F432377

General Info

Members Datasets Scaffolds Average Seq Length
392 281 784 243

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0084660|Ga0466969_0084660_624_1448
Length 274
Sequence MQKKECRHLPKKERRFSVMSESSTNADQPERDCIVVTGASRGIGAAIAHALAAQGFHVACLSRSGGAPAGAAADIAEHWSLWKADVTQPASLAAVFRQIESEGWRIAGLVNNAGMHTDGVSAELPLEEWQRVMDANATSVLSACQAAYPHLVAGGGGVIVNIGSFFDKLGVKRNLAYCASKAAVGAITRCLAVEWAGKGIRVINVAPGYIETELNADVMVPGGPLRTYLDKRIPRGQPGTAADVGALVSALFSQAGNFLTGETIYIDGAQGIAH

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
122 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
259 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
263 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
269 2738541277 Variovorax sp. GV051 Isolate Unclassified
270 2738543019 Variovorax sp. GV040 Isolate Unclassified
271 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
272 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
273 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
274 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
275 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
276 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
277 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
278 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
279 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
280 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
281 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0
Isolates 3.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 1.28
Rhizoplane 2.3
Rhizosphere 86.99
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0084660 3300044656 Bacteria 1509
2 JGI25151J46595_10013370 3300003187 Bacteria 3695
3 JGI25406J46586_10000117 3300003203 Bacteria 34556
4 rootL2_10287079 3300003322 Bacteria 2380
5 rootH1_10133569 3300003323 Bacteria 8938
6 Ga0055526_1001091 3300003771 Bacteria 19781
7 Ga0055534_1000434 3300003784 Bacteria 24859
8 Ga0065712_10198565 3300005290 Bacteria 1118
9 Ga0070658_10077426 3300005327 Bacteria 2728
10 Ga0070683_100010694 3300005329 Bacteria 7890
11 Ga0070670_100005071 3300005331 Bacteria 11079
12 Ga0070670_100007175 3300005331 Bacteria 9437
13 Ga0068869_100053509 3300005334 Bacteria 2936
14 Ga0068869_100067814 3300005334 Bacteria 2633
15 Ga0070666_10134760 3300005335 Bacteria 1718
16 Ga0070682_100424663 3300005337 Unclassified 1011
17 Ga0068868_100007061 3300005338 Bacteria 7982
18 Ga0068868_100063954 3300005338 Bacteria 2919
19 Ga0070660_100244838 3300005339 Bacteria 1461
20 Ga0070691_10038655 3300005341 Bacteria 2253
21 Ga0070687_100039263 3300005343 Bacteria 2378
22 Ga0070668_100171348 3300005347 Bacteria 1767
23 Ga0070675_100435973 3300005354 Bacteria 1173
24 Ga0070671_100037196 3300005355 Bacteria 4036
25 Ga0070671_100107884 3300005355 Bacteria 2338
26 Ga0070671_100121448 3300005355 Bacteria 2199
27 Ga0070674_100111716 3300005356 Bacteria 2007
28 Ga0070673_100016395 3300005364 Bacteria 5237
29 Ga0070673_100039198 3300005364 Bacteria 3624
30 Ga0070688_100435165 3300005365 Bacteria 978
31 Ga0070667_100067568 3300005367 Bacteria 3039
32 Ga0070667_100452144 3300005367 Bacteria 1174
33 Ga0070701_10011450 3300005438 Bacteria 3967
34 Ga0070701_10284359 3300005438 Bacteria 1011
35 Ga0070700_100124306 3300005441 Bacteria 1733
36 Ga0070708_100152710 3300005445 Bacteria 2148
37 Ga0070663_100087212 3300005455 Bacteria 2306
38 Ga0070678_100097201 3300005456 Bacteria 2273
39 Ga0070662_100104046 3300005457 Unclassified 2154
40 Ga0070681_10072910 3300005458 Bacteria 3396
41 Ga0068867_100109699 3300005459 Bacteria 2119
42 Ga0070706_100030160 3300005467 Bacteria 4995
43 Ga0070707_100260249 3300005468 Bacteria 1688
44 Ga0070672_100033689 3300005543 Bacteria 3881
45 Ga0070672_100089640 3300005543 Bacteria 2478
46 Ga0070695_100030554 3300005545 Bacteria 3356
47 Ga0070695_100183449 3300005545 Bacteria 1484
48 Ga0070664_100049950 3300005564 Bacteria 3538
49 Ga0070664_100334341 3300005564 Bacteria 1375
50 Ga0068854_100121174 3300005578 Bacteria 1986
51 Ga0068854_100621061 3300005578 Bacteria 925
52 Ga0068852_100006409 3300005616 Bacteria 8503
53 Ga0068859_100939341 3300005617 Bacteria 948
54 Ga0068864_100021001 3300005618 Bacteria 5468
55 Ga0068864_100108257 3300005618 Bacteria 2473
56 Ga0068864_100150080 3300005618 Bacteria 2110
57 Ga0068864_100212236 3300005618 Unclassified 1783
58 Ga0068861_100179647 3300005719 Bacteria 1760
59 Ga0068851_10029283 3300005834 Bacteria 2726
60 Ga0068863_100098089 3300005841 Bacteria 2783
61 Ga0068863_100133223 3300005841 Bacteria 2373
62 Ga0068858_100079248 3300005842 Bacteria 3052
63 Ga0068860_100320817 3300005843 Bacteria 1520
64 Ga0081455_10000076 3300005937 Bacteria 105979
65 Ga0081455_10000371 3300005937 Bacteria 59407
66 Ga0081540_1000604 3300005983 Bacteria 34243
67 Ga0081540_1003531 3300005983 Bacteria 12325
68 Ga0081540_1052460 3300005983 Bacteria 2007
69 Ga0081539_10000922 3300005985 Bacteria 55364
70 Ga0075365_10151157 3300006038 Bacteria 1615
71 Ga0075364_10000545 3300006051 Bacteria 19227
72 Ga0075364_10002318 3300006051 Bacteria 10675
73 Ga0075432_10162243 3300006058 Bacteria 865
74 Ga0070716_100080228 3300006173 Bacteria 1945
75 Ga0070712_100290298 3300006175 Bacteria 1320
76 Ga0097621_100033590 3300006237 Bacteria 4087
77 Ga0097621_100085713 3300006237 Bacteria 2627
78 Ga0068871_100081402 3300006358 Bacteria 2682
79 Ga0068871_100251226 3300006358 Bacteria 1540
80 Ga0068871_100368731 3300006358 Bacteria 1273
81 Ga0075430_100012694 3300006846 Bacteria 7177
82 Ga0075431_100009236 3300006847 Bacteria 9896
83 Ga0075433_10003530 3300006852 Bacteria 12068
84 Ga0075434_100000906 3300006871 Bacteria 23754
85 Ga0068865_100033787 3300006881 Bacteria 3426
86 Ga0097620_100939392 3300006931 Bacteria 948
87 Ga0099823_1008331 3300006944 Bacteria 10553
88 Ga0075435_100136906 3300007076 Bacteria 2052
89 Ga0105240_10553277 3300009093 Bacteria 1273
90 Ga0111539_10010305 3300009094 Bacteria 11766
91 Ga0111539_10057362 3300009094 Bacteria 4625
92 Ga0111539_10176053 3300009094 Bacteria 2499
93 Ga0111539_10610680 3300009094 Bacteria 1270
94 Ga0111539_11399264 3300009094 Bacteria 811
95 Ga0105245_10174305 3300009098 Bacteria 2050
96 Ga0105245_10193520 3300009098 Unclassified 1949
97 Ga0105242_10033880 3300009176 Bacteria 4093
98 Ga0105249_10058213 3300009553 Bacteria 3542
99 Ga0105249_10427360 3300009553 Bacteria 1359
100 Ga0105246_10373085 3300011119 Bacteria 1176
101 Ga0157374_10011741 3300013296 Bacteria 7599
102 Ga0157374_10070414 3300013296 Bacteria 3296
103 Ga0157378_10115739 3300013297 Bacteria 2464
104 Ga0163162_10008575 3300013306 Bacteria 9963
105 Ga0157375_10084693 3300013308 Bacteria 3219
106 Ga0157375_10250850 3300013308 Bacteria 1930
107 Ga0163163_10607359 3300014325 Bacteria 1157
108 Ga0157380_10104810 3300014326 Bacteria 2363
109 Ga0157380_10128967 3300014326 Bacteria 2155
110 Ga0157380_10820405 3300014326 Bacteria 949
111 Ga0182008_10022920 3300014497 Bacteria 3195
112 Ga0157377_10134849 3300014745 Bacteria 1512
113 Ga0157376_10148080 3300014969 Bacteria 2114
114 Ga0157376_10459084 3300014969 Bacteria 1244
115 Ga0182007_10019160 3300015262 Bacteria 2465
116 Ga0163161_10211420 3300017792 Bacteria 1498
117 Ga0209646_1021758 3300025246 Bacteria 919
118 Ga0209759_1001780 3300025256 Bacteria 10947
119 Ga0209759_1024541 3300025256 Bacteria 1304
120 Ga0209675_1000090 3300025291 Bacteria 146665
121 Ga0209025_1001275 3300025294 Bacteria 34648
122 Ga0209564_1000985 3300025295 Bacteria 35696
123 Ga0207697_10088817 3300025315 Bacteria 1308
124 Ga0207682_10003988 3300025893 Bacteria 6285
125 Ga0207682_10143459 3300025893 Bacteria 1073
126 Ga0207688_10199279 3300025901 Bacteria 1200
127 Ga0207645_10015403 3300025907 Bacteria 5080
128 Ga0207643_10008262 3300025908 Bacteria 5588
129 Ga0207684_10616061 3300025910 Unclassified 926
130 Ga0207707_10063152 3300025912 Bacteria 3223
131 Ga0207695_10420202 3300025913 Bacteria 1221
132 Ga0207663_10513598 3300025916 Bacteria 932
133 Ga0207662_10014683 3300025918 Bacteria 4397
134 Ga0207646_10062913 3300025922 Bacteria 3312
135 Ga0207650_10003147 3300025925 Bacteria 11368
136 Ga0207650_10242758 3300025925 Bacteria 1456
137 Ga0207659_10003404 3300025926 Bacteria 9536
138 Ga0207659_10049604 3300025926 Bacteria 2978
139 Ga0207644_10159291 3300025931 Bacteria 1753
140 Ga0207644_10172728 3300025931 Bacteria 1688
141 Ga0207706_10019061 3300025933 Bacteria 6172
142 Ga0207706_10136953 3300025933 Unclassified 2154
143 Ga0207709_10171874 3300025935 Bacteria 1522
144 Ga0207670_10283815 3300025936 Bacteria 1291
145 Ga0207669_10026643 3300025937 Bacteria 3149
146 Ga0207691_10103567 3300025940 Bacteria 2538
147 Ga0207691_10133997 3300025940 Bacteria 2187
148 Ga0207689_10013309 3300025942 Bacteria 7018
149 Ga0207679_10040574 3300025945 Bacteria 3333
150 Ga0207651_10020640 3300025960 Bacteria 3982
151 Ga0207651_10151528 3300025960 Bacteria 1805
152 Ga0207668_10033386 3300025972 Bacteria 3409
153 Ga0207640_10166934 3300025981 Bacteria 1635
154 Ga0207658_10421874 3300025986 Bacteria 1176
155 Ga0207677_10052075 3300026023 Bacteria 2779
156 Ga0207678_10033372 3300026067 Bacteria 4485
157 Ga0207678_10404832 3300026067 Bacteria 1182
158 Ga0207708_10090651 3300026075 Bacteria 2356
159 Ga0207708_10544786 3300026075 Bacteria 978
160 Ga0207641_10093733 3300026088 Bacteria 2632
161 Ga0207641_10274917 3300026088 Bacteria 1582
162 Ga0207648_10109163 3300026089 Bacteria 2429
163 Ga0207648_10134551 3300026089 Bacteria 2177
164 Ga0207676_10146523 3300026095 Bacteria 2028
165 Ga0207676_10200764 3300026095 Bacteria 1762
166 Ga0207676_10244111 3300026095 Unclassified 1613
167 Ga0207676_10270544 3300026095 Bacteria 1538
168 Ga0207675_100120839 3300026118 Bacteria 2478
169 Ga0207675_100181709 3300026118 Bacteria 2014
170 Ga0207683_10004517 3300026121 Bacteria 12005
171 Ga0207683_10099743 3300026121 Bacteria 2592
172 Ga0209389_1000004 3300027296 Bacteria 263759
173 Ga0209969_1002286 3300027360 Bacteria 2642
174 Ga0209969_1007670 3300027360 Bacteria 1525
175 Ga0209489_100172 3300027361 Bacteria 100396
176 Ga0209967_1002197 3300027364 Bacteria 2527
177 Ga0209995_1009133 3300027471 Bacteria 1602
178 Ga0209966_1024184 3300027695 Bacteria 1198
179 Ga0209966_1057893 3300027695 Bacteria 833
180 Ga0209974_10004620 3300027876 Bacteria 4900
181 Ga0207428_10232665 3300027907 Bacteria 1379
182 Ga0268265_10535070 3300028380 Bacteria 1110
183 Ga0268264_10260320 3300028381 Bacteria 1616
184 Ga0265318_10002631 3300028577 Bacteria 9473
185 Ga0307511_10019215 3300030521 Bacteria 6506
186 Ga0265330_10009111 3300031235 Bacteria 4731
187 Ga0265332_10018165 3300031238 Bacteria 3101
188 Ga0265320_10036359 3300031240 Bacteria 2489
189 Ga0265339_10001315 3300031249 Bacteria 18593
190 Ga0265331_10052176 3300031250 Bacteria 1954
191 Ga0265316_10009185 3300031344 Bacteria 9107
192 Ga0307509_10000004 3300031507 Bacteria 535507
193 Ga0307408_100084164 3300031548 Bacteria 2385
194 Ga0265313_10144836 3300031595 Bacteria 1019
195 Ga0316575_10022074 3300031665 Bacteria 2454
196 Ga0316579_10000932 3300031691 Bacteria 10169
197 Ga0265342_10020689 3300031712 Bacteria 4214
198 Ga0316578_10002018 3300031728 Bacteria 8641
199 Ga0307416_101564584 3300032002 Bacteria 765
200 Ga0307414_10224692 3300032004 Bacteria 1544
201 Ga0307411_10868838 3300032005 Bacteria 799
202 Ga0316583_10003229 3300032133 Bacteria 5737
203 Ga0316583_10127071 3300032133 Bacteria 888
204 Ga0307510_10000001 3300033180 Bacteria 1172244
205 Ga0307510_10006484 3300033180 Bacteria 13961
206 Ga0373950_0004326 3300034818 Bacteria 2077
207 Ga0373928_0066843 3300035084 Bacteria 880
208 Ga0373949_0007502 3300035090 Bacteria 2387
209 Ga0373951_0012603 3300035091 Bacteria 1901
210 Ga0373952_0004800 3300035092 Bacteria 2460
211 Ga0373952_0024162 3300035092 Bacteria 1303
212 Ga0373939_0053470 3300035114 Bacteria 1261
213 Ga0373961_0004583 3300035241 Bacteria 3337
214 Ga0373962_0002143 3300035242 Bacteria 4709
215 Ga0373931_0000378 3300035691 Bacteria 18340
216 Ga0373931_0002381 3300035691 Bacteria 8319
217 Ga0316582_0001123 3300036647 Bacteria 11363
218 Ga0395905_0046100 3300037471 Bacteria 4088
219 Ga0395905_0174171 3300037471 Bacteria 2020
220 Ga0316581_0054288 3300037588 Bacteria 1228
221 Ga0395901_0017014 3300038443 Bacteria 7411
222 Ga0436360_0189068 3300039438 Bacteria 2561
223 Ga0450916_000689 3300042530 Bacteria 3073
224 Ga0451577_0108041 3300042876 Bacteria 2487
225 Ga0451577_0270554 3300042876 Unclassified 1539
226 Ga0451577_0335786 3300042876 Bacteria 1371
227 Ga0451577_0882751 3300042876 Bacteria 806
228 Ga0466969_0005468 3300044656 Bacteria 6757
229 Ga0466969_0087553 3300044656 Bacteria 1479
230 Ga0466972_0090720 3300044658 Bacteria 1449
231 Ga0453683_0109115 3300044673 Bacteria 1740
232 Ga0466965_0002246 3300044683 Bacteria 8140
233 Ga0466966_0001889 3300044684 Bacteria 13599
234 Ga0466966_0015433 3300044684 Bacteria 5049
235 Ga0466966_0018709 3300044684 Bacteria 4563
236 Ga0466961_0088926 3300044693 Bacteria 1951
237 Ga0466963_0204570 3300044694 Bacteria 1381
238 Ga0466964_0000521 3300044706 Bacteria 12008
239 Ga0453684_0209650 3300044712 Unclassified 2266
240 Ga0466971_0075829 3300044719 Bacteria 1529
241 Ga0466970_0001263 3300044765 Bacteria 12239
242 Ga0466970_0042992 3300044765 Bacteria 2403
243 Ga0466970_0057996 3300044765 Bacteria 2071
244 Ga0466957_0123926 3300044842 Bacteria 1649
245 Ga0466959_0002081 3300045049 Bacteria 12665
246 Ga0466959_0010594 3300045049 Bacteria 6600
247 Ga0466959_0147861 3300045049 Bacteria 1657
248 Ga0451576_0160296 3300045051 Bacteria 2347
249 Ga0466958_0378822 3300045836 Bacteria 912
250 Ga0495603_0014895 3300046455 Bacteria 4703
251 Ga0495590_0021836 3300046457 Bacteria 2267
252 Ga0495629_0000295 3300046459 Bacteria 42788
253 Ga0495638_0000808 3300046460 Bacteria 33041
254 Ga0495653_0083900 3300046463 Bacteria 2348
255 Ga0495650_0023164 3300046471 Bacteria 2960
256 Ga0495580_0013065 3300046472 Bacteria 6356
257 Ga0495580_0020564 3300046472 Bacteria 4883
258 Ga0495580_0027163 3300046472 Bacteria 4166
259 Ga0495662_0040979 3300046476 Bacteria 2236
260 Ga0495584_0063347 3300046491 Bacteria 1859
261 Ga0495594_0052147 3300046499 Bacteria 2252
262 Ga0495583_0000255 3300046506 Bacteria 88289
263 Ga0495628_0243765 3300046516 Bacteria 1344
264 Ga0495630_0000342 3300046517 Bacteria 36980
265 Ga0495666_0001023 3300046526 Bacteria 13252
266 Ga0495666_0006515 3300046526 Bacteria 5877
267 Ga0495666_0013070 3300046526 Bacteria 4137
268 Ga0495642_0016387 3300046528 Bacteria 2888
269 Ga0495652_0339233 3300046529 Bacteria 1080
270 Ga0495665_0006665 3300046531 Bacteria 6231
271 Ga0495665_0011019 3300046531 Bacteria 4891
272 Ga0495665_0140651 3300046531 Bacteria 1261
273 Ga0495645_0002096 3300046543 Bacteria 13544
274 Ga0495667_0231495 3300046559 Bacteria 1178
275 Ga0495656_0119594 3300046615 Bacteria 1242
276 Ga0495625_0016458 3300046660 Bacteria 5820
277 Ga0495625_0020934 3300046660 Bacteria 5042
278 Ga0495625_0041987 3300046660 Bacteria 3326
279 Ga0495659_0177667 3300046664 Bacteria 866
280 Ga0495599_0006749 3300046678 Bacteria 6932
281 Ga0495658_0352665 3300046683 Bacteria 935
282 Ga0495658_0422728 3300046683 Bacteria 850
283 Ga0495589_0061277 3300046794 Bacteria 1847
284 Ga0495604_0001617 3300047317 Bacteria 18571
285 Ga0495604_0076622 3300047317 Bacteria 2515
286 Ga0495604_0090482 3300047317 Bacteria 2272
287 Ga0495683_0044784 3300047323 Bacteria 2225
288 Ga0495687_000170 3300047443 Bacteria 96886
289 Ga0495681_0000936 3300047470 Bacteria 22511
290 Ga0495602_0196072 3300048088 Bacteria 1544
291 Ga0495614_0180399 3300048089 Bacteria 950
292 Ga0496101_0023499 3300048904 Bacteria 4260
293 Ga0496102_0711248 3300048905 Bacteria 927
294 Ga0496104_0294752 3300048907 Bacteria 1535
295 Ga0496108_0357329 3300048911 Bacteria 1275
296 Ga0496110_0139414 3300048913 Unclassified 2192
297 Ga0496110_0229353 3300048913 Bacteria 1689
298 Ga0496114_0038483 3300048917 Bacteria 3958
299 Ga0496114_0150594 3300048917 Bacteria 2018
300 Ga0496115_0469188 3300048918 Bacteria 1015
301 Ga0466983_0005887 3300048986 Bacteria 8594
302 Ga0495682_0000459 3300049460 Bacteria 28107
303 Ga0501031_0019553 3300049568 Bacteria 4411
304 Ga0501032_0000013 3300049569 Bacteria 185070
305 Ga0501033_0000427 3300049570 Bacteria 40245
306 Ga0501033_0005939 3300049570 Bacteria 9583
307 Ga0501033_0025697 3300049570 Bacteria 4437
308 Ga0501033_0408560 3300049570 Unclassified 946
309 Ga0501034_0000054 3300049571 Bacteria 206373
310 Ga0501034_0000569 3300049571 Bacteria 58487
311 Ga0501036_0000031 3300049572 Bacteria 92249
312 Ga0501036_0000562 3300049572 Bacteria 26673
313 Ga0501037_0000096 3300049573 Bacteria 81773
314 Ga0501037_0003055 3300049573 Bacteria 12139
315 Ga0501037_0004290 3300049573 Bacteria 10344
316 Ga0501037_0217362 3300049573 Bacteria 1346
317 Ga0501038_0000018 3300049574 Bacteria 155191
318 Ga0501038_0006870 3300049574 Bacteria 10511
319 Ga0501039_0000018 3300049575 Bacteria 176187
320 Ga0501039_0000095 3300049575 Bacteria 61547
321 Ga0501039_0221165 3300049575 Bacteria 1489
322 Ga0501041_0091495 3300049577 Bacteria 1878
323 Ga0501043_0000014 3300049579 Bacteria 184687
324 Ga0501043_0000331 3300049579 Bacteria 42804
325 Ga0501043_0053480 3300049579 Bacteria 3171
326 Ga0501043_0227695 3300049579 Bacteria 1441
327 Ga0501046_0027880 3300049580 Bacteria 4604
328 Ga0501046_0043047 3300049580 Bacteria 3597
329 Ga0501047_0046096 3300049581 Bacteria 4214
330 Ga0501048_0502770 3300049582 Bacteria 869
331 Ga0501068_0122988 3300049584 Bacteria 1619
332 Ga0501069_0077894 3300049585 Bacteria 1864
333 Ga0501070_0122896 3300049586 Bacteria 2145
334 Ga0501071_0315929 3300049587 Bacteria 1186
335 Ga0501073_0450034 3300049589 Bacteria 890
336 Ga0501074_0237023 3300049590 Bacteria 1298
337 Ga0501075_0154217 3300049591 Bacteria 1751
338 Ga0501076_0039753 3300049592 Bacteria 3694
339 Ga0501076_0354931 3300049592 Bacteria 1204
340 Ga0501079_0012660 3300049741 Bacteria 6444
341 Ga0501080_0036137 3300049742 Bacteria 4612
342 Ga0501081_0092464 3300049743 Bacteria 2128
343 Ga0501081_0339989 3300049743 Bacteria 1105
344 Ga0501081_0504345 3300049743 Bacteria 902
345 Ga0501035_0000019 3300049822 Bacteria 241152
346 Ga0501035_0000204 3300049822 Bacteria 72214
347 Ga0501035_0084987 3300049822 Bacteria 2790
348 Ga0501035_0103252 3300049822 Bacteria 2501
349 Ga0501035_0134446 3300049822 Bacteria 2154
350 Ga0501044_0003562 3300049823 Bacteria 17529
351 Ga0501044_0006006 3300049823 Bacteria 13414
352 Ga0501044_0138519 3300049823 Bacteria 2423
353 Ga0501045_0126711 3300049824 Bacteria 1897
354 Ga0501045_0156995 3300049824 Bacteria 1693
355 nmdc:mga00v17_435_c1 3300050491 Bacteria 23450
356 nmdc:mga00v17_67613_c1 3300050491 Bacteria 2208
357 nmdc:mga0yw44_136189_c1 3300050492 Bacteria 1240
358 nmdc:mga0qj67_27873_c1 3300050509 Bacteria 4380
359 nmdc:mga06r32_21726_c1 3300050510 Bacteria 5926
360 nmdc:mga08y16_69813_c1 3300050511 Bacteria 3662
361 nmdc:mga0n895_3297_c1 3300050512 Bacteria 12959
362 nmdc:mga0n895_747455_c1 3300050512 Bacteria 971
363 nmdc:mga0rr50_11573_c1 3300050513 Bacteria 5655
364 nmdc:mga0a205_13584_c1 3300050515 Bacteria 7586
365 Ga0495595_0058860 3300053084 Bacteria 1795
366 Ga0495619_0010221 3300053085 Bacteria 5911
367 Ga0500607_016571 3300053121 Bacteria 4223
368 Ga0500608_004608 3300053122 Bacteria 5365
369 Ga0500559_0000072 3300053136 Bacteria 79568
370 Ga0500568_0006208 3300053139 Bacteria 6034
371 Ga0500604_0007896 3300053151 Bacteria 2823
372 Ga0500624_013862 3300053157 Bacteria 1212
373 Ga0501084_0018775 3300054114 Bacteria 5757
374 Ga0501084_0747415 3300054114 Bacteria 824
375 Ga0501082_0008032 3300060353 Bacteria 9109
376 Ga0466962_0003754 3300061719 Bacteria 7252
377 Ga0530510_0139284 3300061734 Bacteria 1787
378 2644029537 2643221603 Bacteria 6147767
379 2644030878 2643221603 Bacteria 6147767
380 2738723567 2738541277 Bacteria 7458140
381 2739284298 2738543019 Bacteria 7459457
382 2739613666 2739367655 Bacteria 4051151
383 2758639543 2758568016 Bacteria 5645291
384 2792834511 2791355137 Bacteria 9654227
385 2881166223 2881161766 Bacteria 7127907
386 2887377482 2887375801 Bacteria 5334027
387 2889916910 2889914905 Bacteria 5702301
388 2897808532 2897803580 Bacteria 7000062
389 2900641493 2900634093 Bacteria 10263517
390 2939636778 2939631187 Bacteria 6118131
391 2977979808 2977971508 Bacteria 7472917
392 8039102189 8039098773 Bacteria 6602928
393 Ga0466969_0084660
394 JGI25151J46595_10013370
395 JGI25406J46586_10000117
396 rootL2_10287079
397 rootH1_10133569
398 Ga0055526_1001091
399 Ga0055534_1000434
400 Ga0065712_10198565
401 Ga0070658_10077426
402 Ga0070683_100010694
403 Ga0070670_100005071
404 Ga0070670_100007175
405 Ga0068869_100053509
406 Ga0068869_100067814
407 Ga0070666_10134760
408 Ga0070682_100424663
409 Ga0068868_100007061
410 Ga0068868_100063954
411 Ga0070660_100244838
412 Ga0070691_10038655
413 Ga0070687_100039263
414 Ga0070668_100171348
415 Ga0070675_100435973
416 Ga0070671_100037196
417 Ga0070671_100107884
418 Ga0070671_100121448
419 Ga0070674_100111716
420 Ga0070673_100016395
421 Ga0070673_100039198
422 Ga0070688_100435165
423 Ga0070667_100067568
424 Ga0070667_100452144
425 Ga0070701_10011450
426 Ga0070701_10284359
427 Ga0070700_100124306
428 Ga0070708_100152710
429 Ga0070663_100087212
430 Ga0070678_100097201
431 Ga0070662_100104046
432 Ga0070681_10072910
433 Ga0068867_100109699
434 Ga0070706_100030160
435 Ga0070707_100260249
436 Ga0070672_100033689
437 Ga0070672_100089640
438 Ga0070695_100030554
439 Ga0070695_100183449
440 Ga0070664_100049950
441 Ga0070664_100334341
442 Ga0068854_100121174
443 Ga0068854_100621061
444 Ga0068852_100006409
445 Ga0068859_100939341
446 Ga0068864_100021001
447 Ga0068864_100108257
448 Ga0068864_100150080
449 Ga0068864_100212236
450 Ga0068861_100179647
451 Ga0068851_10029283
452 Ga0068863_100098089
453 Ga0068863_100133223
454 Ga0068858_100079248
455 Ga0068860_100320817
456 Ga0081455_10000076
457 Ga0081455_10000371
458 Ga0081540_1000604
459 Ga0081540_1003531
460 Ga0081540_1052460
461 Ga0081539_10000922
462 Ga0075365_10151157
463 Ga0075364_10000545
464 Ga0075364_10002318
465 Ga0075432_10162243
466 Ga0070716_100080228
467 Ga0070712_100290298
468 Ga0097621_100033590
469 Ga0097621_100085713
470 Ga0068871_100081402
471 Ga0068871_100251226
472 Ga0068871_100368731
473 Ga0075430_100012694
474 Ga0075431_100009236
475 Ga0075433_10003530
476 Ga0075434_100000906
477 Ga0068865_100033787
478 Ga0097620_100939392
479 Ga0099823_1008331
480 Ga0075435_100136906
481 Ga0105240_10553277
482 Ga0111539_10010305
483 Ga0111539_10057362
484 Ga0111539_10176053
485 Ga0111539_10610680
486 Ga0111539_11399264
487 Ga0105245_10174305
488 Ga0105245_10193520
489 Ga0105242_10033880
490 Ga0105249_10058213
491 Ga0105249_10427360
492 Ga0105246_10373085
493 Ga0157374_10011741
494 Ga0157374_10070414
495 Ga0157378_10115739
496 Ga0163162_10008575
497 Ga0157375_10084693
498 Ga0157375_10250850
499 Ga0163163_10607359
500 Ga0157380_10104810
501 Ga0157380_10128967
502 Ga0157380_10820405
503 Ga0182008_10022920
504 Ga0157377_10134849
505 Ga0157376_10148080
506 Ga0157376_10459084
507 Ga0182007_10019160
508 Ga0163161_10211420
509 Ga0209646_1021758
510 Ga0209759_1001780
511 Ga0209759_1024541
512 Ga0209675_1000090
513 Ga0209025_1001275
514 Ga0209564_1000985
515 Ga0207697_10088817
516 Ga0207682_10003988
517 Ga0207682_10143459
518 Ga0207688_10199279
519 Ga0207645_10015403
520 Ga0207643_10008262
521 Ga0207684_10616061
522 Ga0207707_10063152
523 Ga0207695_10420202
524 Ga0207663_10513598
525 Ga0207662_10014683
526 Ga0207646_10062913
527 Ga0207650_10003147
528 Ga0207650_10242758
529 Ga0207659_10003404
530 Ga0207659_10049604
531 Ga0207644_10159291
532 Ga0207644_10172728
533 Ga0207706_10019061
534 Ga0207706_10136953
535 Ga0207709_10171874
536 Ga0207670_10283815
537 Ga0207669_10026643
538 Ga0207691_10103567
539 Ga0207691_10133997
540 Ga0207689_10013309
541 Ga0207679_10040574
542 Ga0207651_10020640
543 Ga0207651_10151528
544 Ga0207668_10033386
545 Ga0207640_10166934
546 Ga0207658_10421874
547 Ga0207677_10052075
548 Ga0207678_10033372
549 Ga0207678_10404832
550 Ga0207708_10090651
551 Ga0207708_10544786
552 Ga0207641_10093733
553 Ga0207641_10274917
554 Ga0207648_10109163
555 Ga0207648_10134551
556 Ga0207676_10146523
557 Ga0207676_10200764
558 Ga0207676_10244111
559 Ga0207676_10270544
560 Ga0207675_100120839
561 Ga0207675_100181709
562 Ga0207683_10004517
563 Ga0207683_10099743
564 Ga0209389_1000004
565 Ga0209969_1002286
566 Ga0209969_1007670
567 Ga0209489_100172
568 Ga0209967_1002197
569 Ga0209995_1009133
570 Ga0209966_1024184
571 Ga0209966_1057893
572 Ga0209974_10004620
573 Ga0207428_10232665
574 Ga0268265_10535070
575 Ga0268264_10260320
576 Ga0265318_10002631
577 Ga0307511_10019215
578 Ga0265330_10009111
579 Ga0265332_10018165
580 Ga0265320_10036359
581 Ga0265339_10001315
582 Ga0265331_10052176
583 Ga0265316_10009185
584 Ga0307509_10000004
585 Ga0307408_100084164
586 Ga0265313_10144836
587 Ga0316575_10022074
588 Ga0316579_10000932
589 Ga0265342_10020689
590 Ga0316578_10002018
591 Ga0307416_101564584
592 Ga0307414_10224692
593 Ga0307411_10868838
594 Ga0316583_10003229
595 Ga0316583_10127071
596 Ga0307510_10000001
597 Ga0307510_10006484
598 Ga0373950_0004326
599 Ga0373928_0066843
600 Ga0373949_0007502
601 Ga0373951_0012603
602 Ga0373952_0004800
603 Ga0373952_0024162
604 Ga0373939_0053470
605 Ga0373961_0004583
606 Ga0373962_0002143
607 Ga0373931_0000378
608 Ga0373931_0002381
609 Ga0316582_0001123
610 Ga0395905_0046100
611 Ga0395905_0174171
612 Ga0316581_0054288
613 Ga0395901_0017014
614 Ga0436360_0189068
615 Ga0450916_000689
616 Ga0451577_0108041
617 Ga0451577_0270554
618 Ga0451577_0335786
619 Ga0451577_0882751
620 Ga0466969_0005468
621 Ga0466969_0087553
622 Ga0466972_0090720
623 Ga0453683_0109115
624 Ga0466965_0002246
625 Ga0466966_0001889
626 Ga0466966_0015433
627 Ga0466966_0018709
628 Ga0466961_0088926
629 Ga0466963_0204570
630 Ga0466964_0000521
631 Ga0453684_0209650
632 Ga0466971_0075829
633 Ga0466970_0001263
634 Ga0466970_0042992
635 Ga0466970_0057996
636 Ga0466957_0123926
637 Ga0466959_0002081
638 Ga0466959_0010594
639 Ga0466959_0147861
640 Ga0451576_0160296
641 Ga0466958_0378822
642 Ga0495603_0014895
643 Ga0495590_0021836
644 Ga0495629_0000295
645 Ga0495638_0000808
646 Ga0495653_0083900
647 Ga0495650_0023164
648 Ga0495580_0013065
649 Ga0495580_0020564
650 Ga0495580_0027163
651 Ga0495662_0040979
652 Ga0495584_0063347
653 Ga0495594_0052147
654 Ga0495583_0000255
655 Ga0495628_0243765
656 Ga0495630_0000342
657 Ga0495666_0001023
658 Ga0495666_0006515
659 Ga0495666_0013070
660 Ga0495642_0016387
661 Ga0495652_0339233
662 Ga0495665_0006665
663 Ga0495665_0011019
664 Ga0495665_0140651
665 Ga0495645_0002096
666 Ga0495667_0231495
667 Ga0495656_0119594
668 Ga0495625_0016458
669 Ga0495625_0020934
670 Ga0495625_0041987
671 Ga0495659_0177667
672 Ga0495599_0006749
673 Ga0495658_0352665
674 Ga0495658_0422728
675 Ga0495589_0061277
676 Ga0495604_0001617
677 Ga0495604_0076622
678 Ga0495604_0090482
679 Ga0495683_0044784
680 Ga0495687_000170
681 Ga0495681_0000936
682 Ga0495602_0196072
683 Ga0495614_0180399
684 Ga0496101_0023499
685 Ga0496102_0711248
686 Ga0496104_0294752
687 Ga0496108_0357329
688 Ga0496110_0139414
689 Ga0496110_0229353
690 Ga0496114_0038483
691 Ga0496114_0150594
692 Ga0496115_0469188
693 Ga0466983_0005887
694 Ga0495682_0000459
695 Ga0501031_0019553
696 Ga0501032_0000013
697 Ga0501033_0000427
698 Ga0501033_0005939
699 Ga0501033_0025697
700 Ga0501033_0408560
701 Ga0501034_0000054
702 Ga0501034_0000569
703 Ga0501036_0000031
704 Ga0501036_0000562
705 Ga0501037_0000096
706 Ga0501037_0003055
707 Ga0501037_0004290
708 Ga0501037_0217362
709 Ga0501038_0000018
710 Ga0501038_0006870
711 Ga0501039_0000018
712 Ga0501039_0000095
713 Ga0501039_0221165
714 Ga0501041_0091495
715 Ga0501043_0000014
716 Ga0501043_0000331
717 Ga0501043_0053480
718 Ga0501043_0227695
719 Ga0501046_0027880
720 Ga0501046_0043047
721 Ga0501047_0046096
722 Ga0501048_0502770
723 Ga0501068_0122988
724 Ga0501069_0077894
725 Ga0501070_0122896
726 Ga0501071_0315929
727 Ga0501073_0450034
728 Ga0501074_0237023
729 Ga0501075_0154217
730 Ga0501076_0039753
731 Ga0501076_0354931
732 Ga0501079_0012660
733 Ga0501080_0036137
734 Ga0501081_0092464
735 Ga0501081_0339989
736 Ga0501081_0504345
737 Ga0501035_0000019
738 Ga0501035_0000204
739 Ga0501035_0084987
740 Ga0501035_0103252
741 Ga0501035_0134446
742 Ga0501044_0003562
743 Ga0501044_0006006
744 Ga0501044_0138519
745 Ga0501045_0126711
746 Ga0501045_0156995
747 nmdc:mga00v17_435_c1
748 nmdc:mga00v17_67613_c1
749 nmdc:mga0yw44_136189_c1
750 nmdc:mga0qj67_27873_c1
751 nmdc:mga06r32_21726_c1
752 nmdc:mga08y16_69813_c1
753 nmdc:mga0n895_3297_c1
754 nmdc:mga0n895_747455_c1
755 nmdc:mga0rr50_11573_c1
756 nmdc:mga0a205_13584_c1
757 Ga0495595_0058860
758 Ga0495619_0010221
759 Ga0500607_016571
760 Ga0500608_004608
761 Ga0500559_0000072
762 Ga0500568_0006208
763 Ga0500604_0007896
764 Ga0500624_013862
765 Ga0501084_0018775
766 Ga0501084_0747415
767 Ga0501082_0008032
768 Ga0466962_0003754
769 Ga0530510_0139284
770 2644029537
771 2644030878
772 2738723567
773 2739284298
774 2739613666
775 2758639543
776 2792834511
777 2881166223
778 2887377482
779 2889916910
780 2897808532
781 2900641493
782 2939636778
783 2977979808
784 8039102189

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

32

220

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

38

269

0.94

PF08659

KR

KR domain

33

211

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

34

211

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uzn-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9543 9 249
1uzl-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9526 9 249
1uzn-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9514 9 249
5ovl-assembly1.cif.gz_B crystal structure of maba bound to nadp+ from m. smegmatis 0.9504 9 249
5ovk-assembly1.cif.gz_C crystal structure maba bound to nadph from m. smegmatis 0.9493 9 249
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9522 7 38 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 5 182 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 53 179 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 9 249 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.941 83 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A8A7CQ34-F1-model_v4 deleted 0.9739 6 251
AF-A0A1Q4DHZ9-F1-model_v4 Short-chain dehydrogenase 0.972 6 249 GO:0016616
AF-A0A8A7CQ34-F1-model_v4 deleted 0.9661 6 251
AF-A0A2N6CTZ4-F1-model_v4 Short-chain dehydrogenase 0.9652 5 249 GO:0016616
AF-A0A853QXV0-F1-model_v4 deleted 0.964 69 251

Map