036 3300047472 Bacteria 14877
345 Ga0495686_0012524 3300047472 Bacteria 5929
346 Ga0495602_0004288 3300048088 Bacteria 14849
347 Ga0496115_0000095 3300048918 Bacteria 82835
348 Ga0496117_0001767 3300048920 Bacteria 29757
349 Ga0496118_0056654 3300048921 Bacteria 2944
350 Ga0496118_0101124 3300048921 Bacteria 1948
351 Ga0496119_0000328 3300048922 Bacteria 66480
352 Ga0496120_0000244 3300048923 Bacteria 92211
353 Ga0496122_0007109 3300048925 Bacteria 12569
354 Ga0496123_0000366 3300048926 Bacteria 84678
355 Ga0496124_0002996 3300048927 Bacteria 21123
356 Ga0496126_0039301 3300048929 Bacteria 4391
357 Ga0501031_0113889 3300049568 Bacteria 1766
358 Ga0501031_0120833 3300049568 Bacteria 1711
359 Ga0501032_0012160 3300049569 Bacteria 6161
360 Ga0501033_0005782 3300049570 Bacteria 9734
361 Ga0501034_0150776 3300049571 Bacteria 2301
362 Ga0501034_0292664 3300049571 Bacteria 1566
363 Ga0501043_0017589 3300049579 Bacteria 5606
364 Ga0501046_0003730 3300049580 Bacteria 13945
365 Ga0501046_0100434 3300049580 Bacteria 2220
366 Ga0501070_0009906 3300049586 Bacteria 8056
367 Ga0501225_0001457 3300049705 Bacteria 7409
368 Ga0501080_0349438 3300049742 Bacteria 1335
369 Ga0501035_0051327 3300049822 Bacteria 3693
370 Ga0501044_0170409 3300049823 Bacteria 2149
371 nmdc:mga00v17_11418_c1 3300050491 Bacteria 4882
372 nmdc:mga00v17_409_c1 3300050491 Bacteria 24367
373 Ga0500595_000582 3300053119 Bacteria 21779
374 Ga0500595_011684 3300053119 Bacteria 3424
375 Ga0500608_001297 3300053122 Bacteria 8896
376 Ga0500628_001005 3300053129 Bacteria 4928
377 Ga0500658_0001059 3300053134 Bacteria 11270
378 Ga0500616_0000037 3300053153 Bacteria 390473
379 Ga0500634_0000092 3300053161 Bacteria 34916
380 Ga0500636_0000505 3300053177 Bacteria 21218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0107469 Ga0373937_0107469_1459_2571 333
2 3300026089 Ga0207648_10100900 Ga0207648_101009002 343
3 3300046684 Ga0495669_0047842 Ga0495669_0047842_325_1551 350
4 3300005530 Ga0070679_100000639 Ga0070679_10000063919 355
5 3300005535 Ga0070684_100002610 Ga0070684_1000026102 355
6 3300005563 Ga0068855_100208191 Ga0068855_1002081912 355
7 3300009093 Ga0105240_10018301 Ga0105240_100183012 355
8 3300009174 Ga0105241_10002675 Ga0105241_100026752 355
9 3300009545 Ga0105237_10002229 Ga0105237_1000222912 355
10 3300009551 Ga0105238_10000501 Ga0105238_1000050128 355
11 3300013105 Ga0157369_10182524 Ga0157369_101825242 355
12 3300013307 Ga0157372_10001007 Ga0157372_100010077 355
13 3300025911 Ga0207654_10003431 Ga0207654_100034319 355
14 3300025920 Ga0207649_10066249 Ga0207649_100662491 355
15 3300025924 Ga0207694_10004582 Ga0207694_100045823 355
16 3300025949 Ga0207667_10002815 Ga0207667_1000281512 355
17 3300026078 Ga0207702_10004066 Ga0207702_1000406610 355
18 3300009093 Ga0105240_10109778 Ga0105240_101097782 360
19 3300025913 Ga0207695_10170636 Ga0207695_101706361 360
20 3300031548 Ga0307408_100031300 Ga0307408_1000313003 360
21 3300035724 Ga0373933_0034377 Ga0373933_0034377_1184_2386 363
22 3300036401 Ga0373937_0026628 Ga0373937_0026628_1453_2655 363
23 3300046535 Ga0495586_0044236 Ga0495586_0044236_397_1650 365
24 3300047444 Ga0495675_0049175 Ga0495675_0049175_1406_2659 365
25 3300053119 Ga0500595_000582 Ga0500595_000582_9535_10845 365
26 3300053153 Ga0500616_0000037 Ga0500616_0000037_46211_47419 365
27 3300005329 Ga0070683_100044281 Ga0070683_1000442812 366
28 3300005336 Ga0070680_100024927 Ga0070680_1000249274 366
29 3300005341 Ga0070691_10001935 Ga0070691_100019357 366
30 3300005458 Ga0070681_10002128 Ga0070681_1000212811 366
31 3300005539 Ga0068853_100292366 Ga0068853_1002923662 366
32 3300005577 Ga0068857_100000258 Ga0068857_10000025814 366
33 3300005614 Ga0068856_100030815 Ga0068856_1000308152 366
34 3300005616 Ga0068852_100046611 Ga0068852_1000466114 366
35 3300025912 Ga0207707_10000239 Ga0207707_1000023949 366
36 3300025913 Ga0207695_10001615 Ga0207695_1000161530 366
37 3300025914 Ga0207671_10025313 Ga0207671_100253134 366
38 3300025917 Ga0207660_10027513 Ga0207660_100275134 366
39 3300025921 Ga0207652_10013549 Ga0207652_100135496 366
40 3300025944 Ga0207661_10019019 Ga0207661_100190194 366
41 3300026116 Ga0207674_10000035 Ga0207674_1000003550 366
42 3300046454 Ga0495592_0018145 Ga0495592_0018145_1782_2993 366
43 3300046536 Ga0495587_0001148 Ga0495587_0001148_2638_3849 366
44 3300048088 Ga0495602_0004288 Ga0495602_0004288_11748_12959 366
45 3300005329 Ga0070683_100150611 Ga0070683_1001506111 367
46 3300005563 Ga0068855_100030223 Ga0068855_1000302234 367
47 3300005842 Ga0068858_100070970 Ga0068858_1000709702 367
48 3300006237 Ga0097621_100069723 Ga0097621_1000697233 367
49 3300009093 Ga0105240_10003712 Ga0105240_1000371211 367
50 3300009098 Ga0105245_10010930 Ga0105245_100109304 367
51 3300009098 Ga0105245_10034702 Ga0105245_100347023 367
52 3300009176 Ga0105242_10007238 Ga0105242_100072386 367
53 3300009177 Ga0105248_10028396 Ga0105248_100283963 367
54 3300009545 Ga0105237_10048040 Ga0105237_100480402 367
55 3300009551 Ga0105238_10013136 Ga0105238_100131363 367
56 3300011119 Ga0105246_10015448 Ga0105246_100154483 367
57 3300013104 Ga0157370_10113311 Ga0157370_101133112 367
58 3300013105 Ga0157369_10005007 Ga0157369_100050072 367
59 3300013307 Ga0157372_10015918 Ga0157372_100159184 367
60 3300013308 Ga0157375_10010186 Ga0157375_100101868 367
61 3300025913 Ga0207695_10023665 Ga0207695_100236654 367
62 3300025914 Ga0207671_10068867 Ga0207671_100688673 367
63 3300025927 Ga0207687_10020199 Ga0207687_100201992 367
64 3300025934 Ga0207686_10009052 Ga0207686_100090524 367
65 3300025941 Ga0207711_10006254 Ga0207711_1000625410 367
66 3300025949 Ga0207667_10015480 Ga0207667_100154803 367
67 3300031247 Ga0265340_10009853 Ga0265340_100098533 369
68 3300031711 Ga0265314_10002451 Ga0265314_1000245115 369
69 3300049742 Ga0501080_0349438 Ga0501080_0349438_86_1315 369
70 3300005330 Ga0070690_100046321 Ga0070690_1000463213 370
71 3300005344 Ga0070661_100141754 Ga0070661_1001417542 370
72 3300005364 Ga0070673_100032984 Ga0070673_1000329842 370
73 3300005563 Ga0068855_100016565 Ga0068855_1000165657 370
74 3300009177 Ga0105248_10003926 Ga0105248_100039263 370
75 3300009545 Ga0105237_10008681 Ga0105237_100086818 370
76 3300009551 Ga0105238_10079026 Ga0105238_100790262 370
77 3300010375 Ga0105239_10008026 Ga0105239_100080263 370
78 3300010375 Ga0105239_10030497 Ga0105239_100304975 370
79 3300013105 Ga0157369_10105453 Ga0157369_101054533 370
80 3300013296 Ga0157374_10146793 Ga0157374_101467932 370
81 3300013307 Ga0157372_10205708 Ga0157372_102057082 370
82 3300025906 Ga0207699_10156854 Ga0207699_101568541 370
83 3300025911 Ga0207654_10051451 Ga0207654_100514512 370
84 3300025941 Ga0207711_10086428 Ga0207711_100864283 370
85 3300025944 Ga0207661_10014859 Ga0207661_100148593 370
86 3300025981 Ga0207640_10142469 Ga0207640_101424691 370
87 3300026041 Ga0207639_10133079 Ga0207639_101330791 370
88 3300041458 Ga0451798_0976735 Ga0451798_0976735_204_1436 370
89 3300041459 Ga0451800_0052964 Ga0451800_0052964_6216_7448 370
90 3300046472 Ga0495580_0021984 Ga0495580_0021984_2556_3779 370
91 3300005289 Ga0065704_10077052 Ga0065704_100770523 371
92 3300005331 Ga0070670_100000697 Ga0070670_10000069711 371
93 3300009011 Ga0105251_10000008 Ga0105251_1000000832 371
94 3300014325 Ga0163163_10032221 Ga0163163_100322213 371
95 3300025735 Ga0207713_1000100 Ga0207713_100010083 371
96 3300025925 Ga0207650_10002042 Ga0207650_100020423 371
97 3300033180 Ga0307510_10035987 Ga0307510_100359873 371
98 3300048920 Ga0496117_0001767 Ga0496117_0001767_922_2220 371
99 3300048922 Ga0496119_0000328 Ga0496119_0000328_22224_23522 371
100 3300048923 Ga0496120_0000244 Ga0496120_0000244_42959_44257 371
101 3300048925 Ga0496122_0007109 Ga0496122_0007109_4103_5401 371
102 3300048926 Ga0496123_0000366 Ga0496123_0000366_7169_8467 371
103 3300048927 Ga0496124_0002996 Ga0496124_0002996_18978_20276 371
104 3300005456 Ga0070678_100074520 Ga0070678_1000745201 372
105 3300014325 Ga0163163_10013122 Ga0163163_100131223 372
106 3300014968 Ga0157379_10169884 Ga0157379_101698842 372
107 3300026121 Ga0207683_10302931 Ga0207683_103029312 372
108 3300037312 Ga0395899_0228185 Ga0395899_0228185_12_1241 372
109 3300047472 Ga0495686_0012524 Ga0495686_0012524_4300_5577 372
110 3300049569 Ga0501032_0012160 Ga0501032_0012160_902_2203 372
111 3300049571 Ga0501034_0292664 Ga0501034_0292664_143_1444 372
112 3300049579 Ga0501043_0017589 Ga0501043_0017589_3076_4377 372
113 3300049580 Ga0501046_0003730 Ga0501046_0003730_8015_9316 372
114 3300049823 Ga0501044_0170409 Ga0501044_0170409_656_1957 372
115 3300009098 Ga0105245_10000992 Ga0105245_1000099210 373
116 3300009174 Ga0105241_10005011 Ga0105241_100050117 373
117 3300025927 Ga0207687_10012315 Ga0207687_100123154 373
118 3300031595 Ga0265313_10002051 Ga0265313_100020516 373
119 3300049568 Ga0501031_0120833 Ga0501031_0120833_416_1678 374
120 3300005614 Ga0068856_100125180 Ga0068856_1001251802 375
121 3300009551 Ga0105238_10163661 Ga0105238_101636612 375
122 3300025924 Ga0207694_10105526 Ga0207694_101055262 375
123 3300026078 Ga0207702_10085803 Ga0207702_100858032 375
124 3300044656 Ga0466969_0004303 Ga0466969_0004303_25_1269 375
125 3300048921 Ga0496118_0056654 Ga0496118_0056654_600_2189 375
126 3300005341 Ga0070691_10007547 Ga0070691_100075474 376
127 3300044765 Ga0466970_0007040 Ga0466970_0007040_530_1780 376
128 3300005329 Ga0070683_100007330 Ga0070683_1000073306 377
129 3300005436 Ga0070713_100133934 Ga0070713_1001339343 377
130 3300005577 Ga0068857_100035682 Ga0068857_1000356826 377
131 3300009093 Ga0105240_10212662 Ga0105240_102126621 377
132 3300013307 Ga0157372_10090294 Ga0157372_100902942 377
133 3300026116 Ga0207674_10001346 Ga0207674_1000134614 377
134 3300045049 Ga0466959_0019037 Ga0466959_0019037_1326_2576 377
135 3300046529 Ga0495652_0194729 Ga0495652_0194729_146_1393 377
136 3300053119 Ga0500595_011684 Ga0500595_011684_658_1983 377
137 3300013296 Ga0157374_10264279 Ga0157374_102642792 378
138 3300028800 Ga0265338_10010043 Ga0265338_100100434 378
139 3300034816 Ga0373930_0001575 Ga0373930_0001575_965_2218 378
140 3300035084 Ga0373928_0000114 Ga0373928_0000114_2453_3706 378
141 3300035085 Ga0373929_0002461 Ga0373929_0002461_1668_2921 378
142 3300035089 Ga0373944_0000255 Ga0373944_0000255_9812_11065 378
143 3300035090 Ga0373949_0000516 Ga0373949_0000516_931_2184 378
144 3300035091 Ga0373951_0001189 Ga0373951_0001189_4277_5530 378
145 3300035112 Ga0373932_0000004 Ga0373932_0000004_328961_330214 378
146 3300035116 Ga0373945_0001362 Ga0373945_0001362_402_1655 378
147 3300035170 Ga0373943_0081806 Ga0373943_0081806_60_1313 378
148 3300035242 Ga0373962_0000028 Ga0373962_0000028_27742_28995 378
149 3300035691 Ga0373931_0000009 Ga0373931_0000009_288958_290211 378
150 3300035692 Ga0373935_0039746 Ga0373935_0039746_626_1879 378
151 3300035695 Ga0373927_0017376 Ga0373927_0017376_2980_4236 378
152 3300035695 Ga0373927_0018448 Ga0373927_0018448_2765_4018 378
153 3300037068 Ga0373925_0001919 Ga0373925_0001919_14130_15383 378
154 3300037068 Ga0373925_0006033 Ga0373925_0006033_3248_4504 378
155 3300030733 Ga0314311_1143704 Ga0314311_11437042 379
156 3300049571 Ga0501034_0150776 Ga0501034_0150776_949_2205 379
157 3300028800 Ga0265338_10000009 Ga0265338_10000009377 381
158 3300028800 Ga0265338_10001092 Ga0265338_100010927 381
159 3300029957 Ga0265324_10000844 Ga0265324_100008448 381
160 3300029957 Ga0265324_10001351 Ga0265324_100013514 381
161 3300031344 Ga0265316_10111458 Ga0265316_101114581 381
162 3300046648 Ga0495611_0027295 Ga0495611_0027295_205_1530 381
163 3300049705 Ga0501225_0001457 Ga0501225_0001457_2504_3760 381
164 3300053177 Ga0500636_0000505 Ga0500636_0000505_18843_20168 381
165 3300003762 Ga0055542_1000093 Ga0055542_100009374 382
166 3300025228 Ga0209672_100580 Ga0209672_1005805 382
167 3300025242 Ga0209258_100057 Ga0209258_10005728 382
168 3300025254 Ga0209148_1000068 Ga0209148_100006828 382
169 3300029957 Ga0265324_10010355 Ga0265324_100103553 383
170 3300037068 Ga0373925_0023758 Ga0373925_0023758_1278_2543 383
171 3300053122 Ga0500608_001297 Ga0500608_001297_5013_6299 384
172 3300031824 Ga0307413_10009728 Ga0307413_100097282 385
173 3300046460 Ga0495638_0000015 Ga0495638_0000015_17103_18377 386
174 3300046460 Ga0495638_0081521 Ga0495638_0081521_545_1846 386
175 3300014326 Ga0157380_10000275 Ga0157380_1000027521 387
176 3300005295 Ga0065707_10081717 Ga0065707_1008171727 388
177 3300006028 Ga0070717_10087882 Ga0070717_100878822 388
178 3300006237 Ga0097621_100013771 Ga0097621_1000137712 388
179 3300006358 Ga0068871_100022937 Ga0068871_1000229372 388
180 3300006914 Ga0075436_100015674 Ga0075436_1000156742 388
181 3300046460 Ga0495638_0007680 Ga0495638_0007680_1293_2573 388
182 3300046660 Ga0495625_0002895 Ga0495625_0002895_6327_7607 388
183 3300048921 Ga0496118_0101124 Ga0496118_0101124_209_1489 388
184 3300003320 rootH2_10168912 rootH2_101689122 389
185 3300045836 Ga0466958_0014101 Ga0466958_0014101_2031_3317 389
186 3300009093 Ga0105240_10029764 Ga0105240_100297642 390
187 3300013105 Ga0157369_10137881 Ga0157369_101378812 390
188 3300013307 Ga0157372_10141473 Ga0157372_101414731 390
189 3300025913 Ga0207695_10001734 Ga0207695_100017348 390
190 3300025913 Ga0207695_10154219 Ga0207695_101542192 390
191 iso_pu_bacteria 2643221577 2643896036 390
192 iso_pu_bacteria 2643221685 2644478243 390
193 iso_pu_bacteria 2895498888 2895502074 390
194 iso_pu_bacteria 2895511927 2895518076 390
195 iso_pu_bacteria 2895522137 2895524507 390
196 iso_pu_bacteria 2895525241 2895525940 390
197 3300002773 JGI25152J39213_1000218 JGI25152J39213_100021822 391
198 3300002774 JGI25150J39212_1000154 JGI25150J39212_100015417 391
199 3300003187 JGI25151J46595_10000133 JGI25151J46595_1000013322 391
200 3300003215 JGI25153J46596_10000058 JGI25153J46596_1000005821 391
201 3300005841 Ga0068863_100129357 Ga0068863_1001293572 391
202 3300013306 Ga0163162_10051559 Ga0163162_100515592 391
203 3300025245 Ga0207425_1000011 Ga0207425_1000011363 391
204 3300025258 Ga0209129_1000031 Ga0209129_1000031177 391
205 3300025294 Ga0209025_1000012 Ga0209025_1000012677 391
206 3300025297 Ga0209758_1000143 Ga0209758_1000143130 391
207 3300025941 Ga0207711_10037382 Ga0207711_100373823 391
208 3300046615 Ga0495656_0002359 Ga0495656_0002359_14_1372 391
209 iso_pu_bacteria 8003014200 8003015412 391
210 3300002741 JGI25157J39369_1000132 JGI25157J39369_100013245 392
211 3300002771 JGI25163J39215_1000228 JGI25163J39215_100022811 392
212 3300003751 Ga0055538_1001042 Ga0055538_10010423 392
213 3300005985 Ga0081539_10050503 Ga0081539_100505032 392
214 3300025224 Ga0209784_100053 Ga0209784_100053108 392
215 3300025231 Ga0207427_100061 Ga0207427_10006149 392
216 3300025231 Ga0207427_101163 Ga0207427_1011632 392
217 3300025233 Ga0209437_100037 Ga0209437_100037208 392
218 3300025233 Ga0209437_100279 Ga0209437_10027922 392
219 3300025242 Ga0209258_100138 Ga0209258_100138125 392
220 3300025246 Ga0209646_1001187 Ga0209646_10011872 392
221 3300025250 Ga0209026_1000104 Ga0209026_100010449 392
222 3300025254 Ga0209148_1000001 Ga0209148_1000001302 392
223 3300025254 Ga0209148_1000002 Ga0209148_1000002260 392
224 3300025256 Ga0209759_1000220 Ga0209759_100022065 392
225 3300025261 Ga0209233_1000002 Ga0209233_10000021929 392
226 3300025272 Ga0209455_1000079 Ga0209455_100007949 392
227 3300006914 Ga0075436_100001089 Ga0075436_10000108910 393
228 3300025898 Ga0207692_10065543 Ga0207692_100655432 393
229 3300025911 Ga0207654_10016969 Ga0207654_100169693 393
230 3300046519 Ga0495632_0016867 Ga0495632_0016867_1544_2845 393
231 3300048918 Ga0496115_0000095 Ga0496115_0000095_12754_14046 393
232 iso_pu_bacteria 2818991457 2819661888 393
233 iso_pu_bacteria 2919130084 2919133813 393
234 iso_pu_bacteria 2929195423 2929199893 393
235 3300005844 Ga0068862_100039426 Ga0068862_1000394263 394
236 3300006931 Ga0097620_100049249 Ga0097620_1000492492 394
237 3300028380 Ga0268265_10137278 Ga0268265_101372782 394
238 3300041406 Ga0439439_0004210 Ga0439439_0004210_13_1314 394
239 3300041410 Ga0439461_0001086 Ga0439461_0001086_1700_3001 394
240 3300041413 Ga0439465_0002438 Ga0439465_0002438_3083_4384 394
241 3300042014 Ga0439457_006317 Ga0439457_006317_444_1745 394
242 3300042015 Ga0439462_0002986 Ga0439462_0002986_1147_2448 394
243 3300042435 Ga0439434_0016877 Ga0439434_0016877_58_1359 394
244 3300047472 Ga0495686_0003036 Ga0495686_0003036_8591_9886 394
245 3300053134 Ga0500658_0001059 Ga0500658_0001059_8740_10041 394
246 3300005330 Ga0070690_100046273 Ga0070690_1000462731 395
247 3300005466 Ga0070685_10048236 Ga0070685_100482362 395
248 3300005841 Ga0068863_100011508 Ga0068863_1000115083 395
249 3300009553 Ga0105249_10142007 Ga0105249_101420072 395
250 3300013296 Ga0157374_10153097 Ga0157374_101530972 395
251 3300013308 Ga0157375_10034224 Ga0157375_100342242 395
252 3300025298 Ga0209050_1002871 Ga0209050_10028713 395
253 3300025304 Ga0209257_1025654 Ga0209257_10256542 395
254 3300026067 Ga0207678_10034859 Ga0207678_100348595 395
255 3300026088 Ga0207641_10048856 Ga0207641_100488563 395
256 3300028800 Ga0265338_10013083 Ga0265338_100130839 395
257 3300041413 Ga0439465_0000057 Ga0439465_0000057_15114_16412 395
258 3300041451 Ga0451791_0598715 Ga0451791_0598715_299_1606 395
259 3300042007 Ga0439449_0002182 Ga0439449_0002182_553_1851 395
260 3300046691 Ga0495670_0000025 Ga0495670_0000025_11675_13015 395
261 3300003762 Ga0055542_1000088 Ga0055542_100008818 396
262 3300003763 Ga0055529_1000034 Ga0055529_100003418 396
263 3300003781 Ga0055536_1008763 Ga0055536_10087633 396
264 3300003794 Ga0055531_10001188 Ga0055531_100011882 396
265 3300025254 Ga0209148_1000093 Ga0209148_100009318 396
266 3300025272 Ga0209455_1000045 Ga0209455_1000045159 396
267 3300025273 Ga0209673_1001757 Ga0209673_100175713 396
268 3300025291 Ga0209675_1006346 Ga0209675_10063462 396
269 3300025292 Ga0209676_1001475 Ga0209676_100147511 396
270 3300025292 Ga0209676_1003116 Ga0209676_10031162 396
271 3300025292 Ga0209676_1009163 Ga0209676_10091633 396
272 3300025294 Ga0209025_1044984 Ga0209025_10449842 396
273 3300025297 Ga0209758_1013289 Ga0209758_10132893 396
274 3300025299 Ga0209256_1001211 Ga0209256_100121112 396
275 3300025299 Ga0209256_1001259 Ga0209256_100125915 396
276 3300025304 Ga0209257_1000822 Ga0209257_100082234 396
277 3300025304 Ga0209257_1001291 Ga0209257_10012912 396
278 3300025304 Ga0209257_1001585 Ga0209257_10015853 396
279 3300046453 Ga0495627_008304 Ga0495627_008304_2537_3838 396
280 3300046471 Ga0495650_0000091 Ga0495650_0000091_47020_48345 396
281 3300046506 Ga0495583_0000364 Ga0495583_0000364_25861_27186 396
282 3300046665 Ga0495661_0015567 Ga0495661_0015567_1071_2396 396
283 3300049568 Ga0501031_0113889 Ga0501031_0113889_110_1438 396
284 3300049580 Ga0501046_0100434 Ga0501046_0100434_445_1773 396
285 3300049822 Ga0501035_0051327 Ga0501035_0051327_1132_2448 396
286 3300053161 Ga0500634_0000092 Ga0500634_0000092_6761_8062 396
287 iso_pu_bacteria 2747842501 2748017816 396
288 3300003775 Ga0055524_1004490 Ga0055524_10044901 397
289 3300003794 Ga0055531_10001537 Ga0055531_100015379 397
290 3300005985 Ga0081539_10000206 Ga0081539_1000020636 397
291 3300006051 Ga0075364_10000136 Ga0075364_1000013616 397
292 3300025284 Ga0209130_1002731 Ga0209130_10027315 397
293 3300025291 Ga0209675_1005956 Ga0209675_10059563 397
294 3300025292 Ga0209676_1001455 Ga0209676_100145513 397
295 3300025292 Ga0209676_1001734 Ga0209676_10017343 397
296 3300025294 Ga0209025_1000802 Ga0209025_100080233 397
297 3300025298 Ga0209050_1001338 Ga0209050_10013389 397
298 3300025299 Ga0209256_1000752 Ga0209256_100075213 397
299 3300025304 Ga0209257_1000712 Ga0209257_100071227 397
300 3300025304 Ga0209257_1001499 Ga0209257_100149912 397
301 3300038705 Ga0237819_00271 Ga0237819_00271_7228_8532 397
302 3300050491 nmdc:mga00v17_11418_c1 nmdc:mga00v17_11418_c1_492_1820 397
303 3300050491 nmdc:mga00v17_409_c1 nmdc:mga00v17_409_c1_15355_16659 397
304 3300002737 JGI25162J39368_1000115 JGI25162J39368_10001158 398
305 3300002772 JGI25164J39214_1000090 JGI25164J39214_100009067 398
306 3300003214 JGI25165J46597_1000194 JGI25165J46597_100019413 398
307 3300003761 Ga0055535_1000106 Ga0055535_100010667 398
308 3300003762 Ga0055542_1000150 Ga0055542_10001508 398
309 3300003763 Ga0055529_1000168 Ga0055529_100016813 398
310 3300003763 Ga0055529_1000178 Ga0055529_100017868 398
311 3300003856 Ga0058692_1000057 Ga0058692_100005745 398
312 3300005457 Ga0070662_100001369 Ga0070662_10000136910 398
313 3300009148 Ga0105243_10000184 Ga0105243_1000018418 398
314 3300025933 Ga0207706_10003484 Ga0207706_1000348411 398
315 3300025935 Ga0207709_10000466 Ga0207709_1000046628 398
316 3300027312 Ga0209371_1000156 Ga0209371_100015630 398
317 3300030500 Ga0268256_1000130 Ga0268256_100013047 398
318 3300048929 Ga0496126_0039301 Ga0496126_0039301_920_2293 398
319 iso_pu_bacteria 2852684882 2852688553 398
320 3300003761 Ga0055535_1000312 Ga0055535_100031211 399
321 3300025929 Ga0207664_10098164 Ga0207664_100981642 399
322 3300031456 Ga0307513_10002543 Ga0307513_100025433 399
323 3300041509 Ga0451843_1731494 Ga0451843_1731494_1124_2434 399
324 3300044765 Ga0466970_0009117 Ga0466970_0009117_354_1676 399
325 3300045049 Ga0466959_0000042 Ga0466959_0000042_53210_54532 399
326 3300045836 Ga0466958_0023416 Ga0466958_0023416_787_2109 399
327 3300044693 Ga0466961_0000103 Ga0466961_0000103_7297_8619 400
328 3300044706 Ga0466964_0012742 Ga0466964_0012742_1810_3138 400
329 3300049570 Ga0501033_0005782 Ga0501033_0005782_4796_6136 400
330 3300037312 Ga0395899_0000321 Ga0395899_0000321_16526_17854 401
331 3300037418 Ga0395900_0000144 Ga0395900_0000144_105803_107131 401
332 3300037466 Ga0395898_0000018 Ga0395898_0000018_254476_255804 401
333 3300038443 Ga0395901_0051736 Ga0395901_0051736_964_2292 401
334 iso_pu_bacteria 2928963466 2928966944 402
335 3300005435 Ga0070714_100102244 Ga0070714_1001022442 403
336 3300025233 Ga0209437_100186 Ga0209437_10018631 403
337 3300025926 Ga0207659_10027097 Ga0207659_100270972 403
338 3300037312 Ga0395899_0033909 Ga0395899_0033909_1974_3320 404
339 3300037466 Ga0395898_0000336 Ga0395898_0000336_19500_20846 404
340 3300053129 Ga0500628_001005 Ga0500628_001005_118_1461 404
341 3300003759 Ga0055525_1000027 Ga0055525_100002796 405
342 3300003760 Ga0055527_1000229 Ga0055527_10002299 405
343 3300003761 Ga0055535_1000065 Ga0055535_100006556 405
344 3300003762 Ga0055542_1000083 Ga0055542_100008313 405
345 3300003763 Ga0055529_1000654 Ga0055529_10006546 405
346 3300025228 Ga0209672_100005 Ga0209672_100005599 405
347 3300025230 Ga0209563_100023 Ga0209563_100023259 405
348 3300025242 Ga0209258_100006 Ga0209258_100006599 405
349 3300025254 Ga0209148_1000012 Ga0209148_1000012599 405
350 3300025272 Ga0209455_1000008 Ga0209455_1000008599 405
351 3300015261 Ga0182006_1012205 Ga0182006_10122052 406
352 3300003752 Ga0055539_1002337 Ga0055539_10023372 407
353 3300003756 Ga0055533_1001399 Ga0055533_10013994 407
354 3300003760 Ga0055527_1000031 Ga0055527_100003165 407
355 3300003761 Ga0055535_1000283 Ga0055535_100028320 407
356 3300003762 Ga0055542_1000100 Ga0055542_100010018 407
357 3300003763 Ga0055529_1000073 Ga0055529_100007386 407
358 3300005614 Ga0068856_100065698 Ga0068856_1000656982 407
359 3300025226 Ga0209674_100187 Ga0209674_10018739 407
360 3300025228 Ga0209672_100016 Ga0209672_100016249 407
361 3300025242 Ga0209258_100012 Ga0209258_100012390 407
362 3300025253 Ga0209677_102988 Ga0209677_1029882 407
363 3300025254 Ga0209148_1000014 Ga0209148_1000014266 407
364 3300025272 Ga0209455_1000014 Ga0209455_1000014154 407
365 3300026078 Ga0207702_10000204 Ga0207702_1000020424 407
366 3300026121 Ga0207683_10007858 Ga0207683_100078582 408
367 3300002705 JGI25156J39149_1002556 JGI25156J39149_10025564 409
368 3300002737 JGI25162J39368_1000819 JGI25162J39368_10008195 409
369 3300002741 JGI25157J39369_1001714 JGI25157J39369_10017143 409
370 3300002772 JGI25164J39214_1000111 JGI25164J39214_100011129 409
371 3300003214 JGI25165J46597_1000103 JGI25165J46597_100010330 409
372 3300003760 Ga0055527_1001230 Ga0055527_10012302 409
373 3300003762 Ga0055542_1000217 Ga0055542_100021725 409
374 3300003763 Ga0055529_1000067 Ga0055529_1000067120 409
375 3300025228 Ga0209672_100212 Ga0209672_10021222 409
376 3300025231 Ga0207427_100155 Ga0207427_10015531 409
377 3300025242 Ga0209258_100106 Ga0209258_10010654 409
378 3300025250 Ga0209026_1000618 Ga0209026_10006183 409
379 3300025254 Ga0209148_1000042 Ga0209148_1000042180 409
380 3300025256 Ga0209759_1004617 Ga0209759_10046172 409
381 3300025256 Ga0209759_1004637 Ga0209759_10046372 409
382 3300025261 Ga0209233_1000265 Ga0209233_100026531 409
383 3300025272 Ga0209455_1000016 Ga0209455_1000016435 409
384 3300049586 Ga0501070_0009906 Ga0501070_0009906_4063_5448 409
385 3300002705 JGI25156J39149_1004959 JGI25156J39149_10049592 410
386 3300002741 JGI25157J39369_1000882 JGI25157J39369_10008825 410
387 3300025250 Ga0209026_1000108 Ga0209026_100010868 410
388 3300025256 Ga0209759_1000501 Ga0209759_10005013 410
389 3300015687 Ga0183368_1002 Ga0183368_10021363 412
390 3300003756 Ga0055533_1000327 Ga0055533_100032715 415
391 3300025226 Ga0209674_100014 Ga0209674_10001497 415
392 3300025904 Ga0207647_10003922 Ga0207647_100039226 415
393 3300002067 JGI24735J21928_10007404 JGI24735J21928_100074042 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

88

445

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e9o-assembly1.cif.gz_B e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.8001 31 395
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.7996 31 396
7t3n-assembly1.cif.gz_A r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) 0.7491 33 408
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.749 34 395
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.7483 31 396
ID Description Score Start End Superfamily
af_P39398_249_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9177 204 403 1.20.1250.20
af_P0AA78_214_424_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9154 201 404 1.20.1250.20
af_Q46916_243_446_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9132 205 405 1.20.1250.20
af_Q5NCM1_276_486_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9067 201 402 1.20.1250.20
af_P39398_249_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9049 204 403 1.20.1250.20
ID Description Score Start End GO Terms
AF-T1CJP1-F1-model_v4 Major facilitator superfamily MFS_1 0.9035 181 327 GO:0015134
GO:0016020
AF-A0A2V9QEX3-F1-model_v4 MFS transporter 0.8986 167 405 GO:0015134
GO:0016020
AF-A0A2V9QEX3-F1-model_v4 MFS transporter 0.8673 167 405 GO:0015134
GO:0016020
AF-A0A7S0WUC9-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8658 212 397 GO:0016020
GO:0022857
AF-A0A497KM25-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8543 151 396 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
78.8 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map