F431975

General Info

Members Datasets Scaffolds Average Seq Length
391 233 379 180

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100145656|Ga0068864_1001456562
Length 210
Sequence MSFLDRTGACYRLGAKDEIPLSKRRMGITVDGVRQPTLFLTVGLPCTGKTTAARRIEIEHKALRLTKDEWVKALYGHENPPSAQDVIEGRLIEIGLRALELGTNVVVDYGLWGRDERSALRQAAADVGATVELRYFEITPAEQRRRIDRRQAEAPHTTWPISDEELAEWAATIDILTPGELDGSEPVDDPPAGFATWDDWRRHRWPPSVY

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
3 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
4 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
5 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
6 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
7 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
8 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
9 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
10 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
11 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.77
Isolates 3.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 18.16
Rhizosphere 72.63
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1072592 3300003578 Bacteria 1609
2 Ga0070658_10738094 3300005327 Bacteria 855
3 Ga0070683_101085724 3300005329 Bacteria 769
4 Ga0068869_100041342 3300005334 Bacteria 3301
5 Ga0070680_100256732 3300005336 Bacteria 1478
6 Ga0070691_10209460 3300005341 Bacteria 1028
7 Ga0070661_100057795 3300005344 Bacteria 2842
8 Ga0070661_100648040 3300005344 Bacteria 857
9 Ga0070669_100303281 3300005353 Bacteria 1285
10 Ga0070675_100005056 3300005354 Bacteria 10070
11 Ga0070671_100140667 3300005355 Bacteria 2037
12 Ga0070659_100164369 3300005366 Bacteria 1816
13 Ga0070714_100000100 3300005435 Bacteria 73241
14 Ga0070714_100003188 3300005435 Bacteria 12195
15 Ga0070700_100031288 3300005441 Bacteria 3187
16 Ga0070663_100196533 3300005455 Bacteria 1572
17 Ga0070678_100275282 3300005456 Bacteria 1421
18 Ga0070678_100901906 3300005456 Bacteria 808
19 Ga0068867_100118697 3300005459 Bacteria 2041
20 Ga0070706_100053741 3300005467 Bacteria 3717
21 Ga0070698_100024459 3300005471 Bacteria 6302
22 Ga0070684_100015051 3300005535 Bacteria 6285
23 Ga0070684_100282014 3300005535 Bacteria 1522
24 Ga0070695_100087844 3300005545 Bacteria 2069
25 Ga0070696_100036557 3300005546 Bacteria 3386
26 Ga0070693_100156633 3300005547 Bacteria 1447
27 Ga0070664_100004428 3300005564 Bacteria 11284
28 Ga0068857_100067516 3300005577 Bacteria 3183
29 Ga0068854_100176480 3300005578 Bacteria 1666
30 Ga0068856_100162711 3300005614 Bacteria 2243
31 Ga0068852_100000660 3300005616 Bacteria 22572
32 Ga0068864_100145656 3300005618 Bacteria 2141
33 Ga0068870_10335649 3300005840 Bacteria 965
34 Ga0081455_10635781 3300005937 Bacteria 690
35 Ga0075365_10013554 3300006038 Bacteria 4882
36 Ga0075365_10027535 3300006038 Bacteria 3618
37 Ga0075365_10087572 3300006038 Bacteria 2118
38 Ga0075365_10159563 3300006038 Bacteria 1571
39 Ga0075365_10256722 3300006038 Bacteria 1229
40 Ga0075365_10337387 3300006038 Bacteria 1062
41 Ga0075370_10248083 3300006353 Bacteria 1055
42 Ga0075430_100034841 3300006846 Bacteria 4274
43 Ga0075431_100003964 3300006847 Bacteria 14422
44 Ga0075429_100027552 3300006880 Bacteria 4932
45 Ga0099794_10162539 3300007265 Bacteria 1136
46 Ga0111539_10010992 3300009094 Bacteria 11394
47 Ga0111539_10012913 3300009094 Bacteria 10451
48 Ga0111539_10029547 3300009094 Bacteria 6674
49 Ga0105245_10408965 3300009098 Bacteria 1358
50 Ga0105245_11135486 3300009098 Bacteria 828
51 Ga0105245_11178321 3300009098 Bacteria 814
52 Ga0105247_10359704 3300009101 Bacteria 1026
53 Ga0114129_10005441 3300009147 Bacteria 17996
54 Ga0114129_10277167 3300009147 Bacteria 2241
55 Ga0114129_10632161 3300009147 Bacteria 1383
56 Ga0105243_10013416 3300009148 Bacteria 6197
57 Ga0105243_10895841 3300009148 Bacteria 882
58 Ga0105243_11019561 3300009148 Bacteria 831
59 Ga0105243_11422883 3300009148 Bacteria 715
60 Ga0105241_10412854 3300009174 Bacteria 1186
61 Ga0105238_10189336 3300009551 Bacteria 2034
62 Ga0105249_10261807 3300009553 Bacteria 1719
63 Ga0105239_10032728 3300010375 Bacteria 5713
64 Ga0157373_10532989 3300013100 Bacteria 850
65 Ga0157370_10218710 3300013104 Bacteria 1764
66 Ga0157369_10419999 3300013105 Bacteria 1386
67 Ga0157369_11590062 3300013105 Bacteria 665
68 Ga0157372_10000031 3300013307 Bacteria 178827
69 Ga0157372_10083357 3300013307 Bacteria 3621
70 Ga0157372_10265513 3300013307 Bacteria 1993
71 Ga0157372_10350555 3300013307 Bacteria 1720
72 Ga0157372_12347153 3300013307 Bacteria 613
73 Ga0163163_10792053 3300014325 Bacteria 1011
74 Ga0157380_10228496 3300014326 Bacteria 1669
75 Ga0157380_11648758 3300014326 Bacteria 698
76 Ga0157377_10002762 3300014745 Bacteria 7817
77 Ga0157379_10088708 3300014968 Bacteria 2774
78 Ga0157379_10620225 3300014968 Bacteria 1011
79 Ga0163161_10263777 3300017792 Bacteria 1346
80 Ga0154015_1304478 3300020610 Bacteria 2066
81 Ga0207688_10116783 3300025901 Bacteria 1554
82 Ga0207645_10040109 3300025907 Bacteria 2999
83 Ga0207643_10145268 3300025908 Bacteria 1419
84 Ga0207684_10266452 3300025910 Bacteria 1478
85 Ga0207693_10208824 3300025915 Bacteria 1535
86 Ga0207660_10073559 3300025917 Bacteria 2492
87 Ga0207649_10050663 3300025920 Bacteria 2569
88 Ga0207652_10331229 3300025921 Bacteria 1375
89 Ga0207652_10643757 3300025921 Bacteria 948
90 Ga0207681_10276225 3300025923 Bacteria 1321
91 Ga0207694_10326001 3300025924 Bacteria 1268
92 Ga0207659_10029947 3300025926 Bacteria 3713
93 Ga0207687_10266055 3300025927 Bacteria 1369
94 Ga0207664_10000002 3300025929 Bacteria 657053
95 Ga0207644_10288583 3300025931 Bacteria 1319
96 Ga0207706_10083551 3300025933 Bacteria 2807
97 Ga0207706_10759367 3300025933 Bacteria 826
98 Ga0207704_10201639 3300025938 Bacteria 1457
99 Ga0207691_10306075 3300025940 Bacteria 1364
100 Ga0207711_10019635 3300025941 Bacteria 5626
101 Ga0207689_10010933 3300025942 Bacteria 7802
102 Ga0207661_10318004 3300025944 Bacteria 1399
103 Ga0207661_10461230 3300025944 Bacteria 1158
104 Ga0207679_10034139 3300025945 Bacteria 3587
105 Ga0207640_10707975 3300025981 Bacteria 864
106 Ga0207677_10046706 3300026023 Bacteria 2901
107 Ga0207639_10301839 3300026041 Bacteria 1416
108 Ga0207678_10184531 3300026067 Bacteria 1781
109 Ga0207678_10198496 3300026067 Bacteria 1715
110 Ga0207708_10014726 3300026075 Bacteria 5852
111 Ga0207702_10135413 3300026078 Bacteria 2222
112 Ga0207676_10166468 3300026095 Bacteria 1916
113 Ga0207674_10022452 3300026116 Bacteria 6773
114 Ga0207674_10730787 3300026116 Bacteria 955
115 Ga0207683_10335076 3300026121 Bacteria 1387
116 Ga0207698_11167753 3300026142 Bacteria 783
117 Ga0207428_10009399 3300027907 Bacteria 8770
118 Ga0268265_10013642 3300028380 Bacteria 5527
119 Ga0268265_11125101 3300028380 Unclassified 780
120 Ga0265336_10009820 3300028666 Bacteria 3297
121 Ga0307517_10028286 3300028786 Bacteria 6691
122 Ga0307515_10025527 3300028794 Bacteria 10216
123 Ga0307515_10256567 3300028794 Bacteria 1492
124 Ga0265760_10112123 3300031090 Bacteria 869
125 Ga0307513_10106505 3300031456 Bacteria 2809
126 Ga0307408_100474268 3300031548 Bacteria 1090
127 Ga0307408_101339447 3300031548 Bacteria 672
128 Ga0307405_10002289 3300031731 Bacteria 8387
129 Ga0307405_10084982 3300031731 Bacteria 2079
130 Ga0307413_10025154 3300031824 Bacteria 3259
131 Ga0307413_10044898 3300031824 Bacteria 2615
132 Ga0307413_10142384 3300031824 Bacteria 1659
133 Ga0307518_10306229 3300031838 Bacteria 961
134 Ga0307410_10021039 3300031852 Bacteria 4005
135 Ga0307410_10027069 3300031852 Bacteria 3620
136 Ga0307410_11077825 3300031852 Bacteria 696
137 Ga0307406_10001055 3300031901 Bacteria 15360
138 Ga0307406_10233224 3300031901 Bacteria 1376
139 Ga0307406_11027833 3300031901 Bacteria 708
140 Ga0307407_10183549 3300031903 Bacteria 1388
141 Ga0307407_10376367 3300031903 Bacteria 1012
142 Ga0307412_10961850 3300031911 Bacteria 752
143 Ga0307409_100021456 3300031995 Bacteria 4428
144 Ga0307409_100049964 3300031995 Bacteria 3191
145 Ga0307409_100153818 3300031995 Bacteria 2001
146 Ga0307409_100365563 3300031995 Bacteria 1366
147 Ga0307409_100684588 3300031995 Bacteria 1023
148 Ga0307409_101648957 3300031995 Bacteria 670
149 Ga0307409_102099325 3300031995 Bacteria 595
150 Ga0307416_100517736 3300032002 Bacteria 1260
151 Ga0307416_101038267 3300032002 Bacteria 923
152 Ga0307414_10026228 3300032004 Bacteria 3748
153 Ga0307411_10050189 3300032005 Bacteria 2716
154 Ga0307415_100001171 3300032126 Bacteria 12262
155 Ga0307415_100101281 3300032126 Bacteria 2113
156 Ga0307415_100191086 3300032126 Bacteria 1616
157 Ga0307415_100277356 3300032126 Bacteria 1377
158 Ga0373923_0089298 3300035111 Bacteria 1346
159 Ga0373953_0104354 3300035117 Bacteria 1195
160 Ga0373957_0361829 3300035120 Bacteria 621
161 Ga0373955_0207789 3300035172 Bacteria 1167
162 Ga0373935_1008473 3300035692 Bacteria 618
163 Ga0373927_0478997 3300035695 Bacteria 822
164 Ga0373933_0635217 3300035724 Bacteria 702
165 Ga0373947_0029836 3300035725 Bacteria 3202
166 Ga0373937_1019041 3300036401 Bacteria 777
167 Ga0242420_016625 3300038996 Bacteria 1283
168 Ga0451789_0355673 3300041443 Bacteria 762
169 Ga0451795_0713340 3300041456 Bacteria 680
170 Ga0451802_0666249 3300041460 Bacteria 1372
171 Ga0451807_1935486 3300041486 Bacteria 968
172 Ga0451833_0145802 3300041491 Bacteria 942
173 Ga0451837_0169009 3300041494 Bacteria 900
174 Ga0451853_0311556 3300041512 Bacteria 1287
175 Ga0451853_2618283 3300041512 Bacteria 861
176 Ga0439464_0042943 3300042439 Bacteria 1292
177 Ga0466966_0154138 3300044684 Bacteria 1400
178 Ga0466961_0056268 3300044693 Bacteria 2506
179 Ga0466961_0348264 3300044693 Bacteria 902
180 Ga0466963_0013185 3300044694 Bacteria 5072
181 Ga0466963_0016373 3300044694 Bacteria 4610
182 Ga0466963_0029401 3300044694 Bacteria 3537
183 Ga0466963_0131378 3300044694 Bacteria 1730
184 Ga0466964_0082059 3300044706 Bacteria 1386
185 Ga0466957_0063091 3300044842 Bacteria 2277
186 Ga0466957_0321427 3300044842 Bacteria 1044
187 Ga0466957_0534180 3300044842 Bacteria 816
188 Ga0466957_1190457 3300044842 Bacteria 551
189 Ga0466960_0012794 3300044901 Bacteria 3550
190 Ga0466958_0013357 3300045836 Bacteria 4674
191 Ga0466958_0119281 3300045836 Bacteria 1651
192 Ga0466958_0380236 3300045836 Bacteria 910
193 Ga0466967_0002863 3300045976 Bacteria 10963
194 Ga0466967_0028586 3300045976 Bacteria 4656
195 Ga0466967_0109264 3300045976 Bacteria 2539
196 Ga0466967_0130594 3300045976 Bacteria 2331
197 Ga0466967_0151952 3300045976 Bacteria 2165
198 Ga0466967_0190207 3300045976 Bacteria 1939
199 Ga0466967_0197224 3300045976 Bacteria 1905
200 Ga0466967_0199389 3300045976 Bacteria 1895
201 Ga0466967_0287540 3300045976 Bacteria 1578
202 Ga0466967_0491291 3300045976 Bacteria 1203
203 Ga0466967_0664909 3300045976 Bacteria 1031
204 Ga0466967_0705988 3300045976 Bacteria 999
205 Ga0466967_0743370 3300045976 Bacteria 973
206 Ga0466967_0793457 3300045976 Bacteria 940
207 Ga0466967_0972132 3300045976 Bacteria 845
208 Ga0466967_1431011 3300045976 Bacteria 688
209 Ga0466967_1874139 3300045976 Bacteria 596
210 Ga0495592_0341400 3300046454 Bacteria 963
211 Ga0495629_0000580 3300046459 Bacteria 29719
212 Ga0495629_0239163 3300046459 Bacteria 1250
213 Ga0495638_0067557 3300046460 Bacteria 2194
214 Ga0495641_0017451 3300046461 Bacteria 3741
215 Ga0495641_0021327 3300046461 Bacteria 3261
216 Ga0495653_0104299 3300046463 Bacteria 2049
217 Ga0495580_0197577 3300046472 Bacteria 1386
218 Ga0495582_0003386 3300046473 Bacteria 8975
219 Ga0495664_0179962 3300046477 Bacteria 1282
220 Ga0495585_0260722 3300046492 Bacteria 862
221 Ga0495606_0007931 3300046507 Bacteria 9358
222 Ga0495618_0130780 3300046514 Bacteria 1606
223 Ga0495628_0383983 3300046516 Bacteria 1028
224 Ga0495630_0427710 3300046517 Bacteria 1014
225 Ga0495632_0030626 3300046519 Bacteria 2791
226 Ga0495666_0191773 3300046526 Bacteria 941
227 Ga0495652_0130308 3300046529 Bacteria 1992
228 Ga0495665_0045795 3300046531 Bacteria 2324
229 Ga0495665_0123552 3300046531 Bacteria 1355
230 Ga0495640_0140955 3300046533 Bacteria 1554
231 Ga0495645_0741924 3300046543 Bacteria 593
232 Ga0495667_0489896 3300046559 Bacteria 770
233 Ga0495656_0241628 3300046615 Unclassified 909
234 Ga0495656_0525881 3300046615 Bacteria 629
235 Ga0495668_0001279 3300046616 Bacteria 24933
236 Ga0495634_0198736 3300046642 Bacteria 1246
237 Ga0495625_0001034 3300046660 Bacteria 36610
238 Ga0495635_0133447 3300046663 Bacteria 1692
239 Ga0495588_0127622 3300046674 Bacteria 1342
240 Ga0495657_0201171 3300046675 Bacteria 1214
241 Ga0495657_0204338 3300046675 Bacteria 1203
242 Ga0495647_0130460 3300046681 Bacteria 1064
243 Ga0495658_0011541 3300046683 Bacteria 4447
244 Ga0495658_0259248 3300046683 Bacteria 1094
245 Ga0495658_0292853 3300046683 Bacteria 1029
246 Ga0495613_0008060 3300046689 Bacteria 7834
247 Ga0495613_0111126 3300046689 Bacteria 1974
248 Ga0495624_0072387 3300046690 Bacteria 2144
249 Ga0495674_0372986 3300047319 Bacteria 1155
250 Ga0495676_0165376 3300047321 Bacteria 1561
251 Ga0495680_0424269 3300047322 Bacteria 914
252 Ga0495683_0034203 3300047323 Bacteria 2585
253 Ga0495684_0285894 3300047471 Bacteria 1188
254 Ga0495593_0120491 3300047673 Bacteria 1335
255 Ga0495602_0514446 3300048088 Bacteria 835
256 Ga0495626_0000284 3300048091 Bacteria 55286
257 Ga0496100_0003778 3300048903 Bacteria 7925
258 Ga0496100_0010866 3300048903 Bacteria 5166
259 Ga0496100_0202570 3300048903 Bacteria 1447
260 Ga0496100_0391315 3300048903 Bacteria 1057
261 Ga0496101_0002618 3300048904 Bacteria 11063
262 Ga0496101_0010687 3300048904 Bacteria 6067
263 Ga0496101_0011986 3300048904 Bacteria 5776
264 Ga0496101_0568417 3300048904 Unclassified 896
265 Ga0496102_0006268 3300048905 Bacteria 10141
266 Ga0496102_0026963 3300048905 Bacteria 5130
267 Ga0496103_0003996 3300048906 Bacteria 8960
268 Ga0496103_0095925 3300048906 Bacteria 1874
269 Ga0496103_0150708 3300048906 Bacteria 1490
270 Ga0496103_0308071 3300048906 Bacteria 1019
271 Ga0496104_0003578 3300048907 Bacteria 13414
272 Ga0496104_0026862 3300048907 Bacteria 5321
273 Ga0496104_0069993 3300048907 Bacteria 3335
274 Ga0496104_0071263 3300048907 Bacteria 3304
275 Ga0496104_0813336 3300048907 Bacteria 840
276 Ga0496104_0841057 3300048907 Bacteria 823
277 Ga0496105_0002751 3300048908 Bacteria 12837
278 Ga0496105_0009932 3300048908 Bacteria 7466
279 Ga0496105_0021192 3300048908 Bacteria 5258
280 Ga0496105_0077760 3300048908 Bacteria 2740
281 Ga0496105_0083328 3300048908 Bacteria 2641
282 Ga0496105_0149142 3300048908 Bacteria 1923
283 Ga0496105_0376951 3300048908 Unclassified 1129
284 Ga0496106_0019215 3300048909 Bacteria 5067
285 Ga0496106_0156305 3300048909 Bacteria 1801
286 Ga0496106_0183005 3300048909 Bacteria 1664
287 Ga0496106_0286452 3300048909 Bacteria 1320
288 Ga0496106_0681739 3300048909 Bacteria 820
289 Ga0496107_0001608 3300048910 Bacteria 14073
290 Ga0496107_0021595 3300048910 Bacteria 4550
291 Ga0496107_0036339 3300048910 Bacteria 3533
292 Ga0496107_0038903 3300048910 Bacteria 3411
293 Ga0496108_0042423 3300048911 Bacteria 3798
294 Ga0496108_0141553 3300048911 Bacteria 2072
295 Ga0496108_0686483 3300048911 Bacteria 888
296 Ga0496109_0040864 3300048912 Bacteria 4201
297 Ga0496109_0084587 3300048912 Bacteria 2927
298 Ga0496109_0086186 3300048912 Bacteria 2900
299 Ga0496109_0193818 3300048912 Bacteria 1909
300 Ga0496109_0243842 3300048912 Bacteria 1692
301 Ga0496109_0550424 3300048912 Bacteria 1088
302 Ga0496110_0140680 3300048913 Bacteria 2182
303 Ga0496110_0339696 3300048913 Bacteria 1368
304 Ga0496110_0558609 3300048913 Bacteria 1040
305 Ga0496110_0806202 3300048913 Bacteria 843
306 Ga0496110_0963749 3300048913 Bacteria 760
307 Ga0496111_0078638 3300048914 Bacteria 2405
308 Ga0496111_0569541 3300048914 Bacteria 831
309 Ga0496111_0633281 3300048914 Bacteria 781
310 Ga0496112_0265685 3300048915 Bacteria 1665
311 Ga0496112_0704313 3300048915 Bacteria 938
312 Ga0496113_0032186 3300048916 Bacteria 3810
313 Ga0496113_0299695 3300048916 Bacteria 1287
314 Ga0496114_0049481 3300048917 Bacteria 3497
315 Ga0496114_0057911 3300048917 Bacteria 3235
316 Ga0496114_0061449 3300048917 Bacteria 3142
317 Ga0496114_0094729 3300048917 Bacteria 2540
318 Ga0496114_0140537 3300048917 Bacteria 2090
319 Ga0496114_0163932 3300048917 Bacteria 1934
320 Ga0496114_0956291 3300048917 Bacteria 739
321 Ga0496114_1129294 3300048917 Bacteria 669
322 Ga0496115_0001157 3300048918 Bacteria 19008
323 Ga0496115_0051134 3300048918 Bacteria 3313
324 Ga0496124_0240925 3300048927 Bacteria 1345
325 Ga0501036_0010121 3300049572 Bacteria 7771
326 Ga0501038_0114725 3300049574 Bacteria 2228
327 Ga0501039_0038527 3300049575 Bacteria 3691
328 Ga0501039_0070916 3300049575 Bacteria 2707
329 Ga0501039_0302480 3300049575 Bacteria 1257
330 Ga0501039_0514007 3300049575 Bacteria 940
331 Ga0501040_0303636 3300049576 Bacteria 1141
332 Ga0501041_0098532 3300049577 Bacteria 1808
333 Ga0501042_0060569 3300049578 Bacteria 2704
334 Ga0501042_0095748 3300049578 Bacteria 2133
335 Ga0501042_0299919 3300049578 Bacteria 1161
336 Ga0501043_0346762 3300049579 Bacteria 1129
337 Ga0501048_0103996 3300049582 Bacteria 2004
338 Ga0501048_0627544 3300049582 Bacteria 772
339 Ga0501069_0306349 3300049585 Bacteria 932
340 Ga0501071_0270907 3300049587 Bacteria 1284
341 Ga0501072_0067727 3300049588 Bacteria 2817
342 Ga0501072_0109942 3300049588 Bacteria 2194
343 Ga0501074_0625904 3300049590 Bacteria 761
344 Ga0501075_0084127 3300049591 Bacteria 2409
345 Ga0501075_0202203 3300049591 Bacteria 1515
346 Ga0501075_0554395 3300049591 Bacteria 877
347 Ga0501077_0278694 3300049593 Bacteria 1064
348 Ga0501202_008655 3300049652 Bacteria 1858
349 Ga0501079_0471661 3300049741 Bacteria 986
350 Ga0501045_0046598 3300049824 Bacteria 3157
351 Ga0501045_0088249 3300049824 Bacteria 2291
352 Ga0501045_0175382 3300049824 Bacteria 1597
353 nmdc:mga0yw44_103079_c1 3300050492 Unclassified 1004
354 nmdc:mga0yw44_146154_c1 3300050492 Bacteria 1539
355 nmdc:mga0yw44_289719_c1 3300050492 Bacteria 1095
356 nmdc:mga0yw44_39827_c1 3300050492 Bacteria 2788
357 nmdc:mga0yw44_9894_c1 3300050492 Bacteria 4845
358 nmdc:mga05p37_1092_c1 3300050507 Bacteria 31135
359 nmdc:mga05p37_32345_c1 3300050507 Bacteria 6397
360 nmdc:mga05p37_82620_c1 3300050507 Bacteria 3959
361 nmdc:mga09592_221_c1 3300050508 Bacteria 40980
362 nmdc:mga0qj67_29236_c1 3300050509 Bacteria 4280
363 nmdc:mga06r32_1732_c1 3300050510 Bacteria 19636
364 nmdc:mga06r32_32036_c1 3300050510 Bacteria 4941
365 nmdc:mga08y16_108143_c1 3300050511 Bacteria 2895
366 nmdc:mga08y16_1330_c1 3300050511 Bacteria 24618
367 nmdc:mga08y16_93928_c1 3300050511 Bacteria 3125
368 nmdc:mga0a205_346827_c1 3300050515 Bacteria 1353
369 Ga0495601_0173982 3300053077 Bacteria 1407
370 Ga0495595_0234204 3300053084 Bacteria 918
371 Ga0495619_0076316 3300053085 Bacteria 2250
372 Ga0500646_0003668 3300053090 Bacteria 3931
373 Ga0500583_0116042 3300053092 Bacteria 1322
374 Ga0500617_133934 3300053124 Bacteria 1004
375 Ga0500642_0060564 3300053130 Unclassified 1698
376 Ga0501082_0786978 3300060353 Bacteria 832
377 Ga0530510_0307912 3300061734 Bacteria 1186
378 Ga0530510_0593972 3300061734 Bacteria 842
379 Ga0530510_0827799 3300061734 Bacteria 707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028666 Ga0265336_10009820 Ga0265336_100098203 169
2 3300035120 Ga0373957_0361829 Ga0373957_0361829_22_531 169
3 3300006038 Ga0075365_10027535 Ga0075365_100275353 170
4 3300009094 Ga0111539_10029547 Ga0111539_100295475 170
5 3300025933 Ga0207706_10759367 Ga0207706_107593672 170
6 3300050511 nmdc:mga08y16_93928_c1 nmdc:mga08y16_93928_c1_2101_2640 170
7 3300044842 Ga0466957_1190457 Ga0466957_1190457_19_534 171
8 3300050492 nmdc:mga0yw44_289719_c1 nmdc:mga0yw44_289719_c1_235_756 171
9 iso_pu_bacteria 2848551377 2848554087 173
10 iso_pu_bacteria 2643221690 2644506010 174
11 iso_pu_bacteria 2818991318 2819425087 174
12 iso_pu_bacteria 2818991458 2819666761 174
13 iso_pu_bacteria 2833709550 2833713127 174
14 iso_pu_bacteria 2643221694 2644527417 175
15 iso_pu_bacteria 2643221722 2644667516 175
16 iso_pu_bacteria 2856858025 2856864626 175
17 iso_pu_bacteria 2884994152 2884997115 175
18 iso_pu_bacteria 649633069 649813849 175
19 3300048927 Ga0496124_0240925 Ga0496124_0240925_251_847 176
20 3300050492 nmdc:mga0yw44_146154_c1 nmdc:mga0yw44_146154_c1_319_855 176
21 iso_pu_bacteria 2501939600 2501943928 176
22 3300006038 Ga0075365_10337387 Ga0075365_103373872 177
23 3300013104 Ga0157370_10218710 Ga0157370_102187102 177
24 3300013105 Ga0157369_11590062 Ga0157369_115900621 177
25 3300031995 Ga0307409_101648957 Ga0307409_1016489571 177
26 3300032126 Ga0307415_100101281 Ga0307415_1001012813 177
27 3300044694 Ga0466963_0013185 Ga0466963_0013185_157_693 177
28 3300044694 Ga0466963_0016373 Ga0466963_0016373_2441_2974 177
29 3300045836 Ga0466958_0119281 Ga0466958_0119281_879_1415 177
30 3300045976 Ga0466967_0002863 Ga0466967_0002863_375_908 177
31 3300045976 Ga0466967_0197224 Ga0466967_0197224_144_677 177
32 3300045976 Ga0466967_0793457 Ga0466967_0793457_244_780 177
33 3300045976 Ga0466967_0972132 Ga0466967_0972132_71_613 177
34 3300048903 Ga0496100_0003778 Ga0496100_0003778_2730_3263 177
35 3300048904 Ga0496101_0002618 Ga0496101_0002618_3478_4011 177
36 3300048905 Ga0496102_0006268 Ga0496102_0006268_5750_6283 177
37 3300048906 Ga0496103_0003996 Ga0496103_0003996_6442_6975 177
38 3300048907 Ga0496104_0003578 Ga0496104_0003578_7378_7911 177
39 3300048908 Ga0496105_0002751 Ga0496105_0002751_10416_10949 177
40 3300048909 Ga0496106_0156305 Ga0496106_0156305_693_1226 177
41 3300048917 Ga0496114_0061449 Ga0496114_0061449_847_1380 177
42 3300003578 Ga0006562J51391_1072592 Ga0006562J51391_10725922 178
43 3300005327 Ga0070658_10738094 Ga0070658_107380942 178
44 3300005329 Ga0070683_101085724 Ga0070683_1010857241 178
45 3300005334 Ga0068869_100041342 Ga0068869_1000413422 178
46 3300005336 Ga0070680_100256732 Ga0070680_1002567322 178
47 3300005341 Ga0070691_10209460 Ga0070691_102094602 178
48 3300005344 Ga0070661_100057795 Ga0070661_1000577952 178
49 3300005344 Ga0070661_100648040 Ga0070661_1006480401 178
50 3300005353 Ga0070669_100303281 Ga0070669_1003032812 178
51 3300005354 Ga0070675_100005056 Ga0070675_1000050568 178
52 3300005355 Ga0070671_100140667 Ga0070671_1001406673 178
53 3300005366 Ga0070659_100164369 Ga0070659_1001643692 178
54 3300005435 Ga0070714_100000100 Ga0070714_10000010055 178
55 3300005435 Ga0070714_100003188 Ga0070714_10000318816 178
56 3300005441 Ga0070700_100031288 Ga0070700_1000312883 178
57 3300005455 Ga0070663_100196533 Ga0070663_1001965332 178
58 3300005456 Ga0070678_100275282 Ga0070678_1002752822 178
59 3300005456 Ga0070678_100901906 Ga0070678_1009019061 178
60 3300005459 Ga0068867_100118697 Ga0068867_1001186972 178
61 3300005467 Ga0070706_100053741 Ga0070706_1000537412 178
62 3300005471 Ga0070698_100024459 Ga0070698_1000244591 178
63 3300005535 Ga0070684_100015051 Ga0070684_1000150514 178
64 3300005535 Ga0070684_100282014 Ga0070684_1002820142 178
65 3300005545 Ga0070695_100087844 Ga0070695_1000878444 178
66 3300005546 Ga0070696_100036557 Ga0070696_1000365573 178
67 3300005547 Ga0070693_100156633 Ga0070693_1001566331 178
68 3300005564 Ga0070664_100004428 Ga0070664_10000442812 178
69 3300005577 Ga0068857_100067516 Ga0068857_1000675162 178
70 3300005578 Ga0068854_100176480 Ga0068854_1001764801 178
71 3300005614 Ga0068856_100162711 Ga0068856_1001627112 178
72 3300005616 Ga0068852_100000660 Ga0068852_1000006601 178
73 3300005618 Ga0068864_100145656 Ga0068864_1001456562 178
74 3300005840 Ga0068870_10335649 Ga0068870_103356491 178
75 3300005937 Ga0081455_10635781 Ga0081455_106357811 178
76 3300006038 Ga0075365_10013554 Ga0075365_100135543 178
77 3300006038 Ga0075365_10087572 Ga0075365_100875722 178
78 3300006038 Ga0075365_10159563 Ga0075365_101595632 178
79 3300006038 Ga0075365_10256722 Ga0075365_102567221 178
80 3300006353 Ga0075370_10248083 Ga0075370_102480832 178
81 3300006846 Ga0075430_100034841 Ga0075430_1000348413 178
82 3300006847 Ga0075431_100003964 Ga0075431_10000396410 178
83 3300006880 Ga0075429_100027552 Ga0075429_1000275525 178
84 3300007265 Ga0099794_10162539 Ga0099794_101625392 178
85 3300009094 Ga0111539_10010992 Ga0111539_1001099213 178
86 3300009094 Ga0111539_10012913 Ga0111539_1001291310 178
87 3300009098 Ga0105245_10408965 Ga0105245_104089652 178
88 3300009098 Ga0105245_11135486 Ga0105245_111354861 178
89 3300009098 Ga0105245_11178321 Ga0105245_111783211 178
90 3300009101 Ga0105247_10359704 Ga0105247_103597042 178
91 3300009147 Ga0114129_10005441 Ga0114129_100054413 178
92 3300009147 Ga0114129_10277167 Ga0114129_102771673 178
93 3300009147 Ga0114129_10632161 Ga0114129_106321612 178
94 3300009148 Ga0105243_10013416 Ga0105243_100134163 178
95 3300009148 Ga0105243_10895841 Ga0105243_108958412 178
96 3300009148 Ga0105243_11019561 Ga0105243_110195611 178
97 3300009148 Ga0105243_11422883 Ga0105243_114228832 178
98 3300009174 Ga0105241_10412854 Ga0105241_104128542 178
99 3300009551 Ga0105238_10189336 Ga0105238_101893362 178
100 3300009553 Ga0105249_10261807 Ga0105249_102618072 178
101 3300010375 Ga0105239_10032728 Ga0105239_100327284 178
102 3300013100 Ga0157373_10532989 Ga0157373_105329891 178
103 3300013105 Ga0157369_10419999 Ga0157369_104199993 178
104 3300013307 Ga0157372_10000031 Ga0157372_10000031118 178
105 3300013307 Ga0157372_10083357 Ga0157372_100833574 178
106 3300013307 Ga0157372_10265513 Ga0157372_102655132 178
107 3300013307 Ga0157372_10350555 Ga0157372_103505552 178
108 3300013307 Ga0157372_12347153 Ga0157372_123471531 178
109 3300014325 Ga0163163_10792053 Ga0163163_107920532 178
110 3300014326 Ga0157380_10228496 Ga0157380_102284962 178
111 3300014326 Ga0157380_11648758 Ga0157380_116487581 178
112 3300014745 Ga0157377_10002762 Ga0157377_1000276210 178
113 3300014968 Ga0157379_10088708 Ga0157379_100887084 178
114 3300014968 Ga0157379_10620225 Ga0157379_106202252 178
115 3300017792 Ga0163161_10263777 Ga0163161_102637773 178
116 3300020610 Ga0154015_1304478 Ga0154015_13044783 178
117 3300025901 Ga0207688_10116783 Ga0207688_101167833 178
118 3300025907 Ga0207645_10040109 Ga0207645_100401092 178
119 3300025908 Ga0207643_10145268 Ga0207643_101452682 178
120 3300025910 Ga0207684_10266452 Ga0207684_102664522 178
121 3300025915 Ga0207693_10208824 Ga0207693_102088242 178
122 3300025917 Ga0207660_10073559 Ga0207660_100735592 178
123 3300025920 Ga0207649_10050663 Ga0207649_100506632 178
124 3300025921 Ga0207652_10331229 Ga0207652_103312292 178
125 3300025921 Ga0207652_10643757 Ga0207652_106437571 178
126 3300025923 Ga0207681_10276225 Ga0207681_102762252 178
127 3300025924 Ga0207694_10326001 Ga0207694_103260012 178
128 3300025926 Ga0207659_10029947 Ga0207659_100299474 178
129 3300025927 Ga0207687_10266055 Ga0207687_102660551 178
130 3300025929 Ga0207664_10000002 Ga0207664_10000002557 178
131 3300025931 Ga0207644_10288583 Ga0207644_102885831 178
132 3300025933 Ga0207706_10083551 Ga0207706_100835512 178
133 3300025938 Ga0207704_10201639 Ga0207704_102016392 178
134 3300025940 Ga0207691_10306075 Ga0207691_103060752 178
135 3300025941 Ga0207711_10019635 Ga0207711_100196355 178
136 3300025942 Ga0207689_10010933 Ga0207689_100109333 178
137 3300025944 Ga0207661_10318004 Ga0207661_103180042 178
138 3300025944 Ga0207661_10461230 Ga0207661_104612302 178
139 3300025945 Ga0207679_10034139 Ga0207679_100341392 178
140 3300025981 Ga0207640_10707975 Ga0207640_107079751 178
141 3300026023 Ga0207677_10046706 Ga0207677_100467062 178
142 3300026041 Ga0207639_10301839 Ga0207639_103018392 178
143 3300026067 Ga0207678_10184531 Ga0207678_101845312 178
144 3300026067 Ga0207678_10198496 Ga0207678_101984962 178
145 3300026075 Ga0207708_10014726 Ga0207708_100147262 178
146 3300026078 Ga0207702_10135413 Ga0207702_101354132 178
147 3300026095 Ga0207676_10166468 Ga0207676_101664682 178
148 3300026116 Ga0207674_10022452 Ga0207674_100224523 178
149 3300026116 Ga0207674_10730787 Ga0207674_107307872 178
150 3300026121 Ga0207683_10335076 Ga0207683_103350762 178
151 3300026142 Ga0207698_11167753 Ga0207698_111677531 178
152 3300027907 Ga0207428_10009399 Ga0207428_100093993 178
153 3300028380 Ga0268265_10013642 Ga0268265_100136424 178
154 3300028380 Ga0268265_11125101 Ga0268265_111251011 178
155 3300028786 Ga0307517_10028286 Ga0307517_100282863 178
156 3300028794 Ga0307515_10025527 Ga0307515_100255276 178
157 3300028794 Ga0307515_10256567 Ga0307515_102565672 178
158 3300031090 Ga0265760_10112123 Ga0265760_101121232 178
159 3300031456 Ga0307513_10106505 Ga0307513_101065052 178
160 3300031548 Ga0307408_100474268 Ga0307408_1004742682 178
161 3300031548 Ga0307408_101339447 Ga0307408_1013394471 178
162 3300031731 Ga0307405_10002289 Ga0307405_100022892 178
163 3300031731 Ga0307405_10084982 Ga0307405_100849822 178
164 3300031824 Ga0307413_10025154 Ga0307413_100251542 178
165 3300031824 Ga0307413_10044898 Ga0307413_100448981 178
166 3300031824 Ga0307413_10142384 Ga0307413_101423842 178
167 3300031838 Ga0307518_10306229 Ga0307518_103062292 178
168 3300031852 Ga0307410_10021039 Ga0307410_100210394 178
169 3300031852 Ga0307410_10027069 Ga0307410_100270693 178
170 3300031852 Ga0307410_11077825 Ga0307410_110778251 178
171 3300031901 Ga0307406_10001055 Ga0307406_1000105514 178
172 3300031901 Ga0307406_10233224 Ga0307406_102332242 178
173 3300031901 Ga0307406_11027833 Ga0307406_110278331 178
174 3300031903 Ga0307407_10183549 Ga0307407_101835492 178
175 3300031903 Ga0307407_10376367 Ga0307407_103763673 178
176 3300031911 Ga0307412_10961850 Ga0307412_109618501 178
177 3300031995 Ga0307409_100021456 Ga0307409_1000214564 178
178 3300031995 Ga0307409_100049964 Ga0307409_1000499643 178
179 3300031995 Ga0307409_100153818 Ga0307409_1001538182 178
180 3300031995 Ga0307409_100365563 Ga0307409_1003655632 178
181 3300031995 Ga0307409_100684588 Ga0307409_1006845882 178
182 3300031995 Ga0307409_102099325 Ga0307409_1020993251 178
183 3300032002 Ga0307416_100517736 Ga0307416_1005177362 178
184 3300032002 Ga0307416_101038267 Ga0307416_1010382671 178
185 3300032004 Ga0307414_10026228 Ga0307414_100262284 178
186 3300032005 Ga0307411_10050189 Ga0307411_100501892 178
187 3300032126 Ga0307415_100001171 Ga0307415_1000011712 178
188 3300032126 Ga0307415_100191086 Ga0307415_1001910862 178
189 3300032126 Ga0307415_100277356 Ga0307415_1002773562 178
190 3300035111 Ga0373923_0089298 Ga0373923_0089298_142_681 178
191 3300035117 Ga0373953_0104354 Ga0373953_0104354_146_682 178
192 3300035172 Ga0373955_0207789 Ga0373955_0207789_195_764 178
193 3300035692 Ga0373935_1008473 Ga0373935_1008473_25_564 178
194 3300035695 Ga0373927_0478997 Ga0373927_0478997_145_684 178
195 3300035724 Ga0373933_0635217 Ga0373933_0635217_92_628 178
196 3300035725 Ga0373947_0029836 Ga0373947_0029836_110_646 178
197 3300036401 Ga0373937_1019041 Ga0373937_1019041_175_711 178
198 3300038996 Ga0242420_016625 Ga0242420_016625_515_1051 178
199 3300041443 Ga0451789_0355673 Ga0451789_0355673_156_692 178
200 3300041456 Ga0451795_0713340 Ga0451795_0713340_54_593 178
201 3300041460 Ga0451802_0666249 Ga0451802_0666249_312_848 178
202 3300041486 Ga0451807_1935486 Ga0451807_1935486_104_640 178
203 3300041491 Ga0451833_0145802 Ga0451833_0145802_288_824 178
204 3300041494 Ga0451837_0169009 Ga0451837_0169009_60_596 178
205 3300041512 Ga0451853_0311556 Ga0451853_0311556_651_1193 178
206 3300041512 Ga0451853_2618283 Ga0451853_2618283_71_607 178
207 3300042439 Ga0439464_0042943 Ga0439464_0042943_378_914 178
208 3300044684 Ga0466966_0154138 Ga0466966_0154138_434_970 178
209 3300044693 Ga0466961_0056268 Ga0466961_0056268_720_1256 178
210 3300044693 Ga0466961_0348264 Ga0466961_0348264_246_782 178
211 3300044694 Ga0466963_0029401 Ga0466963_0029401_1646_2182 178
212 3300044694 Ga0466963_0131378 Ga0466963_0131378_610_1146 178
213 3300044706 Ga0466964_0082059 Ga0466964_0082059_579_1121 178
214 3300044842 Ga0466957_0063091 Ga0466957_0063091_1211_1750 178
215 3300044842 Ga0466957_0321427 Ga0466957_0321427_282_818 178
216 3300044842 Ga0466957_0534180 Ga0466957_0534180_157_738 178
217 3300044901 Ga0466960_0012794 Ga0466960_0012794_2476_3012 178
218 3300045836 Ga0466958_0013357 Ga0466958_0013357_3631_4167 178
219 3300045836 Ga0466958_0380236 Ga0466958_0380236_134_679 178
220 3300045976 Ga0466967_0028586 Ga0466967_0028586_2594_3133 178
221 3300045976 Ga0466967_0109264 Ga0466967_0109264_1938_2474 178
222 3300045976 Ga0466967_0130594 Ga0466967_0130594_1368_1904 178
223 3300045976 Ga0466967_0151952 Ga0466967_0151952_543_1079 178
224 3300045976 Ga0466967_0190207 Ga0466967_0190207_1256_1792 178
225 3300045976 Ga0466967_0199389 Ga0466967_0199389_457_996 178
226 3300045976 Ga0466967_0287540 Ga0466967_0287540_650_1192 178
227 3300045976 Ga0466967_0491291 Ga0466967_0491291_396_935 178
228 3300045976 Ga0466967_0664909 Ga0466967_0664909_408_947 178
229 3300045976 Ga0466967_0705988 Ga0466967_0705988_275_811 178
230 3300045976 Ga0466967_0743370 Ga0466967_0743370_118_711 178
231 3300045976 Ga0466967_1431011 Ga0466967_1431011_70_606 178
232 3300045976 Ga0466967_1874139 Ga0466967_1874139_22_558 178
233 3300046454 Ga0495592_0341400 Ga0495592_0341400_23_562 178
234 3300046459 Ga0495629_0000580 Ga0495629_0000580_14740_15276 178
235 3300046459 Ga0495629_0239163 Ga0495629_0239163_494_1033 178
236 3300046460 Ga0495638_0067557 Ga0495638_0067557_723_1259 178
237 3300046461 Ga0495641_0017451 Ga0495641_0017451_1468_2004 178
238 3300046461 Ga0495641_0021327 Ga0495641_0021327_172_711 178
239 3300046463 Ga0495653_0104299 Ga0495653_0104299_784_1323 178
240 3300046472 Ga0495580_0197577 Ga0495580_0197577_529_1068 178
241 3300046473 Ga0495582_0003386 Ga0495582_0003386_3790_4326 178
242 3300046477 Ga0495664_0179962 Ga0495664_0179962_142_681 178
243 3300046492 Ga0495585_0260722 Ga0495585_0260722_234_776 178
244 3300046507 Ga0495606_0007931 Ga0495606_0007931_1182_1718 178
245 3300046514 Ga0495618_0130780 Ga0495618_0130780_528_1067 178
246 3300046516 Ga0495628_0383983 Ga0495628_0383983_220_756 178
247 3300046517 Ga0495630_0427710 Ga0495630_0427710_402_941 178
248 3300046519 Ga0495632_0030626 Ga0495632_0030626_1078_1614 178
249 3300046526 Ga0495666_0191773 Ga0495666_0191773_101_637 178
250 3300046529 Ga0495652_0130308 Ga0495652_0130308_457_993 178
251 3300046531 Ga0495665_0045795 Ga0495665_0045795_1691_2230 178
252 3300046531 Ga0495665_0123552 Ga0495665_0123552_397_936 178
253 3300046533 Ga0495640_0140955 Ga0495640_0140955_962_1501 178
254 3300046543 Ga0495645_0741924 Ga0495645_0741924_25_561 178
255 3300046559 Ga0495667_0489896 Ga0495667_0489896_86_622 178
256 3300046615 Ga0495656_0241628 Ga0495656_0241628_310_846 178
257 3300046615 Ga0495656_0525881 Ga0495656_0525881_65_601 178
258 3300046616 Ga0495668_0001279 Ga0495668_0001279_5355_5891 178
259 3300046642 Ga0495634_0198736 Ga0495634_0198736_658_1197 178
260 3300046660 Ga0495625_0001034 Ga0495625_0001034_23958_24494 178
261 3300046663 Ga0495635_0133447 Ga0495635_0133447_49_588 178
262 3300046674 Ga0495588_0127622 Ga0495588_0127622_291_830 178
263 3300046675 Ga0495657_0201171 Ga0495657_0201171_221_757 178
264 3300046675 Ga0495657_0204338 Ga0495657_0204338_67_603 178
265 3300046681 Ga0495647_0130460 Ga0495647_0130460_156_695 178
266 3300046683 Ga0495658_0011541 Ga0495658_0011541_2704_3240 178
267 3300046683 Ga0495658_0259248 Ga0495658_0259248_145_684 178
268 3300046683 Ga0495658_0292853 Ga0495658_0292853_251_790 178
269 3300046689 Ga0495613_0008060 Ga0495613_0008060_4517_5053 178
270 3300046689 Ga0495613_0111126 Ga0495613_0111126_438_977 178
271 3300046690 Ga0495624_0072387 Ga0495624_0072387_551_1090 178
272 3300047319 Ga0495674_0372986 Ga0495674_0372986_570_1109 178
273 3300047321 Ga0495676_0165376 Ga0495676_0165376_173_712 178
274 3300047322 Ga0495680_0424269 Ga0495680_0424269_137_676 178
275 3300047323 Ga0495683_0034203 Ga0495683_0034203_1634_2170 178
276 3300047471 Ga0495684_0285894 Ga0495684_0285894_498_1034 178
277 3300047673 Ga0495593_0120491 Ga0495593_0120491_518_1057 178
278 3300048088 Ga0495602_0514446 Ga0495602_0514446_243_785 178
279 3300048091 Ga0495626_0000284 Ga0495626_0000284_49396_49932 178
280 3300048903 Ga0496100_0010866 Ga0496100_0010866_1469_2050 178
281 3300048903 Ga0496100_0202570 Ga0496100_0202570_865_1401 178
282 3300048903 Ga0496100_0391315 Ga0496100_0391315_143_679 178
283 3300048904 Ga0496101_0010687 Ga0496101_0010687_4347_4883 178
284 3300048904 Ga0496101_0011986 Ga0496101_0011986_5121_5657 178
285 3300048904 Ga0496101_0568417 Ga0496101_0568417_296_832 178
286 3300048905 Ga0496102_0026963 Ga0496102_0026963_312_848 178
287 3300048906 Ga0496103_0095925 Ga0496103_0095925_695_1231 178
288 3300048906 Ga0496103_0150708 Ga0496103_0150708_480_1019 178
289 3300048906 Ga0496103_0308071 Ga0496103_0308071_23_559 178
290 3300048907 Ga0496104_0026862 Ga0496104_0026862_3841_4383 178
291 3300048907 Ga0496104_0069993 Ga0496104_0069993_2476_3012 178
292 3300048907 Ga0496104_0071263 Ga0496104_0071263_344_880 178
293 3300048907 Ga0496104_0813336 Ga0496104_0813336_33_569 178
294 3300048907 Ga0496104_0841057 Ga0496104_0841057_216_752 178
295 3300048908 Ga0496105_0009932 Ga0496105_0009932_4746_5282 178
296 3300048908 Ga0496105_0021192 Ga0496105_0021192_3840_4382 178
297 3300048908 Ga0496105_0077760 Ga0496105_0077760_23_559 178
298 3300048908 Ga0496105_0083328 Ga0496105_0083328_1707_2243 178
299 3300048908 Ga0496105_0149142 Ga0496105_0149142_125_661 178
300 3300048908 Ga0496105_0376951 Ga0496105_0376951_105_641 178
301 3300048909 Ga0496106_0019215 Ga0496106_0019215_1984_2520 178
302 3300048909 Ga0496106_0183005 Ga0496106_0183005_899_1438 178
303 3300048909 Ga0496106_0286452 Ga0496106_0286452_454_1035 178
304 3300048909 Ga0496106_0681739 Ga0496106_0681739_31_567 178
305 3300048910 Ga0496107_0001608 Ga0496107_0001608_12923_13459 178
306 3300048910 Ga0496107_0021595 Ga0496107_0021595_2478_3014 178
307 3300048910 Ga0496107_0036339 Ga0496107_0036339_2282_2821 178
308 3300048910 Ga0496107_0038903 Ga0496107_0038903_1538_2074 178
309 3300048911 Ga0496108_0042423 Ga0496108_0042423_1855_2397 178
310 3300048911 Ga0496108_0141553 Ga0496108_0141553_1227_1766 178
311 3300048911 Ga0496108_0686483 Ga0496108_0686483_38_574 178
312 3300048912 Ga0496109_0040864 Ga0496109_0040864_2812_3354 178
313 3300048912 Ga0496109_0084587 Ga0496109_0084587_760_1299 178
314 3300048912 Ga0496109_0086186 Ga0496109_0086186_1846_2382 178
315 3300048912 Ga0496109_0193818 Ga0496109_0193818_1301_1837 178
316 3300048912 Ga0496109_0243842 Ga0496109_0243842_406_942 178
317 3300048912 Ga0496109_0550424 Ga0496109_0550424_469_1008 178
318 3300048913 Ga0496110_0140680 Ga0496110_0140680_862_1398 178
319 3300048913 Ga0496110_0339696 Ga0496110_0339696_796_1335 178
320 3300048913 Ga0496110_0558609 Ga0496110_0558609_262_801 178
321 3300048913 Ga0496110_0806202 Ga0496110_0806202_294_830 178
322 3300048913 Ga0496110_0963749 Ga0496110_0963749_107_643 178
323 3300048914 Ga0496111_0078638 Ga0496111_0078638_1651_2196 178
324 3300048914 Ga0496111_0569541 Ga0496111_0569541_89_625 178
325 3300048914 Ga0496111_0633281 Ga0496111_0633281_22_558 178
326 3300048915 Ga0496112_0265685 Ga0496112_0265685_274_810 178
327 3300048915 Ga0496112_0704313 Ga0496112_0704313_357_905 178
328 3300048916 Ga0496113_0032186 Ga0496113_0032186_1653_2189 178
329 3300048916 Ga0496113_0299695 Ga0496113_0299695_478_1014 178
330 3300048917 Ga0496114_0049481 Ga0496114_0049481_1879_2415 178
331 3300048917 Ga0496114_0057911 Ga0496114_0057911_1124_1660 178
332 3300048917 Ga0496114_0094729 Ga0496114_0094729_1893_2429 178
333 3300048917 Ga0496114_0140537 Ga0496114_0140537_800_1336 178
334 3300048917 Ga0496114_0163932 Ga0496114_0163932_30_566 178
335 3300048917 Ga0496114_0956291 Ga0496114_0956291_46_582 178
336 3300048917 Ga0496114_1129294 Ga0496114_1129294_110_649 178
337 3300048918 Ga0496115_0001157 Ga0496115_0001157_2522_3058 178
338 3300048918 Ga0496115_0051134 Ga0496115_0051134_1825_2367 178
339 3300049572 Ga0501036_0010121 Ga0501036_0010121_7146_7688 178
340 3300049574 Ga0501038_0114725 Ga0501038_0114725_210_749 178
341 3300049575 Ga0501039_0038527 Ga0501039_0038527_306_845 178
342 3300049575 Ga0501039_0070916 Ga0501039_0070916_968_1507 178
343 3300049575 Ga0501039_0302480 Ga0501039_0302480_705_1247 178
344 3300049575 Ga0501039_0514007 Ga0501039_0514007_108_650 178
345 3300049576 Ga0501040_0303636 Ga0501040_0303636_433_972 178
346 3300049577 Ga0501041_0098532 Ga0501041_0098532_996_1535 178
347 3300049578 Ga0501042_0060569 Ga0501042_0060569_1486_2028 178
348 3300049578 Ga0501042_0095748 Ga0501042_0095748_260_799 178
349 3300049578 Ga0501042_0299919 Ga0501042_0299919_420_956 178
350 3300049579 Ga0501043_0346762 Ga0501043_0346762_52_594 178
351 3300049582 Ga0501048_0103996 Ga0501048_0103996_232_771 178
352 3300049582 Ga0501048_0627544 Ga0501048_0627544_134_673 178
353 3300049585 Ga0501069_0306349 Ga0501069_0306349_171_716 178
354 3300049587 Ga0501071_0270907 Ga0501071_0270907_463_1002 178
355 3300049588 Ga0501072_0067727 Ga0501072_0067727_303_845 178
356 3300049588 Ga0501072_0109942 Ga0501072_0109942_323_862 178
357 3300049590 Ga0501074_0625904 Ga0501074_0625904_29_568 178
358 3300049591 Ga0501075_0084127 Ga0501075_0084127_19_561 178
359 3300049591 Ga0501075_0202203 Ga0501075_0202203_260_799 178
360 3300049591 Ga0501075_0554395 Ga0501075_0554395_222_761 178
361 3300049593 Ga0501077_0278694 Ga0501077_0278694_306_845 178
362 3300049652 Ga0501202_008655 Ga0501202_008655_599_1138 178
363 3300049741 Ga0501079_0471661 Ga0501079_0471661_179_718 178
364 3300049824 Ga0501045_0046598 Ga0501045_0046598_786_1325 178
365 3300049824 Ga0501045_0088249 Ga0501045_0088249_1308_1847 178
366 3300049824 Ga0501045_0175382 Ga0501045_0175382_454_996 178
367 3300050492 nmdc:mga0yw44_103079_c1 nmdc:mga0yw44_103079_c1_322_864 178
368 3300050492 nmdc:mga0yw44_39827_c1 nmdc:mga0yw44_39827_c1_657_1196 178
369 3300050492 nmdc:mga0yw44_9894_c1 nmdc:mga0yw44_9894_c1_3752_4294 178
370 3300050507 nmdc:mga05p37_1092_c1 nmdc:mga05p37_1092_c1_25169_25771 178
371 3300050507 nmdc:mga05p37_32345_c1 nmdc:mga05p37_32345_c1_1313_1849 178
372 3300050507 nmdc:mga05p37_82620_c1 nmdc:mga05p37_82620_c1_3047_3583 178
373 3300050508 nmdc:mga09592_221_c1 nmdc:mga09592_221_c1_15571_16173 178
374 3300050509 nmdc:mga0qj67_29236_c1 nmdc:mga0qj67_29236_c1_2016_2618 178
375 3300050510 nmdc:mga06r32_1732_c1 nmdc:mga06r32_1732_c1_3397_3999 178
376 3300050510 nmdc:mga06r32_32036_c1 nmdc:mga06r32_32036_c1_943_1482 178
377 3300050511 nmdc:mga08y16_108143_c1 nmdc:mga08y16_108143_c1_279_827 178
378 3300050511 nmdc:mga08y16_1330_c1 nmdc:mga08y16_1330_c1_17312_17914 178
379 3300050515 nmdc:mga0a205_346827_c1 nmdc:mga0a205_346827_c1_679_1281 178
380 3300053077 Ga0495601_0173982 Ga0495601_0173982_536_1105 178
381 3300053084 Ga0495595_0234204 Ga0495595_0234204_218_754 178
382 3300053085 Ga0495619_0076316 Ga0495619_0076316_1528_2067 178
383 3300053090 Ga0500646_0003668 Ga0500646_0003668_658_1194 178
384 3300053092 Ga0500583_0116042 Ga0500583_0116042_379_915 178
385 3300053124 Ga0500617_133934 Ga0500617_133934_64_600 178
386 3300053130 Ga0500642_0060564 Ga0500642_0060564_850_1386 178
387 3300060353 Ga0501082_0786978 Ga0501082_0786978_281_820 178
388 3300061734 Ga0530510_0307912 Ga0530510_0307912_251_790 178
389 3300061734 Ga0530510_0593972 Ga0530510_0593972_40_579 178
390 3300061734 Ga0530510_0827799 Ga0530510_0827799_128_664 178
391 iso_pu_bacteria 2811994882 2812375133 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13671

AAA_33

AAA domain

38

176

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zvn-assembly1.cif.gz_A the structural basis for substrate recognition by mammalian polynucleotide kinase 3' phosphatase 0.8692 1 148
1yj5-assembly1.cif.gz_B molecular architecture of mammalian polynucleotide kinase, a dna repair enzyme 0.8461 1 148
3u7g-assembly1.cif.gz_A crystal structure of mpnkp catalytic fragment (d170a) bound to single-stranded dna (tcctap) 0.8444 1 149
4xru-assembly1.cif.gz_D structure of pnkp1/rnl/hen1 complex 0.8372 1 111
4mde-assembly1.cif.gz_A structure of bacterial polynucleotide kinase product complex bound to gdp and dna 0.8366 1 140
ID Description Score Start End Superfamily
af_Q54TE2_1_167_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8954 1 148 3.40.50.300
af_O13911_231_407_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8746 4 148 3.40.50.300
af_A4IA87_99_253_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8688 4 140 3.40.50.300
af_Q19683_223_405_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.857 4 148 3.40.50.300
af_Q54SI2_168_326_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8493 4 111 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A543KNP6-F1-model_v4 Putative kinase 0.9971 1 178 GO:0016301
AF-A0A2P2BYZ0-F1-model_v4 Kinase 0.997 1 178
AF-A0A536QEI6-F1-model_v4 ATP-binding protein 0.9944 1 106 GO:0005524
AF-A0A372J795-F1-model_v4 ATP-binding protein 0.992 1 178 GO:0005524
AF-A0A413RJP4-F1-model_v4 DUF664 domain-containing protein 0.9915 1 176

Feature Viewer

pLDDT pTM Quality
93.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map