F432038

General Info

Members Datasets Scaffolds Average Seq Length
391 197 780 109

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10075286|Ga0207643_100752862
Length 113
Sequence MPRDDGLPPGTLVMLILRVLASEPLHGYAIAHWIRTSTKEGLNVREGALYPSLHRLEGKGFLAGEWGMTETNREAKFYRLTPVGKKQLATELARWRDYSRIMTLALAASKSGD

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
138 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
166 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0
Rhizoplane 1.02
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 35.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10075286 3300025908 Bacteria 1948
2 JGI24033J26618_1039364 3300002155 Bacteria 656
3 Ga0065712_10018561 3300005290 Bacteria 2313
4 Ga0065715_10038539 3300005293 Bacteria 1231
5 Ga0065715_10502318 3300005293 Bacteria 778
6 Ga0065715_10507940 3300005293 Unclassified 774
7 Ga0065707_10088771 3300005295 Bacteria 4555
8 Ga0070683_101399402 3300005329 Unclassified 672
9 Ga0070670_100089441 3300005331 Archaea 2647
10 Ga0070670_101163782 3300005331 Unclassified 704
11 Ga0070677_10029124 3300005333 Bacteria 2091
12 Ga0068869_100070911 3300005334 Unclassified 2579
13 Ga0068869_100263314 3300005334 Unclassified 1381
14 Ga0070666_10035416 3300005335 Unclassified 3310
15 Ga0070680_100740420 3300005336 Bacteria 846
16 Ga0070668_100011571 3300005347 Bacteria 6569
17 Ga0070668_100304235 3300005347 Bacteria 1338
18 Ga0070668_100787033 3300005347 Unclassified 844
19 Ga0070668_102008945 3300005347 Unclassified 533
20 Ga0070669_100019860 3300005353 Unclassified 4800
21 Ga0070669_101293860 3300005353 Archaea 631
22 Ga0070669_102044822 3300005353 Unclassified 501
23 Ga0070675_100264842 3300005354 Unclassified 1507
24 Ga0070675_100392843 3300005354 Bacteria 1236
25 Ga0070675_101960188 3300005354 Unclassified 540
26 Ga0070674_100374444 3300005356 Unclassified 1157
27 Ga0070673_101862583 3300005364 Unclassified 570
28 Ga0070688_100059519 3300005365 Bacteria 2409
29 Ga0070688_100713565 3300005365 Bacteria 778
30 Ga0070667_101069085 3300005367 Unclassified 754
31 Ga0070713_100077053 3300005436 Unclassified 2834
32 Ga0070701_10879078 3300005438 Unclassified 617
33 Ga0070705_101036170 3300005440 Unclassified 668
34 Ga0070700_100014694 3300005441 Unclassified 4424
35 Ga0070700_101950792 3300005441 Bacteria 508
36 Ga0070694_100114042 3300005444 Bacteria 1929
37 Ga0070663_100105850 3300005455 Bacteria 2106
38 Ga0070678_100100910 3300005456 Bacteria 2236
39 Ga0070678_101520510 3300005456 Unclassified 627
40 Ga0070678_102175543 3300005456 Unclassified 526
41 Ga0070662_100660759 3300005457 Unclassified 882
42 Ga0070662_101271606 3300005457 Unclassified 633
43 Ga0070681_10129745 3300005458 Bacteria 2453
44 Ga0068867_100316874 3300005459 Bacteria 1291
45 Ga0068867_101348065 3300005459 Unclassified 660
46 Ga0070685_10003722 3300005466 Bacteria 7721
47 Ga0070707_100281177 3300005468 Bacteria 1617
48 Ga0070707_101370118 3300005468 Unclassified 674
49 Ga0070679_101594986 3300005530 Bacteria 600
50 Ga0070684_101949375 3300005535 Unclassified 554
51 Ga0070672_100372698 3300005543 Unclassified 1220
52 Ga0070686_100491930 3300005544 Unclassified 950
53 Ga0070665_100085145 3300005548 Bacteria 3166
54 Ga0070665_100279260 3300005548 Bacteria 1672
55 Ga0070665_100330960 3300005548 Unclassified 1528
56 Ga0070665_100610105 3300005548 Bacteria 1104
57 Ga0070665_100683080 3300005548 Bacteria 1040
58 Ga0070704_100288868 3300005549 Bacteria 1362
59 Ga0070664_100764619 3300005564 Unclassified 902
60 Ga0068857_100237209 3300005577 Bacteria 1669
61 Ga0068857_100535016 3300005577 Bacteria 1102
62 Ga0068857_100930730 3300005577 Bacteria 834
63 Ga0068857_101036129 3300005577 Bacteria 791
64 Ga0068854_101431239 3300005578 Unclassified 626
65 Ga0068859_100159336 3300005617 Bacteria 2336
66 Ga0068859_100171634 3300005617 Bacteria 2250
67 Ga0068859_100927540 3300005617 Bacteria 955
68 Ga0068864_101672995 3300005618 Unclassified 641
69 Ga0068864_102245504 3300005618 Unclassified 552
70 Ga0068861_100188907 3300005719 Bacteria 1721
71 Ga0068861_100569103 3300005719 Unclassified 1035
72 Ga0068861_101298242 3300005719 Bacteria 707
73 Ga0068870_10990835 3300005840 Unclassified 599
74 Ga0068863_100014318 3300005841 Bacteria 7641
75 Ga0068860_100015570 3300005843 Bacteria 7427
76 Ga0068860_101433132 3300005843 Unclassified 712
77 Ga0068862_100093267 3300005844 Unclassified 2625
78 Ga0068862_100355741 3300005844 Unclassified 1360
79 Ga0068862_102767229 3300005844 Unclassified 502
80 Ga0075365_10043766 3300006038 Bacteria 2931
81 Ga0075365_10698238 3300006038 Bacteria 717
82 Ga0075368_10013656 3300006042 Bacteria 2985
83 Ga0075363_100321220 3300006048 Unclassified 901
84 Ga0075364_10090364 3300006051 Bacteria 2031
85 Ga0075364_10660163 3300006051 Unclassified 714
86 Ga0075432_10267399 3300006058 Bacteria 699
87 Ga0075432_10423424 3300006058 Unclassified 579
88 Ga0075362_10233378 3300006177 Bacteria 901
89 Ga0075367_10010254 3300006178 Bacteria 4918
90 Ga0075367_10310999 3300006178 Bacteria 992
91 Ga0075367_10436777 3300006178 Unclassified 829
92 Ga0075367_11122431 3300006178 Unclassified 503
93 Ga0075366_10024002 3300006195 Bacteria 3555
94 Ga0075366_10032711 3300006195 Bacteria 3062
95 Ga0075366_10392343 3300006195 Unclassified 854
96 Ga0075370_10061661 3300006353 Bacteria 2136
97 Ga0075370_10128325 3300006353 Bacteria 1479
98 Ga0075428_100008353 3300006844 Bacteria 11479
99 Ga0075428_100084817 3300006844 Unclassified 3456
100 Ga0075428_101174048 3300006844 Bacteria 810
101 Ga0075428_101958419 3300006844 Bacteria 608
102 Ga0075430_100000681 3300006846 Bacteria 26015
103 Ga0075430_100004981 3300006846 Bacteria 11180
104 Ga0075430_100178021 3300006846 Bacteria 1769
105 Ga0075430_100301431 3300006846 Bacteria 1325
106 Ga0075430_101208777 3300006846 Bacteria 622
107 Ga0075431_100029075 3300006847 Bacteria 5686
108 Ga0075431_100063418 3300006847 Bacteria 3813
109 Ga0075431_100082805 3300006847 Unclassified 3312
110 Ga0075431_100133653 3300006847 Bacteria 2558
111 Ga0075431_100209717 3300006847 Bacteria 1990
112 Ga0075431_100290361 3300006847 Bacteria 1655
113 Ga0075431_100541198 3300006847 Bacteria 1152
114 Ga0075433_10007201 3300006852 Bacteria 8808
115 Ga0075433_10039468 3300006852 Bacteria 4083
116 Ga0075433_10229861 3300006852 Bacteria 1647
117 Ga0075433_10263348 3300006852 Unclassified 1528
118 Ga0075434_100006570 3300006871 Bacteria 10664
119 Ga0075434_101038864 3300006871 Bacteria 833
120 Ga0075434_101059136 3300006871 Unclassified 825
121 Ga0075429_100003633 3300006880 Bacteria 13140
122 Ga0075429_100014929 3300006880 Bacteria 6738
123 Ga0075429_100050742 3300006880 Bacteria 3609
124 Ga0075429_100077310 3300006880 Unclassified 2900
125 Ga0075429_100680295 3300006880 Bacteria 901
126 Ga0075429_100693739 3300006880 Unclassified 892
127 Ga0075429_101821110 3300006880 Unclassified 528
128 Ga0068865_100203011 3300006881 Bacteria 1540
129 Ga0068865_100691057 3300006881 Unclassified 871
130 Ga0097620_100159329 3300006931 Bacteria 2336
131 Ga0097620_100171623 3300006931 Bacteria 2250
132 Ga0097620_100927549 3300006931 Bacteria 955
133 Ga0111539_10000321 3300009094 Bacteria 58593
134 Ga0111539_10508151 3300009094 Bacteria 1404
135 Ga0111539_11030254 3300009094 Unclassified 957
136 Ga0111539_11047861 3300009094 Bacteria 948
137 Ga0111539_12492335 3300009094 Unclassified 600
138 Ga0105247_10033036 3300009101 Bacteria 3146
139 Ga0105247_10991259 3300009101 Unclassified 655
140 Ga0114129_10000755 3300009147 Bacteria 41191
141 Ga0114129_10011564 3300009147 Bacteria 12568
142 Ga0114129_10047359 3300009147 Bacteria 6041
143 Ga0114129_10204832 3300009147 Bacteria 2670
144 Ga0114129_10303572 3300009147 Bacteria 2127
145 Ga0114129_11235887 3300009147 Bacteria 929
146 Ga0105243_12947391 3300009148 Unclassified 516
147 Ga0105243_13063699 3300009148 Unclassified 506
148 Ga0105238_10338815 3300009551 Bacteria 1491
149 Ga0105249_12705391 3300009553 Unclassified 568
150 Ga0157374_11637936 3300013296 Unclassified 668
151 Ga0157380_10067734 3300014326 Bacteria 2876
152 Ga0157380_10781785 3300014326 Bacteria 969
153 Ga0157380_12639577 3300014326 Bacteria 569
154 Ga0163161_10093382 3300017792 Bacteria 2229
155 Ga0207697_10038974 3300025315 Bacteria 1949
156 Ga0207697_10096437 3300025315 Unclassified 1257
157 Ga0207710_10720774 3300025900 Bacteria 523
158 Ga0207688_10590082 3300025901 Unclassified 700
159 Ga0207688_10935828 3300025901 Unclassified 548
160 Ga0207680_10041011 3300025903 Unclassified 2698
161 Ga0207647_10667015 3300025904 Bacteria 569
162 Ga0207645_10196816 3300025907 Bacteria 1325
163 Ga0207645_10538688 3300025907 Unclassified 791
164 Ga0207707_10103019 3300025912 Bacteria 2495
165 Ga0207662_10001874 3300025918 Bacteria 10349
166 Ga0207646_10192526 3300025922 Bacteria 1842
167 Ga0207681_10004429 3300025923 Bacteria 8649
168 Ga0207681_11095329 3300025923 Archaea 669
169 Ga0207650_10930742 3300025925 Unclassified 738
170 Ga0207659_10228466 3300025926 Unclassified 1500
171 Ga0207659_10261859 3300025926 Unclassified 1407
172 Ga0207659_11405177 3300025926 Unclassified 598
173 Ga0207659_11741714 3300025926 Bacteria 530
174 Ga0207700_10349721 3300025928 Bacteria 1287
175 Ga0207700_10466541 3300025928 Bacteria 1114
176 Ga0207706_10857734 3300025933 Bacteria 769
177 Ga0207706_10890254 3300025933 Unclassified 752
178 Ga0207706_11158006 3300025933 Unclassified 644
179 Ga0207709_10837439 3300025935 Unclassified 744
180 Ga0207709_10913932 3300025935 Unclassified 714
181 Ga0207669_10093977 3300025937 Bacteria 1961
182 Ga0207669_10640756 3300025937 Unclassified 868
183 Ga0207704_10401796 3300025938 Bacteria 1081
184 Ga0207704_10474923 3300025938 Bacteria 1003
185 Ga0207704_11912003 3300025938 Unclassified 510
186 Ga0207689_10988355 3300025942 Unclassified 710
187 Ga0207661_10900759 3300025944 Unclassified 815
188 Ga0207651_10886407 3300025960 Unclassified 794
189 Ga0207712_10647195 3300025961 Unclassified 918
190 Ga0207712_11089489 3300025961 Bacteria 711
191 Ga0207668_10108178 3300025972 Bacteria 2081
192 Ga0207668_11075385 3300025972 Bacteria 721
193 Ga0207668_11705365 3300025972 Unclassified 569
194 Ga0207640_11969814 3300025981 Bacteria 529
195 Ga0207658_10653756 3300025986 Unclassified 948
196 Ga0207708_10010171 3300026075 Bacteria 6985
197 Ga0207708_10025249 3300026075 Bacteria 4494
198 Ga0207708_10656078 3300026075 Bacteria 893
199 Ga0207708_11770762 3300026075 Bacteria 542
200 Ga0207641_10005608 3300026088 Bacteria 10694
201 Ga0207648_10305827 3300026089 Unclassified 1427
202 Ga0207648_10431492 3300026089 Bacteria 1198
203 Ga0207648_10492611 3300026089 Unclassified 1121
204 Ga0207676_12122053 3300026095 Unclassified 560
205 Ga0207674_10216758 3300026116 Bacteria 1862
206 Ga0207674_10511794 3300026116 Bacteria 1159
207 Ga0207674_11159527 3300026116 Unclassified 742
208 Ga0207674_11221182 3300026116 Bacteria 721
209 Ga0207675_100024424 3300026118 Bacteria 5620
210 Ga0207683_10009069 3300026121 Bacteria 8475
211 Ga0209984_1021216 3300027424 Bacteria 890
212 Ga0209813_10061940 3300027866 Bacteria 1196
213 Ga0209974_10374650 3300027876 Bacteria 555
214 Ga0207428_10075919 3300027907 Bacteria 2633
215 Ga0207428_10966248 3300027907 Unclassified 600
216 Ga0268266_10862863 3300028379 Unclassified 875
217 Ga0268266_11323324 3300028379 Unclassified 696
218 Ga0268265_10087786 3300028380 Unclassified 2476
219 Ga0268265_10466541 3300028380 Bacteria 1183
220 Ga0268265_11277550 3300028380 Bacteria 733
221 Ga0268265_12041649 3300028380 Unclassified 580
222 Ga0268264_10807922 3300028381 Bacteria 937
223 Ga0307408_100021378 3300031548 Bacteria 4379
224 Ga0307408_100102198 3300031548 Unclassified 2186
225 Ga0307408_100323679 3300031548 Bacteria 1299
226 Ga0307408_101054939 3300031548 Unclassified 752
227 Ga0307405_11302738 3300031731 Bacteria 632
228 Ga0307413_10279253 3300031824 Bacteria 1255
229 Ga0307413_10553650 3300031824 Bacteria 933
230 Ga0307410_10143337 3300031852 Bacteria 1770
231 Ga0307410_10291653 3300031852 Unclassified 1284
232 Ga0307410_10569790 3300031852 Bacteria 941
233 Ga0307406_10022516 3300031901 Bacteria 3739
234 Ga0307406_10305559 3300031901 Unclassified 1224
235 Ga0307406_10804316 3300031901 Bacteria 794
236 Ga0307407_10049538 3300031903 Bacteria 2398
237 Ga0307407_11149981 3300031903 Bacteria 605
238 Ga0307412_10015388 3300031911 Bacteria 4535
239 Ga0307412_10050670 3300031911 Bacteria 2741
240 Ga0307412_10236913 3300031911 Bacteria 1409
241 Ga0307412_10278896 3300031911 Unclassified 1311
242 Ga0307409_100543482 3300031995 Bacteria 1139
243 Ga0307409_101827354 3300031995 Unclassified 637
244 Ga0307409_102473706 3300031995 Bacteria 548
245 Ga0307416_100112433 3300032002 Bacteria 2403
246 Ga0307416_100280289 3300032002 Bacteria 1643
247 Ga0307416_100356916 3300032002 Bacteria 1482
248 Ga0307416_100407846 3300032002 Bacteria 1399
249 Ga0307416_100451336 3300032002 Bacteria 1338
250 Ga0307416_100996533 3300032002 Bacteria 941
251 Ga0307416_101148436 3300032002 Unclassified 882
252 Ga0307416_102290931 3300032002 Bacteria 641
253 Ga0307416_102555477 3300032002 Bacteria 609
254 Ga0307414_10257648 3300032004 Bacteria 1454
255 Ga0307411_10012303 3300032005 Bacteria 4663
256 Ga0307411_10295520 3300032005 Unclassified 1296
257 Ga0307415_100947911 3300032126 Bacteria 796
258 Ga0373928_0220263 3300035084 Unclassified 555
259 Ga0373934_0148549 3300035086 Bacteria 959
260 Ga0373962_0296290 3300035242 Unclassified 573
261 Ga0373933_0068403 3300035724 Bacteria 2157
262 Ga0373937_0002495 3300036401 Bacteria 15289
263 Ga0395905_1293390 3300037471 Bacteria 633
264 Ga0451789_0573275 3300041443 Unclassified 805
265 Ga0451800_0416767 3300041459 Unclassified 581
266 Ga0439450_123715 3300042008 Bacteria 667
267 Ga0439435_0350571 3300042436 Unclassified 512
268 Ga0439459_0046051 3300042438 Bacteria 943
269 Ga0495638_0006636 3300046460 Bacteria 8402
270 Ga0496110_0299090 3300048913 Unclassified 1466
271 Ga0496111_1201729 3300048914 Unclassified 537
272 Ga0501292_039206 3300049515 Unclassified 815
273 Ga0501299_002185 3300049522 Bacteria 2681
274 Ga0501031_0008879 3300049568 Bacteria 6535
275 Ga0501031_0239315 3300049568 Bacteria 1180
276 Ga0501032_0000819 3300049569 Bacteria 25266
277 Ga0501032_0036011 3300049569 Unclassified 3380
278 Ga0501033_0271224 3300049570 Bacteria 1199
279 Ga0501034_0010117 3300049571 Bacteria 9841
280 Ga0501034_0125090 3300049571 Bacteria 2556
281 Ga0501034_0473513 3300049571 Bacteria 1168
282 Ga0501034_0535563 3300049571 Unclassified 1081
283 Ga0501036_0015605 3300049572 Bacteria 6346
284 Ga0501036_0153605 3300049572 Unclassified 1941
285 Ga0501036_0769894 3300049572 Bacteria 793
286 Ga0501037_0243067 3300049573 Bacteria 1261
287 Ga0501037_0546009 3300049573 Bacteria 782
288 Ga0501038_0004894 3300049574 Bacteria 12440
289 Ga0501038_0017158 3300049574 Bacteria 6546
290 Ga0501038_0583278 3300049574 Bacteria 847
291 Ga0501038_1405809 3300049574 Bacteria 501
292 Ga0501039_0004885 3300049575 Archaea 10156
293 Ga0501040_0853884 3300049576 Bacteria 659
294 Ga0501041_0718394 3300049577 Bacteria 640
295 Ga0501042_0219504 3300049578 Bacteria 1371
296 Ga0501042_0402494 3300049578 Bacteria 992
297 Ga0501042_0553219 3300049578 Unclassified 836
298 Ga0501043_0003065 3300049579 Bacteria 13887
299 Ga0501043_0059442 3300049579 Bacteria 3000
300 Ga0501043_0191901 3300049579 Unclassified 1588
301 Ga0501043_0259844 3300049579 Bacteria 1336
302 Ga0501043_0974982 3300049579 Unclassified 604
303 Ga0501046_0016525 3300049580 Bacteria 6175
304 Ga0501046_0051109 3300049580 Unclassified 3263
305 Ga0501046_0312283 3300049580 Unclassified 1146
306 Ga0501047_0000887 3300049581 Bacteria 30525
307 Ga0501047_0079748 3300049581 Unclassified 3147
308 Ga0501048_0164547 3300049582 Bacteria 1570
309 Ga0501048_0167606 3300049582 Bacteria 1555
310 Ga0501067_0035728 3300049583 Unclassified 2759
311 Ga0501068_0008151 3300049584 Bacteria 5819
312 Ga0501068_0226249 3300049584 Bacteria 1189
313 Ga0501068_0422852 3300049584 Unclassified 860
314 Ga0501069_0030941 3300049585 Bacteria 2941
315 Ga0501071_0755615 3300049587 Bacteria 749
316 Ga0501071_0948963 3300049587 Unclassified 664
317 Ga0501071_0998914 3300049587 Bacteria 646
318 Ga0501072_0124486 3300049588 Bacteria 2054
319 Ga0501072_0132600 3300049588 Unclassified 1986
320 Ga0501072_1146150 3300049588 Unclassified 604
321 Ga0501073_0013656 3300049589 Bacteria 5909
322 Ga0501073_0139423 3300049589 Unclassified 1680
323 Ga0501073_0284624 3300049589 Bacteria 1140
324 Ga0501073_0332275 3300049589 Bacteria 1049
325 Ga0501074_0905798 3300049590 Bacteria 621
326 Ga0501076_0491617 3300049592 Unclassified 1011
327 Ga0501076_1587588 3300049592 Bacteria 537
328 Ga0501077_0016139 3300049593 Bacteria 4705
329 Ga0501077_0141787 3300049593 Bacteria 1524
330 Ga0501077_0613829 3300049593 Bacteria 699
331 Ga0501202_051555 3300049652 Bacteria 913
332 Ga0501217_029092 3300049661 Bacteria 1349
333 Ga0501233_028045 3300049668 Bacteria 1255
334 Ga0501247_083913 3300049677 Bacteria 518
335 Ga0501080_0127194 3300049742 Unclassified 2359
336 Ga0501080_0857935 3300049742 Unclassified 793
337 Ga0501081_0132625 3300049743 Unclassified 1781
338 Ga0501083_0004372 3300049744 Bacteria 9958
339 Ga0501083_0433885 3300049744 Bacteria 855
340 Ga0501083_0523871 3300049744 Bacteria 771
341 Ga0501268_015412 3300049765 Bacteria 1256
342 Ga0501035_0299032 3300049822 Unclassified 1356
343 Ga0501035_0809135 3300049822 Bacteria 748
344 Ga0501044_0002370 3300049823 Bacteria 21458
345 Ga0501044_0052738 3300049823 Unclassified 4188
346 nmdc:mga03683_308342_c1 3300050489 Unclassified 743
347 nmdc:mga03n38_248356_c1 3300050490 Unclassified 939
348 nmdc:mga00v17_57851_c1 3300050491 Bacteria 2373
349 nmdc:mga00v17_695702_c1 3300050491 Unclassified 652
350 nmdc:mga0yw44_154473_c1 3300050492 Unclassified 1499
351 nmdc:mga0yw44_800608_c1 3300050492 Bacteria 640
352 nmdc:mga0k408_102076_c1 3300050493 Bacteria 1692
353 nmdc:mga0k408_57561_c1 3300050493 Bacteria 2257
354 nmdc:mga04h51_47485_c1 3300050495 Unclassified 1427
355 nmdc:mga04h51_61083_c1 3300050495 Bacteria 1292
356 nmdc:mga07m45_442812_c1 3300050496 Unclassified 753
357 nmdc:mga05p37_12120_c1 3300050507 Bacteria 10294
358 nmdc:mga05p37_32688_c1 3300050507 Bacteria 6365
359 nmdc:mga05p37_930715_c1 3300050507 Bacteria 933
360 nmdc:mga09592_39371_c1 3300050508 Bacteria 3971
361 nmdc:mga09592_715907_c1 3300050508 Bacteria 851
362 nmdc:mga0qj67_1022846_c1 3300050509 Bacteria 648
363 nmdc:mga0qj67_79203_c1 3300050509 Bacteria 2631
364 nmdc:mga06r32_1233217_c1 3300050510 Bacteria 693
365 nmdc:mga06r32_221620_c1 3300050510 Bacteria 1880
366 nmdc:mga06r32_25313_c1 3300050510 Bacteria 5521
367 nmdc:mga06r32_405600_c1 3300050510 Bacteria 1345
368 nmdc:mga08y16_1695976_c1 3300050511 Unclassified 587
369 nmdc:mga08y16_248717_c1 3300050511 Bacteria 1837
370 nmdc:mga08y16_38056_c1 3300050511 Bacteria 5051
371 nmdc:mga08y16_397991_c1 3300050511 Bacteria 1410
372 nmdc:mga0n895_387348_c1 3300050512 Unclassified 1414
373 nmdc:mga0a205_217755_c1 3300050515 Unclassified 1796
374 nmdc:mga0a205_594261_c1 3300050515 Unclassified 960
375 Ga0500646_0056333 3300053090 Bacteria 1146
376 Ga0500651_0193498 3300053093 Bacteria 1203
377 Ga0500555_000263 3300053103 Bacteria 22981
378 Ga0500645_000044 3300053730 Bacteria 109705
379 Ga0501084_0093371 3300054114 Bacteria 2526
380 Ga0590071_004188 3300059421 Bacteria 3514
381 Ga0590074_000301 3300059423 Bacteria 6768
382 Ga0590075_000248 3300059424 Bacteria 15145
383 Ga0590077_000289 3300059426 Bacteria 14225
384 Ga0501082_0009833 3300060353 Bacteria 8242
385 Ga0501082_0016034 3300060353 Bacteria 6445
386 Ga0501082_0054716 3300060353 Bacteria 3439
387 Ga0501082_0212716 3300060353 Unclassified 1682
388 Ga0501082_0372121 3300060353 Bacteria 1246
389 Ga0501082_1049790 3300060353 Bacteria 712
390 Ga0530510_0272573 3300061734 Bacteria 1263
391 Ga0207643_10075286
392 JGI24033J26618_1039364
393 Ga0065712_10018561
394 Ga0065715_10038539
395 Ga0065715_10502318
396 Ga0065715_10507940
397 Ga0065707_10088771
398 Ga0070683_101399402
399 Ga0070670_100089441
400 Ga0070670_101163782
401 Ga0070677_10029124
402 Ga0068869_100070911
403 Ga0068869_100263314
404 Ga0070666_10035416
405 Ga0070680_100740420
406 Ga0070668_100011571
407 Ga0070668_100304235
408 Ga0070668_100787033
409 Ga0070668_102008945
410 Ga0070669_100019860
411 Ga0070669_101293860
412 Ga0070669_102044822
413 Ga0070675_100264842
414 Ga0070675_100392843
415 Ga0070675_101960188
416 Ga0070674_100374444
417 Ga0070673_101862583
418 Ga0070688_100059519
419 Ga0070688_100713565
420 Ga0070667_101069085
421 Ga0070713_100077053
422 Ga0070701_10879078
423 Ga0070705_101036170
424 Ga0070700_100014694
425 Ga0070700_101950792
426 Ga0070694_100114042
427 Ga0070663_100105850
428 Ga0070678_100100910
429 Ga0070678_101520510
430 Ga0070678_102175543
431 Ga0070662_100660759
432 Ga0070662_101271606
433 Ga0070681_10129745
434 Ga0068867_100316874
435 Ga0068867_101348065
436 Ga0070685_10003722
437 Ga0070707_100281177
438 Ga0070707_101370118
439 Ga0070679_101594986
440 Ga0070684_101949375
441 Ga0070672_100372698
442 Ga0070686_100491930
443 Ga0070665_100085145
444 Ga0070665_100279260
445 Ga0070665_100330960
446 Ga0070665_100610105
447 Ga0070665_100683080
448 Ga0070704_100288868
449 Ga0070664_100764619
450 Ga0068857_100237209
451 Ga0068857_100535016
452 Ga0068857_100930730
453 Ga0068857_101036129
454 Ga0068854_101431239
455 Ga0068859_100159336
456 Ga0068859_100171634
457 Ga0068859_100927540
458 Ga0068864_101672995
459 Ga0068864_102245504
460 Ga0068861_100188907
461 Ga0068861_100569103
462 Ga0068861_101298242
463 Ga0068870_10990835
464 Ga0068863_100014318
465 Ga0068860_100015570
466 Ga0068860_101433132
467 Ga0068862_100093267
468 Ga0068862_100355741
469 Ga0068862_102767229
470 Ga0075365_10043766
471 Ga0075365_10698238
472 Ga0075368_10013656
473 Ga0075363_100321220
474 Ga0075364_10090364
475 Ga0075364_10660163
476 Ga0075432_10267399
477 Ga0075432_10423424
478 Ga0075362_10233378
479 Ga0075367_10010254
480 Ga0075367_10310999
481 Ga0075367_10436777
482 Ga0075367_11122431
483 Ga0075366_10024002
484 Ga0075366_10032711
485 Ga0075366_10392343
486 Ga0075370_10061661
487 Ga0075370_10128325
488 Ga0075428_100008353
489 Ga0075428_100084817
490 Ga0075428_101174048
491 Ga0075428_101958419
492 Ga0075430_100000681
493 Ga0075430_100004981
494 Ga0075430_100178021
495 Ga0075430_100301431
496 Ga0075430_101208777
497 Ga0075431_100029075
498 Ga0075431_100063418
499 Ga0075431_100082805
500 Ga0075431_100133653
501 Ga0075431_100209717
502 Ga0075431_100290361
503 Ga0075431_100541198
504 Ga0075433_10007201
505 Ga0075433_10039468
506 Ga0075433_10229861
507 Ga0075433_10263348
508 Ga0075434_100006570
509 Ga0075434_101038864
510 Ga0075434_101059136
511 Ga0075429_100003633
512 Ga0075429_100014929
513 Ga0075429_100050742
514 Ga0075429_100077310
515 Ga0075429_100680295
516 Ga0075429_100693739
517 Ga0075429_101821110
518 Ga0068865_100203011
519 Ga0068865_100691057
520 Ga0097620_100159329
521 Ga0097620_100171623
522 Ga0097620_100927549
523 Ga0111539_10000321
524 Ga0111539_10508151
525 Ga0111539_11030254
526 Ga0111539_11047861
527 Ga0111539_12492335
528 Ga0105247_10033036
529 Ga0105247_10991259
530 Ga0114129_10000755
531 Ga0114129_10011564
532 Ga0114129_10047359
533 Ga0114129_10204832
534 Ga0114129_10303572
535 Ga0114129_11235887
536 Ga0105243_12947391
537 Ga0105243_13063699
538 Ga0105238_10338815
539 Ga0105249_12705391
540 Ga0157374_11637936
541 Ga0157380_10067734
542 Ga0157380_10781785
543 Ga0157380_12639577
544 Ga0163161_10093382
545 Ga0207697_10038974
546 Ga0207697_10096437
547 Ga0207710_10720774
548 Ga0207688_10590082
549 Ga0207688_10935828
550 Ga0207680_10041011
551 Ga0207647_10667015
552 Ga0207645_10196816
553 Ga0207645_10538688
554 Ga0207707_10103019
555 Ga0207662_10001874
556 Ga0207646_10192526
557 Ga0207681_10004429
558 Ga0207681_11095329
559 Ga0207650_10930742
560 Ga0207659_10228466
561 Ga0207659_10261859
562 Ga0207659_11405177
563 Ga0207659_11741714
564 Ga0207700_10349721
565 Ga0207700_10466541
566 Ga0207706_10857734
567 Ga0207706_10890254
568 Ga0207706_11158006
569 Ga0207709_10837439
570 Ga0207709_10913932
571 Ga0207669_10093977
572 Ga0207669_10640756
573 Ga0207704_10401796
574 Ga0207704_10474923
575 Ga0207704_11912003
576 Ga0207689_10988355
577 Ga0207661_10900759
578 Ga0207651_10886407
579 Ga0207712_10647195
580 Ga0207712_11089489
581 Ga0207668_10108178
582 Ga0207668_11075385
583 Ga0207668_11705365
584 Ga0207640_11969814
585 Ga0207658_10653756
586 Ga0207708_10010171
587 Ga0207708_10025249
588 Ga0207708_10656078
589 Ga0207708_11770762
590 Ga0207641_10005608
591 Ga0207648_10305827
592 Ga0207648_10431492
593 Ga0207648_10492611
594 Ga0207676_12122053
595 Ga0207674_10216758
596 Ga0207674_10511794
597 Ga0207674_11159527
598 Ga0207674_11221182
599 Ga0207675_100024424
600 Ga0207683_10009069
601 Ga0209984_1021216
602 Ga0209813_10061940
603 Ga0209974_10374650
604 Ga0207428_10075919
605 Ga0207428_10966248
606 Ga0268266_10862863
607 Ga0268266_11323324
608 Ga0268265_10087786
609 Ga0268265_10466541
610 Ga0268265_11277550
611 Ga0268265_12041649
612 Ga0268264_10807922
613 Ga0307408_100021378
614 Ga0307408_100102198
615 Ga0307408_100323679
616 Ga0307408_101054939
617 Ga0307405_11302738
618 Ga0307413_10279253
619 Ga0307413_10553650
620 Ga0307410_10143337
621 Ga0307410_10291653
622 Ga0307410_10569790
623 Ga0307406_10022516
624 Ga0307406_10305559
625 Ga0307406_10804316
626 Ga0307407_10049538
627 Ga0307407_11149981
628 Ga0307412_10015388
629 Ga0307412_10050670
630 Ga0307412_10236913
631 Ga0307412_10278896
632 Ga0307409_100543482
633 Ga0307409_101827354
634 Ga0307409_102473706
635 Ga0307416_100112433
636 Ga0307416_100280289
637 Ga0307416_100356916
638 Ga0307416_100407846
639 Ga0307416_100451336
640 Ga0307416_100996533
641 Ga0307416_101148436
642 Ga0307416_102290931
643 Ga0307416_102555477
644 Ga0307414_10257648
645 Ga0307411_10012303
646 Ga0307411_10295520
647 Ga0307415_100947911
648 Ga0373928_0220263
649 Ga0373934_0148549
650 Ga0373962_0296290
651 Ga0373933_0068403
652 Ga0373937_0002495
653 Ga0395905_1293390
654 Ga0451789_0573275
655 Ga0451800_0416767
656 Ga0439450_123715
657 Ga0439435_0350571
658 Ga0439459_0046051
659 Ga0495638_0006636
660 Ga0496110_0299090
661 Ga0496111_1201729
662 Ga0501292_039206
663 Ga0501299_002185
664 Ga0501031_0008879
665 Ga0501031_0239315
666 Ga0501032_0000819
667 Ga0501032_0036011
668 Ga0501033_0271224
669 Ga0501034_0010117
670 Ga0501034_0125090
671 Ga0501034_0473513
672 Ga0501034_0535563
673 Ga0501036_0015605
674 Ga0501036_0153605
675 Ga0501036_0769894
676 Ga0501037_0243067
677 Ga0501037_0546009
678 Ga0501038_0004894
679 Ga0501038_0017158
680 Ga0501038_0583278
681 Ga0501038_1405809
682 Ga0501039_0004885
683 Ga0501040_0853884
684 Ga0501041_0718394
685 Ga0501042_0219504
686 Ga0501042_0402494
687 Ga0501042_0553219
688 Ga0501043_0003065
689 Ga0501043_0059442
690 Ga0501043_0191901
691 Ga0501043_0259844
692 Ga0501043_0974982
693 Ga0501046_0016525
694 Ga0501046_0051109
695 Ga0501046_0312283
696 Ga0501047_0000887
697 Ga0501047_0079748
698 Ga0501048_0164547
699 Ga0501048_0167606
700 Ga0501067_0035728
701 Ga0501068_0008151
702 Ga0501068_0226249
703 Ga0501068_0422852
704 Ga0501069_0030941
705 Ga0501071_0755615
706 Ga0501071_0948963
707 Ga0501071_0998914
708 Ga0501072_0124486
709 Ga0501072_0132600
710 Ga0501072_1146150
711 Ga0501073_0013656
712 Ga0501073_0139423
713 Ga0501073_0284624
714 Ga0501073_0332275
715 Ga0501074_0905798
716 Ga0501076_0491617
717 Ga0501076_1587588
718 Ga0501077_0016139
719 Ga0501077_0141787
720 Ga0501077_0613829
721 Ga0501202_051555
722 Ga0501217_029092
723 Ga0501233_028045
724 Ga0501247_083913
725 Ga0501080_0127194
726 Ga0501080_0857935
727 Ga0501081_0132625
728 Ga0501083_0004372
729 Ga0501083_0433885
730 Ga0501083_0523871
731 Ga0501268_015412
732 Ga0501035_0299032
733 Ga0501035_0809135
734 Ga0501044_0002370
735 Ga0501044_0052738
736 nmdc:mga03683_308342_c1
737 nmdc:mga03n38_248356_c1
738 nmdc:mga00v17_57851_c1
739 nmdc:mga00v17_695702_c1
740 nmdc:mga0yw44_154473_c1
741 nmdc:mga0yw44_800608_c1
742 nmdc:mga0k408_102076_c1
743 nmdc:mga0k408_57561_c1
744 nmdc:mga04h51_47485_c1
745 nmdc:mga04h51_61083_c1
746 nmdc:mga07m45_442812_c1
747 nmdc:mga05p37_12120_c1
748 nmdc:mga05p37_32688_c1
749 nmdc:mga05p37_930715_c1
750 nmdc:mga09592_39371_c1
751 nmdc:mga09592_715907_c1
752 nmdc:mga0qj67_1022846_c1
753 nmdc:mga0qj67_79203_c1
754 nmdc:mga06r32_1233217_c1
755 nmdc:mga06r32_221620_c1
756 nmdc:mga06r32_25313_c1
757 nmdc:mga06r32_405600_c1
758 nmdc:mga08y16_1695976_c1
759 nmdc:mga08y16_248717_c1
760 nmdc:mga08y16_38056_c1
761 nmdc:mga08y16_397991_c1
762 nmdc:mga0n895_387348_c1
763 nmdc:mga0a205_217755_c1
764 nmdc:mga0a205_594261_c1
765 Ga0500646_0056333
766 Ga0500651_0193498
767 Ga0500555_000263
768 Ga0500645_000044
769 Ga0501084_0093371
770 Ga0590071_004188
771 Ga0590074_000301
772 Ga0590075_000248
773 Ga0590077_000289
774 Ga0501082_0009833
775 Ga0501082_0016034
776 Ga0501082_0054716
777 Ga0501082_0212716
778 Ga0501082_0372121
779 Ga0501082_1049790
780 Ga0530510_0272573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9392 10 103
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9356 10 103
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9352 10 105
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8968 4 107
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8916 3 107
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9356 10 103 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9227 9 105 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9155 9 102 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8991 8 105 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8934 16 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7S7SQC6-F1-model_v4 PadR family transcriptional regulator 0.9973 10 106
AF-A0A843S070-F1-model_v4 PadR family transcriptional regulator 0.9963 9 106
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.9951 15 106
AF-A0A848X716-F1-model_v4 PadR family transcriptional regulator 0.995 9 106
AF-A0A522T5M2-F1-model_v4 PadR family transcriptional regulator 0.9947 9 107

Map