F432500

General Info

Members Datasets Scaffolds Average Seq Length
393 209 786 136

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10460638|Ga0065712_104606381
Length 161
Sequence LLWKGAHLGLHCRAGKLAAPAQLPLCRAAMRRFGPPPSADEIEAIARDALHRLPEPFSNSIGDIVLLVEDFADDETLAQMDIEDPFDLSGLYEGIPLTERSVEQSGTLPERIFLYRRPILDEWAAGDDTLEHLVAHVLIHEVGHHFGLSDGDIHALEDSVE

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
184 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
185 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
186 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
187 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
190 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
191 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
192 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
196 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
197 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
198 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
199 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
200 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
201 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
202 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2643221622 Sphingomonas sp. Root241 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 3.31
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10460638 3300005290 Bacteria 678
2 ARcpr5oldR_c002867 3300000041 Bacteria 1565
3 ARcpr5yngRDRAFT_c004521 3300000043 Bacteria 1314
4 ARCol0yngRDRAFT_1006803 3300000652 Bacteria 821
5 JGI24740J21852_10014073 3300001979 Bacteria 2963
6 JGI24739J22299_10001357 3300001989 Bacteria 9185
7 JGI24739J22299_10080404 3300001989 Bacteria 1002
8 JGI24737J22298_10001192 3300001990 Bacteria 9171
9 JGI24737J22298_10019149 3300001990 Bacteria 2190
10 JGI24738J21930_10136173 3300002075 Bacteria 540
11 JGI24744J21845_10094086 3300002077 Bacteria 551
12 JGI24034J26672_10075389 3300002239 Bacteria 609
13 JGI24742J22300_10029235 3300002244 Bacteria 958
14 JGI25150J39212_1030589 3300002774 Bacteria 748
15 JGI25153J46596_10018507 3300003215 Bacteria 2703
16 Ga0055537_1001025 3300003773 Bacteria 12617
17 Ga0055524_1000155 3300003775 Bacteria 79672
18 Ga0055528_1039866 3300003790 Bacteria 1067
19 Ga0055531_10010345 3300003794 Bacteria 4646
20 Ga0065165_1004623 3300005262 Bacteria 8367
21 Ga0070658_10009130 3300005327 Bacteria 7971
22 Ga0070658_10042633 3300005327 Bacteria 3665
23 Ga0070658_10055385 3300005327 Bacteria 3222
24 Ga0070658_10184221 3300005327 Bacteria 1758
25 Ga0070676_10012034 3300005328 Bacteria 4715
26 Ga0070683_101771349 3300005329 Unclassified 594
27 Ga0070690_100446064 3300005330 Bacteria 958
28 Ga0070670_100022850 3300005331 Bacteria 5381
29 Ga0070677_10543915 3300005333 Bacteria 635
30 Ga0068869_100000037 3300005334 Bacteria 54729
31 Ga0070666_10004179 3300005335 Bacteria 8766
32 Ga0070666_10028508 3300005335 Bacteria 3664
33 Ga0070680_100111209 3300005336 Bacteria 2280
34 Ga0070680_100123720 3300005336 Bacteria 2160
35 Ga0070680_100180619 3300005336 Bacteria 1777
36 Ga0070680_100357870 3300005336 Bacteria 1241
37 Ga0068868_100003289 3300005338 Bacteria 11252
38 Ga0068868_101308174 3300005338 Bacteria 673
39 Ga0070660_100014391 3300005339 Bacteria 5696
40 Ga0070660_100028480 3300005339 Bacteria 4180
41 Ga0070660_100042002 3300005339 Bacteria 3488
42 Ga0070660_100073510 3300005339 Bacteria 2673
43 Ga0070660_100084070 3300005339 Bacteria 2501
44 Ga0070660_100251458 3300005339 Bacteria 1441
45 Ga0070660_100994826 3300005339 Bacteria 708
46 Ga0070689_100035844 3300005340 Bacteria 3791
47 Ga0070661_100004551 3300005344 Bacteria 9542
48 Ga0070661_100031115 3300005344 Bacteria 3858
49 Ga0070661_100080475 3300005344 Bacteria 2404
50 Ga0070661_100330919 3300005344 Bacteria 1191
51 Ga0070661_100920136 3300005344 Bacteria 722
52 Ga0070692_10006327 3300005345 Bacteria 5136
53 Ga0070692_10291812 3300005345 Bacteria 992
54 Ga0070668_100147108 3300005347 Bacteria 1902
55 Ga0070669_100000553 3300005353 Bacteria 27761
56 Ga0070675_100100684 3300005354 Bacteria 2433
57 Ga0070671_100017714 3300005355 Bacteria 5773
58 Ga0070671_100022777 3300005355 Bacteria 5118
59 Ga0070674_100185232 3300005356 Bacteria 1597
60 Ga0070674_100972041 3300005356 Bacteria 743
61 Ga0070673_100000526 3300005364 Bacteria 20563
62 Ga0070673_100000617 3300005364 Bacteria 19485
63 Ga0070688_100144678 3300005365 Bacteria 1618
64 Ga0070659_100000226 3300005366 Bacteria 43761
65 Ga0070659_100036941 3300005366 Bacteria 3807
66 Ga0070659_100037447 3300005366 Bacteria 3781
67 Ga0070659_100308711 3300005366 Bacteria 1320
68 Ga0070659_100525184 3300005366 Bacteria 1011
69 Ga0070659_101169687 3300005366 Bacteria 679
70 Ga0070667_100019471 3300005367 Bacteria 5631
71 Ga0070714_101981475 3300005435 Bacteria 568
72 Ga0070663_100022206 3300005455 Bacteria 4238
73 Ga0070663_100053327 3300005455 Bacteria 2886
74 Ga0070663_100086772 3300005455 Bacteria 2311
75 Ga0070663_100179422 3300005455 Bacteria 1641
76 Ga0070663_101607682 3300005455 Bacteria 580
77 Ga0070678_100009619 3300005456 Bacteria 5869
78 Ga0070678_101027387 3300005456 Bacteria 758
79 Ga0070662_100000705 3300005457 Bacteria 20486
80 Ga0070662_100005911 3300005457 Bacteria 7851
81 Ga0070662_100014679 3300005457 Bacteria 5235
82 Ga0070662_100165533 3300005457 Bacteria 1732
83 Ga0070662_101120137 3300005457 Bacteria 675
84 Ga0070681_10354433 3300005458 Bacteria 1377
85 Ga0068867_100000435 3300005459 Bacteria 27943
86 Ga0068867_100022258 3300005459 Bacteria 4530
87 Ga0068867_100159747 3300005459 Bacteria 1776
88 Ga0070679_100126541 3300005530 Bacteria 2537
89 Ga0070679_100133819 3300005530 Bacteria 2460
90 Ga0070679_100391145 3300005530 Bacteria 1336
91 Ga0070679_100665965 3300005530 Bacteria 983
92 Ga0070679_101229027 3300005530 Bacteria 694
93 Ga0070679_101734639 3300005530 Bacteria 572
94 Ga0070684_102182504 3300005535 Bacteria 522
95 Ga0068853_100162914 3300005539 Bacteria 2013
96 Ga0068853_100917539 3300005539 Bacteria 841
97 Ga0070672_100001515 3300005543 Bacteria 14397
98 Ga0070672_100121709 3300005543 Bacteria 2136
99 Ga0070696_101326153 3300005546 Bacteria 611
100 Ga0070693_100413054 3300005547 Bacteria 938
101 Ga0070665_100958728 3300005548 Bacteria 868
102 Ga0070665_101563898 3300005548 Bacteria 667
103 Ga0068855_100036875 3300005563 Bacteria 5816
104 Ga0068855_100047240 3300005563 Bacteria 5086
105 Ga0068855_101263463 3300005563 Bacteria 765
106 Ga0070664_100014984 3300005564 Bacteria 6327
107 Ga0070664_100105316 3300005564 Bacteria 2456
108 Ga0068857_100004366 3300005577 Bacteria 11946
109 Ga0068857_101113858 3300005577 Bacteria 763
110 Ga0068854_100453425 3300005578 Bacteria 1072
111 Ga0068852_100002226 3300005616 Bacteria 13301
112 Ga0068852_100008645 3300005616 Bacteria 7524
113 Ga0068852_100729152 3300005616 Bacteria 1002
114 Ga0068852_101361824 3300005616 Bacteria 731
115 Ga0068852_101422659 3300005616 Bacteria 715
116 Ga0068859_100003734 3300005617 Bacteria 15514
117 Ga0068859_100224934 3300005617 Bacteria 1964
118 Ga0068864_100003081 3300005618 Bacteria 13762
119 Ga0068864_100003875 3300005618 Bacteria 12316
120 Ga0068861_100658011 3300005719 Bacteria 968
121 Ga0068851_10035142 3300005834 Bacteria 2504
122 Ga0068851_10245207 3300005834 Bacteria 1014
123 Ga0068851_10597003 3300005834 Bacteria 671
124 Ga0068870_10527269 3300005840 Bacteria 791
125 Ga0068863_100007156 3300005841 Bacteria 10948
126 Ga0068863_100079745 3300005841 Bacteria 3100
127 Ga0068863_100202501 3300005841 Bacteria 1910
128 Ga0068858_100013456 3300005842 Bacteria 7719
129 Ga0068858_100074051 3300005842 Bacteria 3162
130 Ga0068860_100003826 3300005843 Bacteria 15481
131 Ga0068860_100707241 3300005843 Bacteria 1017
132 Ga0068862_100442606 3300005844 Bacteria 1223
133 Ga0097621_100033842 3300006237 Bacteria 4073
134 Ga0097621_101252651 3300006237 Bacteria 699
135 Ga0068871_100081800 3300006358 Bacteria 2676
136 Ga0068871_100752849 3300006358 Bacteria 895
137 Ga0068865_100003562 3300006881 Bacteria 9348
138 Ga0097620_100003734 3300006931 Bacteria 15514
139 Ga0097620_100224937 3300006931 Bacteria 1964
140 Ga0097620_102094521 3300006931 Bacteria 624
141 Ga0105245_10003832 3300009098 Bacteria 13375
142 Ga0105243_10073259 3300009148 Bacteria 2775
143 Ga0105243_12386966 3300009148 Bacteria 567
144 Ga0105248_10004678 3300009177 Bacteria 15148
145 Ga0105248_10054398 3300009177 Bacteria 4489
146 Ga0105238_10401118 3300009551 Bacteria 1364
147 Ga0105239_10229432 3300010375 Bacteria 2083
148 Ga0157373_10001808 3300013100 Bacteria 16270
149 Ga0157373_10211741 3300013100 Bacteria 1367
150 Ga0157373_10637930 3300013100 Bacteria 777
151 Ga0157371_10004280 3300013102 Bacteria 12521
152 Ga0157371_10007134 3300013102 Bacteria 9075
153 Ga0157371_10063408 3300013102 Bacteria 2619
154 Ga0157371_10112265 3300013102 Bacteria 1934
155 Ga0157371_10325232 3300013102 Bacteria 1116
156 Ga0157371_10375609 3300013102 Bacteria 1037
157 Ga0157371_10382759 3300013102 Bacteria 1027
158 Ga0157371_11067476 3300013102 Unclassified 618
159 Ga0157370_10023646 3300013104 Bacteria 6098
160 Ga0157370_10318743 3300013104 Bacteria 1434
161 Ga0157370_10393226 3300013104 Bacteria 1276
162 Ga0157370_10535983 3300013104 Bacteria 1074
163 Ga0157374_10008086 3300013296 Bacteria 8992
164 Ga0157378_10008452 3300013297 Bacteria 8968
165 Ga0163162_10037511 3300013306 Bacteria 4837
166 Ga0163162_10189173 3300013306 Bacteria 2186
167 Ga0163162_10781652 3300013306 Bacteria 1073
168 Ga0157372_10035290 3300013307 Bacteria 5505
169 Ga0157372_11947302 3300013307 Bacteria 675
170 Ga0157375_10001267 3300013308 Bacteria 21875
171 Ga0157375_12370361 3300013308 Bacteria 633
172 Ga0163163_10078901 3300014325 Bacteria 3290
173 Ga0157377_10402378 3300014745 Bacteria 933
174 Ga0157377_10547437 3300014745 Bacteria 817
175 Ga0207425_1021830 3300025245 Bacteria 1354
176 Ga0209026_1009917 3300025250 Bacteria 1822
177 Ga0209565_1000011 3300025263 Bacteria 637062
178 Ga0209673_1001365 3300025273 Bacteria 24145
179 Ga0209675_1013455 3300025291 Bacteria 2556
180 Ga0209564_1035820 3300025295 Bacteria 1429
181 Ga0209758_1005915 3300025297 Bacteria 9096
182 Ga0209050_1009422 3300025298 Bacteria 4999
183 Ga0209256_1000016 3300025299 Bacteria 599092
184 Ga0209257_1002963 3300025304 Bacteria 15539
185 Ga0207697_10002743 3300025315 Bacteria 8981
186 Ga0207697_10351607 3300025315 Bacteria 654
187 Ga0207656_10016046 3300025321 Bacteria 2909
188 Ga0207656_10345674 3300025321 Bacteria 742
189 Ga0207688_10007911 3300025901 Bacteria 5786
190 Ga0207680_10015529 3300025903 Bacteria 3975
191 Ga0207647_10000106 3300025904 Bacteria 64310
192 Ga0207647_10292610 3300025904 Bacteria 928
193 Ga0207647_10536934 3300025904 Bacteria 650
194 Ga0207643_10025544 3300025908 Bacteria 3265
195 Ga0207705_10001009 3300025909 Bacteria 22878
196 Ga0207705_10002265 3300025909 Bacteria 14887
197 Ga0207705_10005335 3300025909 Bacteria 9614
198 Ga0207705_10039814 3300025909 Bacteria 3369
199 Ga0207705_10122722 3300025909 Bacteria 1929
200 Ga0207705_10127189 3300025909 Bacteria 1894
201 Ga0207705_10287673 3300025909 Bacteria 1259
202 Ga0207705_10599900 3300025909 Bacteria 856
203 Ga0207705_10608102 3300025909 Bacteria 850
204 Ga0207705_10680024 3300025909 Bacteria 800
205 Ga0207705_11075830 3300025909 Bacteria 620
206 Ga0207707_10134548 3300025912 Bacteria 2161
207 Ga0207707_10155974 3300025912 Bacteria 1997
208 Ga0207660_10116575 3300025917 Bacteria 2017
209 Ga0207657_10003988 3300025919 Bacteria 15693
210 Ga0207657_10004680 3300025919 Bacteria 14445
211 Ga0207657_10008735 3300025919 Bacteria 10253
212 Ga0207657_10011147 3300025919 Bacteria 8935
213 Ga0207657_10013674 3300025919 Bacteria 7950
214 Ga0207657_10145949 3300025919 Bacteria 1930
215 Ga0207657_10181816 3300025919 Bacteria 1699
216 Ga0207657_10399187 3300025919 Bacteria 1081
217 Ga0207649_10013628 3300025920 Bacteria 4543
218 Ga0207649_10038811 3300025920 Bacteria 2885
219 Ga0207649_10157422 3300025920 Bacteria 1571
220 Ga0207649_10323540 3300025920 Bacteria 1134
221 Ga0207649_10968627 3300025920 Bacteria 669
222 Ga0207652_10312602 3300025921 Bacteria 1418
223 Ga0207652_10478452 3300025921 Bacteria 1122
224 Ga0207652_10564330 3300025921 Bacteria 1022
225 Ga0207652_10626034 3300025921 Bacteria 963
226 Ga0207681_10075320 3300025923 Bacteria 2366
227 Ga0207681_10461024 3300025923 Bacteria 1035
228 Ga0207681_10830476 3300025923 Bacteria 772
229 Ga0207650_10018261 3300025925 Bacteria 4919
230 Ga0207650_10209668 3300025925 Bacteria 1564
231 Ga0207659_10032506 3300025926 Bacteria 3582
232 Ga0207687_10005376 3300025927 Bacteria 8474
233 Ga0207644_10000614 3300025931 Bacteria 22677
234 Ga0207644_10104394 3300025931 Bacteria 2133
235 Ga0207690_10005022 3300025932 Bacteria 7817
236 Ga0207690_10045661 3300025932 Bacteria 2896
237 Ga0207690_11173311 3300025932 Bacteria 641
238 Ga0207706_10000341 3300025933 Bacteria 50615
239 Ga0207706_10003248 3300025933 Bacteria 15582
240 Ga0207706_10021001 3300025933 Bacteria 5865
241 Ga0207706_10092930 3300025933 Bacteria 2653
242 Ga0207709_11110668 3300025935 Bacteria 649
243 Ga0207670_10074587 3300025936 Bacteria 2356
244 Ga0207669_10155385 3300025937 Bacteria 1608
245 Ga0207704_10005443 3300025938 Bacteria 5873
246 Ga0207691_10003928 3300025940 Bacteria 14444
247 Ga0207691_10007087 3300025940 Bacteria 10821
248 Ga0207711_10002755 3300025941 Bacteria 15479
249 Ga0207711_10005061 3300025941 Bacteria 11181
250 Ga0207689_10001967 3300025942 Bacteria 19411
251 Ga0207679_10097676 3300025945 Bacteria 2288
252 Ga0207679_10146136 3300025945 Bacteria 1918
253 Ga0207679_10527217 3300025945 Bacteria 1057
254 Ga0207679_10568083 3300025945 Bacteria 1019
255 Ga0207679_11000760 3300025945 Bacteria 766
256 Ga0207679_11515046 3300025945 Bacteria 615
257 Ga0207667_10033268 3300025949 Bacteria 5545
258 Ga0207667_10250464 3300025949 Bacteria 1812
259 Ga0207667_10497979 3300025949 Bacteria 1236
260 Ga0207667_11373506 3300025949 Bacteria 681
261 Ga0207651_10000825 3300025960 Bacteria 13420
262 Ga0207651_10000915 3300025960 Bacteria 12977
263 Ga0207640_10003645 3300025981 Bacteria 8305
264 Ga0207640_10104329 3300025981 Bacteria 1995
265 Ga0207640_11528384 3300025981 Bacteria 600
266 Ga0207658_10013873 3300025986 Bacteria 5514
267 Ga0207658_10020664 3300025986 Bacteria 4560
268 Ga0207677_10007256 3300026023 Bacteria 6112
269 Ga0207703_10043628 3300026035 Bacteria 3600
270 Ga0207703_10083700 3300026035 Bacteria 2666
271 Ga0207639_10045692 3300026041 Bacteria 3300
272 Ga0207639_10470178 3300026041 Bacteria 1144
273 Ga0207678_10007027 3300026067 Bacteria 9996
274 Ga0207678_10097997 3300026067 Bacteria 2505
275 Ga0207678_10109798 3300026067 Bacteria 2353
276 Ga0207678_10193770 3300026067 Bacteria 1737
277 Ga0207678_11115709 3300026067 Bacteria 698
278 Ga0207678_11332774 3300026067 Bacteria 635
279 Ga0207678_11658502 3300026067 Bacteria 562
280 Ga0207641_10073988 3300026088 Bacteria 2937
281 Ga0207641_10197987 3300026088 Bacteria 1850
282 Ga0207648_10002130 3300026089 Bacteria 21534
283 Ga0207648_10009403 3300026089 Bacteria 9362
284 Ga0207648_10196469 3300026089 Bacteria 1789
285 Ga0207676_10001223 3300026095 Bacteria 19146
286 Ga0207676_10001969 3300026095 Bacteria 14965
287 Ga0207674_10005518 3300026116 Bacteria 15021
288 Ga0207674_11114607 3300026116 Bacteria 759
289 Ga0207675_100690309 3300026118 Bacteria 1029
290 Ga0207683_10011928 3300026121 Bacteria 7417
291 Ga0207683_11038747 3300026121 Bacteria 760
292 Ga0207698_10067148 3300026142 Bacteria 2827
293 Ga0207698_10071760 3300026142 Bacteria 2749
294 Ga0207698_10479230 3300026142 Bacteria 1207
295 Ga0207698_11157531 3300026142 Bacteria 787
296 Ga0209974_10166857 3300027876 Bacteria 801
297 Ga0268266_10282199 3300028379 Bacteria 1544
298 Ga0268266_11241932 3300028379 Bacteria 720
299 Ga0268265_10676070 3300028380 Bacteria 995
300 Ga0268265_10867014 3300028380 Bacteria 884
301 Ga0268264_10003563 3300028381 Bacteria 13405
302 Ga0307408_100143150 3300031548 Bacteria 1879
303 Ga0307408_100267956 3300031548 Bacteria 1416
304 Ga0307408_100288778 3300031548 Bacteria 1369
305 Ga0307407_10078588 3300031903 Bacteria 1988
306 Ga0307412_10649480 3300031911 Bacteria 900
307 Ga0307409_100292097 3300031995 Bacteria 1512
308 Ga0307416_100755186 3300032002 Bacteria 1065
309 Ga0307416_103146837 3300032002 Bacteria 552
310 Ga0307415_100418169 3300032126 Bacteria 1149
311 Ga0395899_0182737 3300037312 Bacteria 1471
312 Ga0395900_0000364 3300037418 Bacteria 65068
313 Ga0395900_0014663 3300037418 Bacteria 7994
314 Ga0395900_0085539 3300037418 Bacteria 3241
315 Ga0395900_0537262 3300037418 Bacteria 1115
316 Ga0395900_0857418 3300037418 Bacteria 833
317 Ga0395898_0085595 3300037466 Bacteria 3038
318 Ga0395898_0487680 3300037466 Bacteria 1172
319 Ga0395905_0040959 3300037471 Bacteria 4346
320 Ga0395905_0054059 3300037471 Bacteria 3758
321 Ga0395905_0473485 3300037471 Bacteria 1151
322 Ga0395905_0547302 3300037471 Bacteria 1059
323 Ga0395905_0551945 3300037471 Bacteria 1053
324 Ga0395905_0969075 3300037471 Bacteria 753
325 Ga0395905_1070535 3300037471 Bacteria 709
326 Ga0395901_0000209 3300038443 Bacteria 73635
327 Ga0395901_0108896 3300038443 Bacteria 2908
328 Ga0395901_0151883 3300038443 Bacteria 2433
329 Ga0395901_0538159 3300038443 Bacteria 1185
330 Ga0395901_0948795 3300038443 Bacteria 839
331 Ga0395901_1087880 3300038443 Bacteria 770
332 Ga0439461_0127847 3300041410 Bacteria 640
333 Ga0439465_0000473 3300041413 Bacteria 11914
334 Ga0451802_1477454 3300041460 Bacteria 580
335 Ga0439431_0002929 3300041997 Bacteria 3751
336 Ga0439445_0080359 3300042004 Bacteria 910
337 Ga0439445_0176685 3300042004 Bacteria 626
338 Ga0439432_038443 3300042006 Bacteria 1524
339 Ga0439432_067051 3300042006 Bacteria 1098
340 Ga0439452_012909 3300042010 Bacteria 2360
341 Ga0439457_098535 3300042014 Bacteria 680
342 Ga0439462_0017656 3300042015 Bacteria 1848
343 Ga0439434_0012005 3300042435 Bacteria 2559
344 Ga0453684_0262614 3300044712 Bacteria 1977
345 Ga0466957_0929329 3300044842 Bacteria 622
346 Ga0466958_1181529 3300045836 Bacteria 500
347 Ga0466967_0044220 3300045976 Bacteria 3861
348 Ga0495648_0363136 3300046524 Bacteria 658
349 Ga0495625_0623097 3300046660 Bacteria 645
350 Ga0495672_0052787 3300047320 Bacteria 2386
351 Ga0495681_0130102 3300047470 Bacteria 1072
352 Ga0496101_0287104 3300048904 Bacteria 1287
353 Ga0496106_1134857 3300048909 Bacteria 611
354 Ga0496107_0105567 3300048910 Bacteria 2068
355 Ga0496108_0056324 3300048911 Bacteria 3302
356 Ga0496109_0006235 3300048912 Bacteria 10029
357 Ga0496110_0010238 3300048913 Bacteria 7618
358 Ga0496111_0006386 3300048914 Bacteria 7650
359 Ga0496111_0871123 3300048914 Bacteria 649
360 Ga0496112_0044797 3300048915 Bacteria 4335
361 Ga0496112_0798188 3300048915 Bacteria 869
362 Ga0496113_0011474 3300048916 Bacteria 5913
363 Ga0496115_0000527 3300048918 Bacteria 29744
364 Ga0501292_000001 3300049515 Bacteria 211592
365 Ga0501294_000451 3300049517 Bacteria 4842
366 Ga0501297_005400 3300049520 Bacteria 1335
367 Ga0501300_034100 3300049523 Bacteria 755
368 Ga0501301_013842 3300049524 Bacteria 702
369 Ga0501047_0060285 3300049581 Bacteria 3662
370 Ga0501222_004333 3300049662 Bacteria 1926
371 Ga0501223_002794 3300049663 Bacteria 3826
372 Ga0501224_003940 3300049664 Bacteria 2092
373 Ga0501227_021246 3300049665 Bacteria 1496
374 Ga0501233_144736 3300049668 Bacteria 659
375 Ga0501235_019693 3300049669 Bacteria 1497
376 Ga0501259_003927 3300049688 Bacteria 2363
377 Ga0501261_000040 3300049690 Bacteria 25841
378 Ga0501245_002473 3300049708 Bacteria 2469
379 Ga0501279_000001 3300049775 Bacteria 299671
380 Ga0501280_000041 3300049776 Bacteria 37942
381 Ga0501281_00006 3300049777 Bacteria 33972
382 Ga0501282_000267 3300049778 Bacteria 6316
383 Ga0501283_002646 3300049779 Bacteria 2332
384 Ga0500643_001417 3300053087 Bacteria 13861
385 Ga0500643_005336 3300053087 Bacteria 5559
386 Ga0500643_007923 3300053087 Bacteria 4229
387 Ga0500641_0124368 3300053096 Bacteria 1112
388 Ga0500658_0000319 3300053134 Bacteria 21255
389 Ga0500658_0040400 3300053134 Bacteria 1868
390 Ga0500568_0088082 3300053139 Bacteria 1173
391 Ga0500604_0044421 3300053151 Bacteria 1353
392 Ga0466962_0255983 3300061719 Bacteria 861
393 2644125276 2643221622 Bacteria 4212502
394 Ga0065712_10460638
395 ARcpr5oldR_c002867
396 ARcpr5yngRDRAFT_c004521
397 ARCol0yngRDRAFT_1006803
398 JGI24740J21852_10014073
399 JGI24739J22299_10001357
400 JGI24739J22299_10080404
401 JGI24737J22298_10001192
402 JGI24737J22298_10019149
403 JGI24738J21930_10136173
404 JGI24744J21845_10094086
405 JGI24034J26672_10075389
406 JGI24742J22300_10029235
407 JGI25150J39212_1030589
408 JGI25153J46596_10018507
409 Ga0055537_1001025
410 Ga0055524_1000155
411 Ga0055528_1039866
412 Ga0055531_10010345
413 Ga0065165_1004623
414 Ga0070658_10009130
415 Ga0070658_10042633
416 Ga0070658_10055385
417 Ga0070658_10184221
418 Ga0070676_10012034
419 Ga0070683_101771349
420 Ga0070690_100446064
421 Ga0070670_100022850
422 Ga0070677_10543915
423 Ga0068869_100000037
424 Ga0070666_10004179
425 Ga0070666_10028508
426 Ga0070680_100111209
427 Ga0070680_100123720
428 Ga0070680_100180619
429 Ga0070680_100357870
430 Ga0068868_100003289
431 Ga0068868_101308174
432 Ga0070660_100014391
433 Ga0070660_100028480
434 Ga0070660_100042002
435 Ga0070660_100073510
436 Ga0070660_100084070
437 Ga0070660_100251458
438 Ga0070660_100994826
439 Ga0070689_100035844
440 Ga0070661_100004551
441 Ga0070661_100031115
442 Ga0070661_100080475
443 Ga0070661_100330919
444 Ga0070661_100920136
445 Ga0070692_10006327
446 Ga0070692_10291812
447 Ga0070668_100147108
448 Ga0070669_100000553
449 Ga0070675_100100684
450 Ga0070671_100017714
451 Ga0070671_100022777
452 Ga0070674_100185232
453 Ga0070674_100972041
454 Ga0070673_100000526
455 Ga0070673_100000617
456 Ga0070688_100144678
457 Ga0070659_100000226
458 Ga0070659_100036941
459 Ga0070659_100037447
460 Ga0070659_100308711
461 Ga0070659_100525184
462 Ga0070659_101169687
463 Ga0070667_100019471
464 Ga0070714_101981475
465 Ga0070663_100022206
466 Ga0070663_100053327
467 Ga0070663_100086772
468 Ga0070663_100179422
469 Ga0070663_101607682
470 Ga0070678_100009619
471 Ga0070678_101027387
472 Ga0070662_100000705
473 Ga0070662_100005911
474 Ga0070662_100014679
475 Ga0070662_100165533
476 Ga0070662_101120137
477 Ga0070681_10354433
478 Ga0068867_100000435
479 Ga0068867_100022258
480 Ga0068867_100159747
481 Ga0070679_100126541
482 Ga0070679_100133819
483 Ga0070679_100391145
484 Ga0070679_100665965
485 Ga0070679_101229027
486 Ga0070679_101734639
487 Ga0070684_102182504
488 Ga0068853_100162914
489 Ga0068853_100917539
490 Ga0070672_100001515
491 Ga0070672_100121709
492 Ga0070696_101326153
493 Ga0070693_100413054
494 Ga0070665_100958728
495 Ga0070665_101563898
496 Ga0068855_100036875
497 Ga0068855_100047240
498 Ga0068855_101263463
499 Ga0070664_100014984
500 Ga0070664_100105316
501 Ga0068857_100004366
502 Ga0068857_101113858
503 Ga0068854_100453425
504 Ga0068852_100002226
505 Ga0068852_100008645
506 Ga0068852_100729152
507 Ga0068852_101361824
508 Ga0068852_101422659
509 Ga0068859_100003734
510 Ga0068859_100224934
511 Ga0068864_100003081
512 Ga0068864_100003875
513 Ga0068861_100658011
514 Ga0068851_10035142
515 Ga0068851_10245207
516 Ga0068851_10597003
517 Ga0068870_10527269
518 Ga0068863_100007156
519 Ga0068863_100079745
520 Ga0068863_100202501
521 Ga0068858_100013456
522 Ga0068858_100074051
523 Ga0068860_100003826
524 Ga0068860_100707241
525 Ga0068862_100442606
526 Ga0097621_100033842
527 Ga0097621_101252651
528 Ga0068871_100081800
529 Ga0068871_100752849
530 Ga0068865_100003562
531 Ga0097620_100003734
532 Ga0097620_100224937
533 Ga0097620_102094521
534 Ga0105245_10003832
535 Ga0105243_10073259
536 Ga0105243_12386966
537 Ga0105248_10004678
538 Ga0105248_10054398
539 Ga0105238_10401118
540 Ga0105239_10229432
541 Ga0157373_10001808
542 Ga0157373_10211741
543 Ga0157373_10637930
544 Ga0157371_10004280
545 Ga0157371_10007134
546 Ga0157371_10063408
547 Ga0157371_10112265
548 Ga0157371_10325232
549 Ga0157371_10375609
550 Ga0157371_10382759
551 Ga0157371_11067476
552 Ga0157370_10023646
553 Ga0157370_10318743
554 Ga0157370_10393226
555 Ga0157370_10535983
556 Ga0157374_10008086
557 Ga0157378_10008452
558 Ga0163162_10037511
559 Ga0163162_10189173
560 Ga0163162_10781652
561 Ga0157372_10035290
562 Ga0157372_11947302
563 Ga0157375_10001267
564 Ga0157375_12370361
565 Ga0163163_10078901
566 Ga0157377_10402378
567 Ga0157377_10547437
568 Ga0207425_1021830
569 Ga0209026_1009917
570 Ga0209565_1000011
571 Ga0209673_1001365
572 Ga0209675_1013455
573 Ga0209564_1035820
574 Ga0209758_1005915
575 Ga0209050_1009422
576 Ga0209256_1000016
577 Ga0209257_1002963
578 Ga0207697_10002743
579 Ga0207697_10351607
580 Ga0207656_10016046
581 Ga0207656_10345674
582 Ga0207688_10007911
583 Ga0207680_10015529
584 Ga0207647_10000106
585 Ga0207647_10292610
586 Ga0207647_10536934
587 Ga0207643_10025544
588 Ga0207705_10001009
589 Ga0207705_10002265
590 Ga0207705_10005335
591 Ga0207705_10039814
592 Ga0207705_10122722
593 Ga0207705_10127189
594 Ga0207705_10287673
595 Ga0207705_10599900
596 Ga0207705_10608102
597 Ga0207705_10680024
598 Ga0207705_11075830
599 Ga0207707_10134548
600 Ga0207707_10155974
601 Ga0207660_10116575
602 Ga0207657_10003988
603 Ga0207657_10004680
604 Ga0207657_10008735
605 Ga0207657_10011147
606 Ga0207657_10013674
607 Ga0207657_10145949
608 Ga0207657_10181816
609 Ga0207657_10399187
610 Ga0207649_10013628
611 Ga0207649_10038811
612 Ga0207649_10157422
613 Ga0207649_10323540
614 Ga0207649_10968627
615 Ga0207652_10312602
616 Ga0207652_10478452
617 Ga0207652_10564330
618 Ga0207652_10626034
619 Ga0207681_10075320
620 Ga0207681_10461024
621 Ga0207681_10830476
622 Ga0207650_10018261
623 Ga0207650_10209668
624 Ga0207659_10032506
625 Ga0207687_10005376
626 Ga0207644_10000614
627 Ga0207644_10104394
628 Ga0207690_10005022
629 Ga0207690_10045661
630 Ga0207690_11173311
631 Ga0207706_10000341
632 Ga0207706_10003248
633 Ga0207706_10021001
634 Ga0207706_10092930
635 Ga0207709_11110668
636 Ga0207670_10074587
637 Ga0207669_10155385
638 Ga0207704_10005443
639 Ga0207691_10003928
640 Ga0207691_10007087
641 Ga0207711_10002755
642 Ga0207711_10005061
643 Ga0207689_10001967
644 Ga0207679_10097676
645 Ga0207679_10146136
646 Ga0207679_10527217
647 Ga0207679_10568083
648 Ga0207679_11000760
649 Ga0207679_11515046
650 Ga0207667_10033268
651 Ga0207667_10250464
652 Ga0207667_10497979
653 Ga0207667_11373506
654 Ga0207651_10000825
655 Ga0207651_10000915
656 Ga0207640_10003645
657 Ga0207640_10104329
658 Ga0207640_11528384
659 Ga0207658_10013873
660 Ga0207658_10020664
661 Ga0207677_10007256
662 Ga0207703_10043628
663 Ga0207703_10083700
664 Ga0207639_10045692
665 Ga0207639_10470178
666 Ga0207678_10007027
667 Ga0207678_10097997
668 Ga0207678_10109798
669 Ga0207678_10193770
670 Ga0207678_11115709
671 Ga0207678_11332774
672 Ga0207678_11658502
673 Ga0207641_10073988
674 Ga0207641_10197987
675 Ga0207648_10002130
676 Ga0207648_10009403
677 Ga0207648_10196469
678 Ga0207676_10001223
679 Ga0207676_10001969
680 Ga0207674_10005518
681 Ga0207674_11114607
682 Ga0207675_100690309
683 Ga0207683_10011928
684 Ga0207683_11038747
685 Ga0207698_10067148
686 Ga0207698_10071760
687 Ga0207698_10479230
688 Ga0207698_11157531
689 Ga0209974_10166857
690 Ga0268266_10282199
691 Ga0268266_11241932
692 Ga0268265_10676070
693 Ga0268265_10867014
694 Ga0268264_10003563
695 Ga0307408_100143150
696 Ga0307408_100267956
697 Ga0307408_100288778
698 Ga0307407_10078588
699 Ga0307412_10649480
700 Ga0307409_100292097
701 Ga0307416_100755186
702 Ga0307416_103146837
703 Ga0307415_100418169
704 Ga0395899_0182737
705 Ga0395900_0000364
706 Ga0395900_0014663
707 Ga0395900_0085539
708 Ga0395900_0537262
709 Ga0395900_0857418
710 Ga0395898_0085595
711 Ga0395898_0487680
712 Ga0395905_0040959
713 Ga0395905_0054059
714 Ga0395905_0473485
715 Ga0395905_0547302
716 Ga0395905_0551945
717 Ga0395905_0969075
718 Ga0395905_1070535
719 Ga0395901_0000209
720 Ga0395901_0108896
721 Ga0395901_0151883
722 Ga0395901_0538159
723 Ga0395901_0948795
724 Ga0395901_1087880
725 Ga0439461_0127847
726 Ga0439465_0000473
727 Ga0451802_1477454
728 Ga0439431_0002929
729 Ga0439445_0080359
730 Ga0439445_0176685
731 Ga0439432_038443
732 Ga0439432_067051
733 Ga0439452_012909
734 Ga0439457_098535
735 Ga0439462_0017656
736 Ga0439434_0012005
737 Ga0453684_0262614
738 Ga0466957_0929329
739 Ga0466958_1181529
740 Ga0466967_0044220
741 Ga0495648_0363136
742 Ga0495625_0623097
743 Ga0495672_0052787
744 Ga0495681_0130102
745 Ga0496101_0287104
746 Ga0496106_1134857
747 Ga0496107_0105567
748 Ga0496108_0056324
749 Ga0496109_0006235
750 Ga0496110_0010238
751 Ga0496111_0006386
752 Ga0496111_0871123
753 Ga0496112_0044797
754 Ga0496112_0798188
755 Ga0496113_0011474
756 Ga0496115_0000527
757 Ga0501292_000001
758 Ga0501294_000451
759 Ga0501297_005400
760 Ga0501300_034100
761 Ga0501301_013842
762 Ga0501047_0060285
763 Ga0501222_004333
764 Ga0501223_002794
765 Ga0501224_003940
766 Ga0501227_021246
767 Ga0501233_144736
768 Ga0501235_019693
769 Ga0501259_003927
770 Ga0501261_000040
771 Ga0501245_002473
772 Ga0501279_000001
773 Ga0501280_000041
774 Ga0501281_00006
775 Ga0501282_000267
776 Ga0501283_002646
777 Ga0500643_001417
778 Ga0500643_005336
779 Ga0500643_007923
780 Ga0500641_0124368
781 Ga0500658_0000319
782 Ga0500658_0040400
783 Ga0500568_0088082
784 Ga0500604_0044421
785 Ga0466962_0255983
786 2644125276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

61

159

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7002 14 133
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.6629 14 133
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.6306 11 137
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.5794 11 137
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.5788 19 137
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6956 14 133 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6648 14 133 3.30.2010.20
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.6552 41 135 3.40.390.30
af_Q9H040_45_153_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.655 20 121 3.30.2010.10
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6528 110 137 3.20.20.140
ID Description Score Start End GO Terms
AF-J2D472-F1-model_v4 deleted 0.9741 23 137
AF-A0A5B8S2P5-F1-model_v4 Metallopeptidase family protein 0.9696 13 138
AF-A0A1H7RWQ5-F1-model_v4 Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain 0.9668 11 137 GO:0006508
GO:0008237
AF-A0A196MS43-F1-model_v4 Neutral zinc metallopeptidase 0.9617 9 137
AF-A0A848SP86-F1-model_v4 Metallopeptidase family protein 0.9615 23 138

Map