F431949

General Info

Members Datasets Scaffolds Average Seq Length
391 179 391 187

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100861902|Ga0070714_1008619021
Length 190
Sequence MDEDSYVDAVLEDCRDKMAKALEHTRTEFSVIRTGRAAPALVEKLKVEYYGSDVPLQQLAGIQVPEAKLMVITPYDKSSLRAIERAIQNSDLGVNPNNDGVVIRLTFPPLTQERRKAMVKVAHSKAEEGRVAVRNLRRAARKDLEGFEKDGEISSDELDRAEKELERVTHEFVADIDRVLHHKEEELLAV

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
119 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
120 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.26
Metatranscriptomes 10.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 2.81
Rhizosphere 95.4
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1840198 2162886006 Bacteria 1419
2 SwRhRL2b_contig_2432317 2162886007 Bacteria 1431
3 JGI25406J46586_10012593 3300003203 Bacteria 3663
4 Ga0058863_11423836 3300004799 Bacteria 886
5 Ga0058863_11932747 3300004799 Bacteria 2077
6 Ga0058861_12025863 3300004800 Bacteria 3546
7 Ga0058862_12824171 3300004803 Unclassified 799
8 Ga0058862_12829687 3300004803 Bacteria 2247
9 Ga0065704_10076007 3300005289 Bacteria 5296
10 Ga0065704_10230011 3300005289 Bacteria 1046
11 Ga0065704_10293140 3300005289 Bacteria 854
12 Ga0065704_10395667 3300005289 Bacteria 757
13 Ga0065707_10082710 3300005295 Bacteria 12558
14 Ga0070658_10240283 3300005327 Bacteria 1535
15 Ga0070683_100001325 3300005329 Bacteria 18851
16 Ga0070683_100037312 3300005329 Bacteria 4448
17 Ga0070683_100439935 3300005329 Bacteria 1244
18 Ga0070680_100044019 3300005336 Bacteria 3627
19 Ga0070680_100113316 3300005336 Bacteria 2259
20 Ga0070689_100101039 3300005340 Bacteria 2282
21 Ga0070689_100266557 3300005340 Bacteria 1417
22 Ga0070691_10019038 3300005341 Bacteria 3165
23 Ga0070661_100310812 3300005344 Bacteria 1229
24 Ga0070714_100003091 3300005435 Bacteria 12353
25 Ga0070714_100861902 3300005435 Unclassified 879
26 Ga0070713_100004486 3300005436 Bacteria 9385
27 Ga0070713_101321111 3300005436 Bacteria 699
28 Ga0070705_100034979 3300005440 Bacteria 2813
29 Ga0070700_100037880 3300005441 Bacteria 2935
30 Ga0070700_100849147 3300005441 Bacteria 739
31 Ga0070694_100078297 3300005444 Bacteria 2293
32 Ga0070694_100312624 3300005444 Bacteria 1207
33 Ga0070708_100133227 3300005445 Bacteria 2301
34 Ga0070681_10021586 3300005458 Bacteria 6454
35 Ga0070681_10094894 3300005458 Bacteria 2931
36 Ga0070681_10155417 3300005458 Bacteria 2213
37 Ga0070681_10546149 3300005458 Bacteria 1072
38 Ga0068867_101038034 3300005459 Bacteria 745
39 Ga0070706_100007380 3300005467 Bacteria 10313
40 Ga0070706_100140917 3300005467 Unclassified 2251
41 Ga0070706_100498407 3300005467 Bacteria 1133
42 Ga0070707_100004612 3300005468 Bacteria 12892
43 Ga0070707_100414702 3300005468 Bacteria 1307
44 Ga0070707_101253140 3300005468 Bacteria 708
45 Ga0070707_101398824 3300005468 Bacteria 666
46 Ga0070698_100057620 3300005471 Bacteria 3931
47 Ga0070698_100165718 3300005471 Bacteria 2153
48 Ga0070698_100847111 3300005471 Bacteria 859
49 Ga0070698_100895902 3300005471 Bacteria 833
50 Ga0070699_100004674 3300005518 Bacteria 12106
51 Ga0070699_100129240 3300005518 Bacteria 2226
52 Ga0070699_100245700 3300005518 Bacteria 1598
53 Ga0070679_100051029 3300005530 Bacteria 4120
54 Ga0070679_100836560 3300005530 Bacteria 864
55 Ga0070684_100000361 3300005535 Bacteria 31277
56 Ga0070684_100099812 3300005535 Bacteria 2591
57 Ga0070684_100765610 3300005535 Bacteria 902
58 Ga0070697_100053188 3300005536 Bacteria 3291
59 Ga0070697_100108640 3300005536 Bacteria 2309
60 Ga0070696_100049807 3300005546 Bacteria 2911
61 Ga0070696_100680010 3300005546 Bacteria 837
62 Ga0070704_100347565 3300005549 Bacteria 1251
63 Ga0070704_100858829 3300005549 Bacteria 814
64 Ga0068855_100581339 3300005563 Bacteria 1210
65 Ga0070664_100119363 3300005564 Bacteria 2308
66 Ga0068857_100002084 3300005577 Bacteria 16240
67 Ga0068857_100961786 3300005577 Bacteria 821
68 Ga0068856_100012537 3300005614 Bacteria 8205
69 Ga0068852_100245342 3300005616 Bacteria 1714
70 Ga0068859_100046398 3300005617 Bacteria 4363
71 Ga0068864_100697894 3300005618 Bacteria 991
72 Ga0068861_100110682 3300005719 Bacteria 2200
73 Ga0068870_10017233 3300005840 Bacteria 3467
74 Ga0068870_10074546 3300005840 Bacteria 1859
75 Ga0068862_100026336 3300005844 Bacteria 4887
76 Ga0068862_100081197 3300005844 Bacteria 2812
77 Ga0068862_100155710 3300005844 Bacteria 2037
78 Ga0068862_100184402 3300005844 Bacteria 1875
79 Ga0081539_10005121 3300005985 Bacteria 13695
80 Ga0081539_10148655 3300005985 Bacteria 1129
81 Ga0081539_10158516 3300005985 Unclassified 1081
82 Ga0070717_10509030 3300006028 Bacteria 1089
83 Ga0075365_10073752 3300006038 Bacteria 2301
84 Ga0075364_10046817 3300006051 Bacteria 2816
85 Ga0075428_100000031 3300006844 Bacteria 119070
86 Ga0075428_100095377 3300006844 Bacteria 3243
87 Ga0075428_100244240 3300006844 Bacteria 1937
88 Ga0075428_100314802 3300006844 Bacteria 1682
89 Ga0075428_100490342 3300006844 Bacteria 1315
90 Ga0075428_100557522 3300006844 Bacteria 1225
91 Ga0075430_100081746 3300006846 Bacteria 2707
92 Ga0075430_100140964 3300006846 Bacteria 2008
93 Ga0075430_100649567 3300006846 Bacteria 870
94 Ga0075431_100003254 3300006847 Bacteria 15727
95 Ga0075431_100239338 3300006847 Unclassified 1847
96 Ga0075431_100264173 3300006847 Bacteria 1746
97 Ga0075431_100551384 3300006847 Bacteria 1140
98 Ga0075431_101010803 3300006847 Unclassified 798
99 Ga0075433_10033713 3300006852 Bacteria 4391
100 Ga0075433_10332324 3300006852 Bacteria 1344
101 Ga0075434_100053938 3300006871 Bacteria 3994
102 Ga0075434_100442779 3300006871 Bacteria 1320
103 Ga0075434_100605033 3300006871 Bacteria 1115
104 Ga0075429_100002367 3300006880 Bacteria 15866
105 Ga0075429_100008742 3300006880 Bacteria 8807
106 Ga0075429_100032678 3300006880 Bacteria 4522
107 Ga0075429_100152387 3300006880 Bacteria 2024
108 Ga0075429_100452628 3300006880 Unclassified 1125
109 Ga0097620_100046397 3300006931 Bacteria 4363
110 Ga0105240_11574186 3300009093 Bacteria 688
111 Ga0111539_10819343 3300009094 Bacteria 1083
112 Ga0105245_10457596 3300009098 Bacteria 1286
113 Ga0114129_10000864 3300009147 Bacteria 39418
114 Ga0114129_10109508 3300009147 Bacteria 3813
115 Ga0114129_10122090 3300009147 Bacteria 3585
116 Ga0114129_10335944 3300009147 Bacteria 2005
117 Ga0114129_10390628 3300009147 Unclassified 1835
118 Ga0105243_10054644 3300009148 Bacteria 3171
119 Ga0105243_10056921 3300009148 Bacteria 3112
120 Ga0105243_10407175 3300009148 Unclassified 1265
121 Ga0105243_10659644 3300009148 Bacteria 1015
122 Ga0105237_10638106 3300009545 Bacteria 1072
123 Ga0105249_10035260 3300009553 Bacteria 4537
124 Ga0105249_10067506 3300009553 Bacteria 3295
125 Ga0105249_10108931 3300009553 Bacteria 2615
126 Ga0105246_10032831 3300011119 Bacteria 3446
127 Ga0105246_10115310 3300011119 Bacteria 1981
128 Ga0105246_11421002 3300011119 Bacteria 648
129 Ga0157373_10608706 3300013100 Bacteria 796
130 Ga0157369_10128239 3300013105 Bacteria 2689
131 Ga0157369_10637149 3300013105 Bacteria 1100
132 Ga0163163_12235212 3300014325 Bacteria 606
133 Ga0157380_10338924 3300014326 Bacteria 1402
134 Ga0197907_10102979 3300020069 Bacteria 1476
135 Ga0197907_10118663 3300020069 Bacteria 816
136 Ga0197907_10318833 3300020069 Bacteria 5076
137 Ga0197907_10805073 3300020069 Bacteria 892
138 Ga0206356_10116448 3300020070 Bacteria 4967
139 Ga0206356_10332003 3300020070 Bacteria 5165
140 Ga0206356_10491885 3300020070 Bacteria 1396
141 Ga0206349_1543534 3300020075 Bacteria 1391
142 Ga0206349_1630894 3300020075 Bacteria 1173
143 Ga0206349_1689260 3300020075 Bacteria 2784
144 Ga0206355_1169112 3300020076 Bacteria 3192
145 Ga0206355_1577546 3300020076 Bacteria 1653
146 Ga0206351_10705360 3300020077 Bacteria 1424
147 Ga0206351_10889781 3300020077 Bacteria 990
148 Ga0206351_10915449 3300020077 Bacteria 1899
149 Ga0206352_10398982 3300020078 Bacteria 2450
150 Ga0206352_10637224 3300020078 Bacteria 966
151 Ga0206352_10675663 3300020078 Bacteria 2393
152 Ga0206350_10183039 3300020080 Bacteria 3712
153 Ga0206350_10283946 3300020080 Bacteria 970
154 Ga0206350_11659259 3300020080 Bacteria 2516
155 Ga0206354_10488103 3300020081 Bacteria 639
156 Ga0206354_10908837 3300020081 Bacteria 3087
157 Ga0206353_10461992 3300020082 Bacteria 1889
158 Ga0206353_11694258 3300020082 Bacteria 1186
159 Ga0206353_12034427 3300020082 Unclassified 764
160 Ga0154015_1045662 3300020610 Bacteria 916
161 Ga0224712_10000853 3300022467 Bacteria 6512
162 Ga0224712_10049099 3300022467 Bacteria 1632
163 Ga0224712_10063275 3300022467 Bacteria 1480
164 Ga0224712_10080727 3300022467 Bacteria 1342
165 Ga0224712_10361150 3300022467 Bacteria 688
166 Ga0224712_10431518 3300022467 Unclassified 631
167 Ga0207643_10079517 3300025908 Bacteria 1898
168 Ga0207684_10001326 3300025910 Bacteria 27171
169 Ga0207684_10025884 3300025910 Bacteria 5001
170 Ga0207684_10103935 3300025910 Bacteria 2429
171 Ga0207707_10021502 3300025912 Bacteria 5639
172 Ga0207707_10139872 3300025912 Bacteria 2117
173 Ga0207671_10156323 3300025914 Bacteria 1764
174 Ga0207663_10068070 3300025916 Bacteria 2286
175 Ga0207660_10045935 3300025917 Bacteria 3080
176 Ga0207660_10049419 3300025917 Bacteria 2981
177 Ga0207649_10346205 3300025920 Bacteria 1099
178 Ga0207652_10409218 3300025921 Bacteria 1224
179 Ga0207652_10420596 3300025921 Bacteria 1205
180 Ga0207646_10023711 3300025922 Bacteria 5633
181 Ga0207646_10373345 3300025922 Bacteria 1288
182 Ga0207646_10777419 3300025922 Bacteria 854
183 Ga0207646_10806948 3300025922 Bacteria 835
184 Ga0207687_10525777 3300025927 Bacteria 990
185 Ga0207700_10018564 3300025928 Bacteria 4678
186 Ga0207664_10022916 3300025929 Bacteria 4672
187 Ga0207709_10087895 3300025935 Bacteria 2022
188 Ga0207709_10365875 3300025935 Unclassified 1093
189 Ga0207709_10503317 3300025935 Bacteria 946
190 Ga0207670_10098535 3300025936 Bacteria 2083
191 Ga0207670_10214859 3300025936 Bacteria 1469
192 Ga0207670_10368217 3300025936 Bacteria 1142
193 Ga0207661_10000572 3300025944 Bacteria 23481
194 Ga0207661_10024739 3300025944 Bacteria 4554
195 Ga0207661_10390911 3300025944 Bacteria 1260
196 Ga0207661_10421547 3300025944 Bacteria 1212
197 Ga0207679_10009162 3300025945 Bacteria 6330
198 Ga0207667_10483024 3300025949 Bacteria 1258
199 Ga0207712_10292078 3300025961 Bacteria 1334
200 Ga0207712_10510942 3300025961 Bacteria 1028
201 Ga0207703_11008628 3300026035 Unclassified 799
202 Ga0207703_11080127 3300026035 Bacteria 771
203 Ga0207708_10010634 3300026075 Bacteria 6834
204 Ga0207702_10003798 3300026078 Bacteria 13637
205 Ga0207676_10775709 3300026095 Bacteria 934
206 Ga0207676_10841770 3300026095 Bacteria 897
207 Ga0207674_10003361 3300026116 Bacteria 19633
208 Ga0207674_10217772 3300026116 Bacteria 1858
209 Ga0207675_100024084 3300026118 Bacteria 5659
210 Ga0207428_10215980 3300027907 Bacteria 1439
211 Ga0268265_10027326 3300028380 Bacteria 4072
212 Ga0268265_10036793 3300028380 Bacteria 3588
213 Ga0268265_10109157 3300028380 Bacteria 2254
214 Ga0268265_10242991 3300028380 Bacteria 1590
215 Ga0265322_10042218 3300028654 Bacteria 1298
216 Ga0265316_10552883 3300031344 Unclassified 819
217 Ga0307408_100134531 3300031548 Unclassified 1933
218 Ga0307408_100320302 3300031548 Bacteria 1306
219 Ga0316575_10010448 3300031665 Bacteria 3413
220 Ga0316579_10001173 3300031691 Bacteria 9355
221 Ga0316579_10004566 3300031691 Bacteria 5511
222 Ga0316579_10216705 3300031691 Unclassified 926
223 Ga0316579_10254801 3300031691 Unclassified 849
224 Ga0316576_10023005 3300031727 Bacteria 4335
225 Ga0316576_10174442 3300031727 Bacteria 1622
226 Ga0316576_10247706 3300031727 Bacteria 1338
227 Ga0316576_10492001 3300031727 Unclassified 903
228 Ga0316576_10653942 3300031727 Bacteria 764
229 Ga0316578_10062862 3300031728 Bacteria 2189
230 Ga0316578_10420674 3300031728 Bacteria 791
231 Ga0307405_10041102 3300031731 Unclassified 2805
232 Ga0307405_10275939 3300031731 Bacteria 1263
233 Ga0316577_10000224 3300031733 Bacteria 19433
234 Ga0316577_10002243 3300031733 Bacteria 9502
235 Ga0316577_10012363 3300031733 Bacteria 4650
236 Ga0316577_10034088 3300031733 Bacteria 2845
237 Ga0316577_10360616 3300031733 Bacteria 825
238 Ga0307410_10028601 3300031852 Bacteria 3539
239 Ga0307410_10313915 3300031852 Bacteria 1241
240 Ga0307406_10037212 3300031901 Bacteria 3004
241 Ga0307406_10300601 3300031901 Bacteria 1233
242 Ga0307406_10402091 3300031901 Bacteria 1086
243 Ga0307407_10641906 3300031903 Bacteria 794
244 Ga0307412_10794084 3300031911 Bacteria 821
245 Ga0307416_100228766 3300032002 Bacteria 1791
246 Ga0307416_100280696 3300032002 Bacteria 1642
247 Ga0307416_100335046 3300032002 Bacteria 1523
248 Ga0307416_100435518 3300032002 Bacteria 1359
249 Ga0307416_100745722 3300032002 Bacteria 1071
250 Ga0307411_10053329 3300032005 Unclassified 2649
251 Ga0307415_100062468 3300032126 Bacteria 2584
252 Ga0307415_100922509 3300032126 Bacteria 806
253 Ga0307415_101435804 3300032126 Bacteria 658
254 Ga0316585_10007771 3300032137 Bacteria 3100
255 Ga0316585_10024508 3300032137 Bacteria 1868
256 Ga0316580_10065670 3300032139 Bacteria 1113
257 Ga0316593_10004251 3300032168 Bacteria 3658
258 Ga0316593_10118109 3300032168 Bacteria 951
259 Ga0316592_1027094 3300033524 Bacteria 1238
260 Ga0316588_1088083 3300033528 Bacteria 772
261 Ga0373929_0077510 3300035085 Bacteria 805
262 Ga0373940_0089593 3300035088 Bacteria 920
263 Ga0373955_0500285 3300035172 Bacteria 742
264 Ga0316574_0008259 3300035398 Bacteria 5769
265 Ga0316574_0057982 3300035398 Bacteria 2425
266 Ga0373935_0172404 3300035692 Bacteria 1481
267 Ga0373927_0560843 3300035695 Bacteria 755
268 Ga0373937_0093449 3300036401 Bacteria 2789
269 Ga0373937_0247588 3300036401 Bacteria 1680
270 Ga0373937_0367737 3300036401 Bacteria 1363
271 Ga0316582_0002774 3300036647 Bacteria 8340
272 Ga0316582_0004043 3300036647 Bacteria 7329
273 Ga0316582_0005225 3300036647 Bacteria 6653
274 Ga0316582_0025508 3300036647 Bacteria 3550
275 Ga0316582_0205021 3300036647 Bacteria 1346
276 Ga0316582_0403180 3300036647 Unclassified 942
277 Ga0316582_0431833 3300036647 Bacteria 908
278 Ga0316582_0475494 3300036647 Bacteria 861
279 Ga0316582_0561971 3300036647 Unclassified 786
280 Ga0316584_0003291 3300036712 Bacteria 10457
281 Ga0316584_0034821 3300036712 Bacteria 3734
282 Ga0316584_0066410 3300036712 Bacteria 2703
283 Ga0316584_0104272 3300036712 Bacteria 2123
284 Ga0316584_0149002 3300036712 Bacteria 1743
285 Ga0316584_0396167 3300036712 Bacteria 984
286 Ga0395905_0133528 3300037471 Bacteria 2335
287 Ga0316581_0012994 3300037588 Bacteria 2354
288 Ga0316581_0120978 3300037588 Bacteria 807
289 Ga0436364_0074556 3300037853 Unclassified 1378
290 Ga0400489_60181 3300039093 Bacteria 1524
291 Ga0451577_0063812 3300042876 Bacteria 3285
292 Ga0451577_0265159 3300042876 Bacteria 1555
293 Ga0451577_0347364 3300042876 Bacteria 1346
294 Ga0451577_0393538 3300042876 Bacteria 1258
295 Ga0451577_0578380 3300042876 Bacteria 1019
296 Ga0453683_0002533 3300044673 Bacteria 14103
297 Ga0453683_0139689 3300044673 Bacteria 1528
298 Ga0453683_0250129 3300044673 Bacteria 1130
299 Ga0453684_0000053 3300044712 Bacteria 545350
300 Ga0453684_0003482 3300044712 Bacteria 35351
301 Ga0453684_0005812 3300044712 Bacteria 24031
302 Ga0453684_0006006 3300044712 Bacteria 23513
303 Ga0453684_0011900 3300044712 Bacteria 14489
304 Ga0453684_0018718 3300044712 Bacteria 10605
305 Ga0453684_0032135 3300044712 Bacteria 7355
306 Ga0453684_0033052 3300044712 Bacteria 7219
307 Ga0453684_0036874 3300044712 Bacteria 6727
308 Ga0453684_0045519 3300044712 Bacteria 5852
309 Ga0453684_0045520 3300044712 Bacteria 5852
310 Ga0453684_0073645 3300044712 Bacteria 4305
311 Ga0453684_0080415 3300044712 Bacteria 4070
312 Ga0453684_0108635 3300044712 Unclassified 3376
313 Ga0453684_0119668 3300044712 Bacteria 3182
314 Ga0453684_0142076 3300044712 Bacteria 2865
315 Ga0453684_0143643 3300044712 Bacteria 2846
316 Ga0453684_0158495 3300044712 Bacteria 2680
317 Ga0453684_0222742 3300044712 Bacteria 2184
318 Ga0453684_0235393 3300044712 Bacteria 2111
319 Ga0453684_0345613 3300044712 Bacteria 1679
320 Ga0453684_0351796 3300044712 Bacteria 1661
321 Ga0453684_0469541 3300044712 Unclassified 1397
322 Ga0453684_0491151 3300044712 Bacteria 1361
323 Ga0453684_0553432 3300044712 Bacteria 1267
324 Ga0453684_0658101 3300044712 Bacteria 1142
325 Ga0453684_0666745 3300044712 Bacteria 1133
326 Ga0453684_0871604 3300044712 Bacteria 966
327 Ga0453684_0941752 3300044712 Bacteria 922
328 Ga0453684_1032189 3300044712 Bacteria 872
329 Ga0453684_1146244 3300044712 Unclassified 819
330 Ga0453684_1524886 3300044712 Unclassified 689
331 Ga0451576_0026475 3300045051 Bacteria 6239
332 Ga0451576_0030459 3300045051 Bacteria 5767
333 Ga0451576_0061822 3300045051 Bacteria 3905
334 Ga0451576_0151350 3300045051 Bacteria 2420
335 Ga0451576_0252667 3300045051 Bacteria 1842
336 Ga0466967_0626443 3300045976 Bacteria 1063
337 Ga0495651_0388431 3300046462 Unclassified 914
338 Ga0495608_0346239 3300046511 Bacteria 915
339 Ga0495630_0388810 3300046517 Bacteria 1068
340 Ga0496104_0905978 3300048907 Bacteria 787
341 Ga0496105_0541422 3300048908 Bacteria 910
342 Ga0496108_0206749 3300048911 Bacteria 1704
343 Ga0496108_0640613 3300048911 Unclassified 924
344 Ga0496109_0390001 3300048912 Bacteria 1316
345 Ga0496109_0514340 3300048912 Bacteria 1130
346 Ga0496110_0557251 3300048913 Bacteria 1041
347 Ga0496111_0346635 3300048914 Bacteria 1099
348 Ga0496112_0070186 3300048915 Bacteria 3462
349 Ga0496115_0167553 3300048918 Bacteria 1817
350 Ga0496115_0526840 3300048918 Bacteria 947
351 Ga0501298_039450 3300049521 Bacteria 954
352 Ga0501031_0227248 3300049568 Bacteria 1215
353 Ga0501039_0138068 3300049575 Bacteria 1915
354 Ga0501040_0376308 3300049576 Bacteria 1019
355 Ga0501041_0264463 3300049577 Unclassified 1082
356 Ga0501071_1031698 3300049587 Bacteria 635
357 Ga0501072_0114063 3300049588 Bacteria 2152
358 Ga0501075_0129584 3300049591 Bacteria 1922
359 Ga0501075_0185803 3300049591 Bacteria 1585
360 Ga0501076_0121760 3300049592 Bacteria 2113
361 Ga0501076_0590290 3300049592 Bacteria 916
362 Ga0501230_042282 3300049667 Unclassified 886
363 Ga0501233_043556 3300049668 Unclassified 1064
364 Ga0501235_075370 3300049669 Unclassified 802
365 Ga0501081_0118412 3300049743 Bacteria 1884
366 Ga0501081_0700044 3300049743 Bacteria 761
367 Ga0501083_0256751 3300049744 Bacteria 1137
368 Ga0501045_0514886 3300049824 Bacteria 888
369 nmdc:mga00v17_72728_c1 3300050491 Bacteria 2133
370 nmdc:mga0yw44_65608_c1 3300050492 Bacteria 2238
371 nmdc:mga0yw44_86205_c2 3300050492 Bacteria 1527
372 nmdc:mga05p37_10588_c1 3300050507 Bacteria 10937
373 nmdc:mga05p37_320166_c1 3300050507 Unclassified 1836
374 nmdc:mga05p37_421465_c1 3300050507 Bacteria 1553
375 nmdc:mga05p37_68111_c1 3300050507 Bacteria 4377
376 nmdc:mga05p37_893956_c1 3300050507 Bacteria 959
377 nmdc:mga09592_106988_c1 3300050508 Bacteria 2399
378 nmdc:mga09592_3031_c1 3300050508 Bacteria 13624
379 nmdc:mga0qj67_185142_c1 3300050509 Bacteria 1691
380 nmdc:mga0qj67_344251_c1 3300050509 Bacteria 1206
381 nmdc:mga06r32_164622_c1 3300050510 Unclassified 2200
382 nmdc:mga06r32_2735_c1 3300050510 Bacteria 15770
383 nmdc:mga0n895_50819_c1 3300050512 Bacteria 4065
384 nmdc:mga0a205_14206_c1 3300050515 Bacteria 7426
385 Ga0495601_0291905 3300053077 Bacteria 1063
386 Ga0495612_0134372 3300053078 Bacteria 1070
387 Ga0495619_0361165 3300053085 Bacteria 1004
388 Ga0501082_0151746 3300060353 Bacteria 2013
389 Ga0530510_0000363 3300061734 Bacteria 29420
390 Ga0530510_0164803 3300061734 Bacteria 1640
391 Ga0530510_0494452 3300061734 Bacteria 927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0080415 Ga0453684_0080415_1240_1860 162
2 3300035398 Ga0316574_0057982 Ga0316574_0057982_1802_2410 168
3 3300036647 Ga0316582_0475494 Ga0316582_0475494_130_738 168
4 3300025922 Ga0207646_10806948 Ga0207646_108069481 180
5 3300044712 Ga0453684_0005812 Ga0453684_0005812_20157_20702 181
6 3300003203 JGI25406J46586_10012593 JGI25406J46586_100125933 185
7 3300004799 Ga0058863_11423836 Ga0058863_114238362 185
8 3300004799 Ga0058863_11932747 Ga0058863_119327472 185
9 3300004800 Ga0058861_12025863 Ga0058861_120258634 185
10 3300004803 Ga0058862_12824171 Ga0058862_128241711 185
11 3300004803 Ga0058862_12829687 Ga0058862_128296873 185
12 3300005289 Ga0065704_10076007 Ga0065704_100760075 185
13 3300005289 Ga0065704_10230011 Ga0065704_102300112 185
14 3300005289 Ga0065704_10293140 Ga0065704_102931401 185
15 3300005289 Ga0065704_10395667 Ga0065704_103956671 185
16 3300005295 Ga0065707_10082710 Ga0065707_100827106 185
17 3300005327 Ga0070658_10240283 Ga0070658_102402831 185
18 3300005329 Ga0070683_100001325 Ga0070683_1000013252 185
19 3300005329 Ga0070683_100037312 Ga0070683_1000373125 185
20 3300005329 Ga0070683_100439935 Ga0070683_1004399351 185
21 3300005336 Ga0070680_100044019 Ga0070680_1000440194 185
22 3300005336 Ga0070680_100113316 Ga0070680_1001133163 185
23 3300005340 Ga0070689_100101039 Ga0070689_1001010392 185
24 3300005340 Ga0070689_100266557 Ga0070689_1002665572 185
25 3300005341 Ga0070691_10019038 Ga0070691_100190382 185
26 3300005344 Ga0070661_100310812 Ga0070661_1003108122 185
27 3300005435 Ga0070714_100003091 Ga0070714_1000030915 185
28 3300005436 Ga0070713_100004486 Ga0070713_1000044862 185
29 3300005440 Ga0070705_100034979 Ga0070705_1000349791 185
30 3300005441 Ga0070700_100037880 Ga0070700_1000378803 185
31 3300005441 Ga0070700_100849147 Ga0070700_1008491471 185
32 3300005444 Ga0070694_100078297 Ga0070694_1000782973 185
33 3300005444 Ga0070694_100312624 Ga0070694_1003126242 185
34 3300005445 Ga0070708_100133227 Ga0070708_1001332272 185
35 3300005458 Ga0070681_10021586 Ga0070681_100215865 185
36 3300005458 Ga0070681_10094894 Ga0070681_100948941 185
37 3300005458 Ga0070681_10155417 Ga0070681_101554173 185
38 3300005458 Ga0070681_10546149 Ga0070681_105461491 185
39 3300005459 Ga0068867_101038034 Ga0068867_1010380341 185
40 3300005467 Ga0070706_100007380 Ga0070706_1000073804 185
41 3300005467 Ga0070706_100140917 Ga0070706_1001409172 185
42 3300005468 Ga0070707_100004612 Ga0070707_1000046126 185
43 3300005468 Ga0070707_100414702 Ga0070707_1004147021 185
44 3300005468 Ga0070707_101253140 Ga0070707_1012531401 185
45 3300005468 Ga0070707_101398824 Ga0070707_1013988241 185
46 3300005471 Ga0070698_100057620 Ga0070698_1000576201 185
47 3300005471 Ga0070698_100165718 Ga0070698_1001657182 185
48 3300005471 Ga0070698_100895902 Ga0070698_1008959021 185
49 3300005518 Ga0070699_100004674 Ga0070699_10000467412 185
50 3300005518 Ga0070699_100129240 Ga0070699_1001292402 185
51 3300005518 Ga0070699_100245700 Ga0070699_1002457002 185
52 3300005530 Ga0070679_100051029 Ga0070679_1000510295 185
53 3300005530 Ga0070679_100836560 Ga0070679_1008365601 185
54 3300005535 Ga0070684_100000361 Ga0070684_10000036120 185
55 3300005535 Ga0070684_100099812 Ga0070684_1000998123 185
56 3300005535 Ga0070684_100765610 Ga0070684_1007656102 185
57 3300005536 Ga0070697_100053188 Ga0070697_1000531882 185
58 3300005536 Ga0070697_100108640 Ga0070697_1001086402 185
59 3300005546 Ga0070696_100049807 Ga0070696_1000498072 185
60 3300005549 Ga0070704_100347565 Ga0070704_1003475651 185
61 3300005549 Ga0070704_100858829 Ga0070704_1008588292 185
62 3300005563 Ga0068855_100581339 Ga0068855_1005813392 185
63 3300005564 Ga0070664_100119363 Ga0070664_1001193632 185
64 3300005577 Ga0068857_100002084 Ga0068857_1000020846 185
65 3300005577 Ga0068857_100961786 Ga0068857_1009617861 185
66 3300005614 Ga0068856_100012537 Ga0068856_1000125376 185
67 3300005616 Ga0068852_100245342 Ga0068852_1002453422 185
68 3300005617 Ga0068859_100046398 Ga0068859_1000463983 185
69 3300005618 Ga0068864_100697894 Ga0068864_1006978942 185
70 3300005719 Ga0068861_100110682 Ga0068861_1001106822 185
71 3300005840 Ga0068870_10017233 Ga0068870_100172333 185
72 3300005840 Ga0068870_10074546 Ga0068870_100745462 185
73 3300005844 Ga0068862_100026336 Ga0068862_1000263362 185
74 3300005844 Ga0068862_100081197 Ga0068862_1000811974 185
75 3300005844 Ga0068862_100155710 Ga0068862_1001557103 185
76 3300005844 Ga0068862_100184402 Ga0068862_1001844023 185
77 3300005985 Ga0081539_10005121 Ga0081539_100051218 185
78 3300005985 Ga0081539_10148655 Ga0081539_101486552 185
79 3300005985 Ga0081539_10158516 Ga0081539_101585162 185
80 3300006028 Ga0070717_10509030 Ga0070717_105090302 185
81 3300006038 Ga0075365_10073752 Ga0075365_100737523 185
82 3300006844 Ga0075428_100095377 Ga0075428_1000953772 185
83 3300006844 Ga0075428_100244240 Ga0075428_1002442403 185
84 3300006844 Ga0075428_100314802 Ga0075428_1003148023 185
85 3300006844 Ga0075428_100490342 Ga0075428_1004903422 185
86 3300006844 Ga0075428_100557522 Ga0075428_1005575222 185
87 3300006846 Ga0075430_100081746 Ga0075430_1000817463 185
88 3300006846 Ga0075430_100140964 Ga0075430_1001409642 185
89 3300006846 Ga0075430_100649567 Ga0075430_1006495671 185
90 3300006847 Ga0075431_100003254 Ga0075431_1000032543 185
91 3300006847 Ga0075431_100239338 Ga0075431_1002393382 185
92 3300006847 Ga0075431_100264173 Ga0075431_1002641733 185
93 3300006847 Ga0075431_100551384 Ga0075431_1005513841 185
94 3300006847 Ga0075431_101010803 Ga0075431_1010108031 185
95 3300006852 Ga0075433_10033713 Ga0075433_100337134 185
96 3300006852 Ga0075433_10332324 Ga0075433_103323242 185
97 3300006871 Ga0075434_100053938 Ga0075434_1000539384 185
98 3300006871 Ga0075434_100442779 Ga0075434_1004427792 185
99 3300006871 Ga0075434_100605033 Ga0075434_1006050332 185
100 3300006880 Ga0075429_100002367 Ga0075429_10000236717 185
101 3300006880 Ga0075429_100008742 Ga0075429_1000087428 185
102 3300006880 Ga0075429_100032678 Ga0075429_1000326783 185
103 3300006880 Ga0075429_100152387 Ga0075429_1001523873 185
104 3300006880 Ga0075429_100452628 Ga0075429_1004526282 185
105 3300006931 Ga0097620_100046397 Ga0097620_1000463973 185
106 3300009093 Ga0105240_11574186 Ga0105240_115741861 185
107 3300009098 Ga0105245_10457596 Ga0105245_104575962 185
108 3300009147 Ga0114129_10122090 Ga0114129_101220904 185
109 3300009148 Ga0105243_10054644 Ga0105243_100546443 185
110 3300009148 Ga0105243_10056921 Ga0105243_100569212 185
111 3300009148 Ga0105243_10659644 Ga0105243_106596442 185
112 3300009545 Ga0105237_10638106 Ga0105237_106381061 185
113 3300009553 Ga0105249_10035260 Ga0105249_100352601 185
114 3300009553 Ga0105249_10067506 Ga0105249_100675062 185
115 3300013100 Ga0157373_10608706 Ga0157373_106087061 185
116 3300013105 Ga0157369_10128239 Ga0157369_101282393 185
117 3300013105 Ga0157369_10637149 Ga0157369_106371492 185
118 3300014325 Ga0163163_12235212 Ga0163163_122352121 185
119 3300014326 Ga0157380_10338924 Ga0157380_103389242 185
120 3300020069 Ga0197907_10102979 Ga0197907_101029792 185
121 3300020069 Ga0197907_10118663 Ga0197907_101186631 185
122 3300020069 Ga0197907_10318833 Ga0197907_103188335 185
123 3300020069 Ga0197907_10805073 Ga0197907_108050732 185
124 3300020070 Ga0206356_10116448 Ga0206356_101164483 185
125 3300020070 Ga0206356_10332003 Ga0206356_103320035 185
126 3300020070 Ga0206356_10491885 Ga0206356_104918851 185
127 3300020075 Ga0206349_1543534 Ga0206349_15435342 185
128 3300020075 Ga0206349_1630894 Ga0206349_16308942 185
129 3300020075 Ga0206349_1689260 Ga0206349_16892603 185
130 3300020076 Ga0206355_1169112 Ga0206355_11691123 185
131 3300020076 Ga0206355_1577546 Ga0206355_15775462 185
132 3300020077 Ga0206351_10705360 Ga0206351_107053602 185
133 3300020077 Ga0206351_10889781 Ga0206351_108897812 185
134 3300020077 Ga0206351_10915449 Ga0206351_109154492 185
135 3300020078 Ga0206352_10398982 Ga0206352_103989823 185
136 3300020078 Ga0206352_10637224 Ga0206352_106372242 185
137 3300020078 Ga0206352_10675663 Ga0206352_106756633 185
138 3300020080 Ga0206350_10183039 Ga0206350_101830392 185
139 3300020080 Ga0206350_10283946 Ga0206350_102839461 185
140 3300020080 Ga0206350_11659259 Ga0206350_116592592 185
141 3300020081 Ga0206354_10488103 Ga0206354_104881031 185
142 3300020081 Ga0206354_10908837 Ga0206354_109088373 185
143 3300020082 Ga0206353_10461992 Ga0206353_104619922 185
144 3300020082 Ga0206353_11694258 Ga0206353_116942582 185
145 3300020082 Ga0206353_12034427 Ga0206353_120344271 185
146 3300020610 Ga0154015_1045662 Ga0154015_10456622 185
147 3300022467 Ga0224712_10000853 Ga0224712_100008535 185
148 3300022467 Ga0224712_10049099 Ga0224712_100490992 185
149 3300022467 Ga0224712_10063275 Ga0224712_100632751 185
150 3300022467 Ga0224712_10080727 Ga0224712_100807272 185
151 3300022467 Ga0224712_10361150 Ga0224712_103611501 185
152 3300022467 Ga0224712_10431518 Ga0224712_104315181 185
153 3300025908 Ga0207643_10079517 Ga0207643_100795173 185
154 3300025910 Ga0207684_10001326 Ga0207684_100013267 185
155 3300025910 Ga0207684_10025884 Ga0207684_100258843 185
156 3300025912 Ga0207707_10021502 Ga0207707_100215026 185
157 3300025912 Ga0207707_10139872 Ga0207707_101398722 185
158 3300025914 Ga0207671_10156323 Ga0207671_101563232 185
159 3300025916 Ga0207663_10068070 Ga0207663_100680702 185
160 3300025917 Ga0207660_10045935 Ga0207660_100459353 185
161 3300025917 Ga0207660_10049419 Ga0207660_100494193 185
162 3300025920 Ga0207649_10346205 Ga0207649_103462052 185
163 3300025921 Ga0207652_10409218 Ga0207652_104092182 185
164 3300025921 Ga0207652_10420596 Ga0207652_104205962 185
165 3300025922 Ga0207646_10023711 Ga0207646_100237116 185
166 3300025922 Ga0207646_10373345 Ga0207646_103733452 185
167 3300025922 Ga0207646_10777419 Ga0207646_107774191 185
168 3300025927 Ga0207687_10525777 Ga0207687_105257772 185
169 3300025928 Ga0207700_10018564 Ga0207700_100185645 185
170 3300025929 Ga0207664_10022916 Ga0207664_100229164 185
171 3300025935 Ga0207709_10087895 Ga0207709_100878952 185
172 3300025935 Ga0207709_10365875 Ga0207709_103658752 185
173 3300025935 Ga0207709_10503317 Ga0207709_105033171 185
174 3300025936 Ga0207670_10098535 Ga0207670_100985352 185
175 3300025936 Ga0207670_10214859 Ga0207670_102148592 185
176 3300025936 Ga0207670_10368217 Ga0207670_103682171 185
177 3300025944 Ga0207661_10000572 Ga0207661_100005723 185
178 3300025944 Ga0207661_10024739 Ga0207661_100247394 185
179 3300025944 Ga0207661_10390911 Ga0207661_103909112 185
180 3300025944 Ga0207661_10421547 Ga0207661_104215472 185
181 3300025945 Ga0207679_10009162 Ga0207679_100091626 185
182 3300025949 Ga0207667_10483024 Ga0207667_104830242 185
183 3300025961 Ga0207712_10292078 Ga0207712_102920782 185
184 3300025961 Ga0207712_10510942 Ga0207712_105109422 185
185 3300026035 Ga0207703_11008628 Ga0207703_110086281 185
186 3300026035 Ga0207703_11080127 Ga0207703_110801271 185
187 3300026075 Ga0207708_10010634 Ga0207708_100106346 185
188 3300026078 Ga0207702_10003798 Ga0207702_100037984 185
189 3300026095 Ga0207676_10775709 Ga0207676_107757091 185
190 3300026095 Ga0207676_10841770 Ga0207676_108417702 185
191 3300026116 Ga0207674_10003361 Ga0207674_100033616 185
192 3300026116 Ga0207674_10217772 Ga0207674_102177723 185
193 3300026118 Ga0207675_100024084 Ga0207675_1000240845 185
194 3300027907 Ga0207428_10215980 Ga0207428_102159802 185
195 3300028380 Ga0268265_10027326 Ga0268265_100273265 185
196 3300028380 Ga0268265_10036793 Ga0268265_100367933 185
197 3300028380 Ga0268265_10109157 Ga0268265_101091573 185
198 3300028380 Ga0268265_10242991 Ga0268265_102429913 185
199 3300028654 Ga0265322_10042218 Ga0265322_100422181 185
200 3300031344 Ga0265316_10552883 Ga0265316_105528831 185
201 3300031548 Ga0307408_100134531 Ga0307408_1001345313 185
202 3300031548 Ga0307408_100320302 Ga0307408_1003203022 185
203 3300031665 Ga0316575_10010448 Ga0316575_100104482 185
204 3300031691 Ga0316579_10001173 Ga0316579_100011737 185
205 3300031691 Ga0316579_10004566 Ga0316579_100045663 185
206 3300031691 Ga0316579_10216705 Ga0316579_102167052 185
207 3300031691 Ga0316579_10254801 Ga0316579_102548011 185
208 3300031727 Ga0316576_10023005 Ga0316576_100230053 185
209 3300031727 Ga0316576_10174442 Ga0316576_101744422 185
210 3300031727 Ga0316576_10247706 Ga0316576_102477062 185
211 3300031727 Ga0316576_10492001 Ga0316576_104920011 185
212 3300031727 Ga0316576_10653942 Ga0316576_106539421 185
213 3300031728 Ga0316578_10062862 Ga0316578_100628622 185
214 3300031728 Ga0316578_10420674 Ga0316578_104206742 185
215 3300031731 Ga0307405_10041102 Ga0307405_100411023 185
216 3300031731 Ga0307405_10275939 Ga0307405_102759392 185
217 3300031733 Ga0316577_10000224 Ga0316577_100002248 185
218 3300031733 Ga0316577_10002243 Ga0316577_100022438 185
219 3300031733 Ga0316577_10012363 Ga0316577_100123634 185
220 3300031733 Ga0316577_10034088 Ga0316577_100340881 185
221 3300031733 Ga0316577_10360616 Ga0316577_103606162 185
222 3300031852 Ga0307410_10028601 Ga0307410_100286013 185
223 3300031852 Ga0307410_10313915 Ga0307410_103139151 185
224 3300031901 Ga0307406_10037212 Ga0307406_100372123 185
225 3300031901 Ga0307406_10300601 Ga0307406_103006012 185
226 3300031901 Ga0307406_10402091 Ga0307406_104020912 185
227 3300031903 Ga0307407_10641906 Ga0307407_106419061 185
228 3300031911 Ga0307412_10794084 Ga0307412_107940841 185
229 3300032002 Ga0307416_100228766 Ga0307416_1002287662 185
230 3300032002 Ga0307416_100280696 Ga0307416_1002806962 185
231 3300032002 Ga0307416_100335046 Ga0307416_1003350461 185
232 3300032002 Ga0307416_100435518 Ga0307416_1004355182 185
233 3300032002 Ga0307416_100745722 Ga0307416_1007457222 185
234 3300032005 Ga0307411_10053329 Ga0307411_100533292 185
235 3300032126 Ga0307415_100062468 Ga0307415_1000624682 185
236 3300032126 Ga0307415_100922509 Ga0307415_1009225091 185
237 3300032126 Ga0307415_101435804 Ga0307415_1014358041 185
238 3300032137 Ga0316585_10007771 Ga0316585_100077712 185
239 3300032137 Ga0316585_10024508 Ga0316585_100245082 185
240 3300032168 Ga0316593_10004251 Ga0316593_100042513 185
241 3300032168 Ga0316593_10118109 Ga0316593_101181092 185
242 3300033524 Ga0316592_1027094 Ga0316592_10270941 185
243 3300033528 Ga0316588_1088083 Ga0316588_10880831 185
244 3300035085 Ga0373929_0077510 Ga0373929_0077510_222_779 185
245 3300035172 Ga0373955_0500285 Ga0373955_0500285_136_693 185
246 3300035692 Ga0373935_0172404 Ga0373935_0172404_249_806 185
247 3300035695 Ga0373927_0560843 Ga0373927_0560843_25_582 185
248 3300036401 Ga0373937_0093449 Ga0373937_0093449_624_1181 185
249 3300036401 Ga0373937_0247588 Ga0373937_0247588_989_1546 185
250 3300036401 Ga0373937_0367737 Ga0373937_0367737_744_1301 185
251 3300036647 Ga0316582_0004043 Ga0316582_0004043_3629_4186 185
252 3300036647 Ga0316582_0005225 Ga0316582_0005225_3606_4163 185
253 3300036647 Ga0316582_0025508 Ga0316582_0025508_446_1003 185
254 3300036647 Ga0316582_0205021 Ga0316582_0205021_732_1289 185
255 3300036647 Ga0316582_0403180 Ga0316582_0403180_247_804 185
256 3300036647 Ga0316582_0431833 Ga0316582_0431833_40_597 185
257 3300036647 Ga0316582_0561971 Ga0316582_0561971_30_587 185
258 3300036712 Ga0316584_0003291 Ga0316584_0003291_3949_4506 185
259 3300036712 Ga0316584_0034821 Ga0316584_0034821_2320_2877 185
260 3300036712 Ga0316584_0066410 Ga0316584_0066410_726_1283 185
261 3300036712 Ga0316584_0104272 Ga0316584_0104272_1462_2019 185
262 3300036712 Ga0316584_0149002 Ga0316584_0149002_462_1019 185
263 3300036712 Ga0316584_0396167 Ga0316584_0396167_211_768 185
264 3300037471 Ga0395905_0133528 Ga0395905_0133528_546_1103 185
265 3300037588 Ga0316581_0012994 Ga0316581_0012994_541_1098 185
266 3300037588 Ga0316581_0120978 Ga0316581_0120978_101_658 185
267 3300039093 Ga0400489_60181 Ga0400489_60181_891_1448 185
268 3300042876 Ga0451577_0265159 Ga0451577_0265159_403_960 185
269 3300044673 Ga0453683_0250129 Ga0453683_0250129_19_576 185
270 3300044712 Ga0453684_0000053 Ga0453684_0000053_469664_470221 185
271 3300044712 Ga0453684_0045520 Ga0453684_0045520_1458_2015 185
272 3300044712 Ga0453684_0073645 Ga0453684_0073645_3242_3799 185
273 3300044712 Ga0453684_0108635 Ga0453684_0108635_1513_2070 185
274 3300044712 Ga0453684_0119668 Ga0453684_0119668_658_1215 185
275 3300044712 Ga0453684_0158495 Ga0453684_0158495_1870_2427 185
276 3300044712 Ga0453684_0222742 Ga0453684_0222742_1135_1692 185
277 3300044712 Ga0453684_0469541 Ga0453684_0469541_497_1054 185
278 3300044712 Ga0453684_0658101 Ga0453684_0658101_269_826 185
279 3300044712 Ga0453684_0666745 Ga0453684_0666745_116_673 185
280 3300044712 Ga0453684_1146244 Ga0453684_1146244_76_633 185
281 3300045051 Ga0451576_0061822 Ga0451576_0061822_2836_3393 185
282 3300046462 Ga0495651_0388431 Ga0495651_0388431_346_903 185
283 3300046511 Ga0495608_0346239 Ga0495608_0346239_346_903 185
284 3300046517 Ga0495630_0388810 Ga0495630_0388810_157_714 185
285 3300048907 Ga0496104_0905978 Ga0496104_0905978_71_649 185
286 3300048908 Ga0496105_0541422 Ga0496105_0541422_123_701 185
287 3300048911 Ga0496108_0206749 Ga0496108_0206749_85_642 185
288 3300048912 Ga0496109_0390001 Ga0496109_0390001_466_1023 185
289 3300048912 Ga0496109_0514340 Ga0496109_0514340_448_1026 185
290 3300048913 Ga0496110_0557251 Ga0496110_0557251_293_871 185
291 3300048914 Ga0496111_0346635 Ga0496111_0346635_426_1004 185
292 3300048915 Ga0496112_0070186 Ga0496112_0070186_484_1041 185
293 3300048918 Ga0496115_0167553 Ga0496115_0167553_231_788 185
294 3300049668 Ga0501233_043556 Ga0501233_043556_152_709 185
295 3300049669 Ga0501235_075370 Ga0501235_075370_134_691 185
296 3300050492 nmdc:mga0yw44_65608_c1 nmdc:mga0yw44_65608_c1_988_1545 185
297 3300050507 nmdc:mga05p37_68111_c1 nmdc:mga05p37_68111_c1_3635_4192 185
298 3300050510 nmdc:mga06r32_2735_c1 nmdc:mga06r32_2735_c1_1428_1985 185
299 3300053077 Ga0495601_0291905 Ga0495601_0291905_172_729 185
300 3300053078 Ga0495612_0134372 Ga0495612_0134372_451_1008 185
301 3300053085 Ga0495619_0361165 Ga0495619_0361165_85_642 185
302 3300061734 Ga0530510_0000363 Ga0530510_0000363_16887_17444 185
303 2162886006 SwRhRL3b_contig_1840198 SwRhRL3b_0911.00001870 186
304 2162886007 SwRhRL2b_contig_2432317 SwRhRL2b_0790.00006180 186
305 3300005435 Ga0070714_100861902 Ga0070714_1008619021 186
306 3300005436 Ga0070713_101321111 Ga0070713_1013211111 186
307 3300005467 Ga0070706_100498407 Ga0070706_1004984072 186
308 3300005471 Ga0070698_100847111 Ga0070698_1008471111 186
309 3300005546 Ga0070696_100680010 Ga0070696_1006800101 186
310 3300006051 Ga0075364_10046817 Ga0075364_100468172 186
311 3300006844 Ga0075428_100000031 Ga0075428_1000000318 186
312 3300009094 Ga0111539_10819343 Ga0111539_108193432 186
313 3300009147 Ga0114129_10000864 Ga0114129_1000086416 186
314 3300009147 Ga0114129_10109508 Ga0114129_101095085 186
315 3300009147 Ga0114129_10335944 Ga0114129_103359443 186
316 3300009147 Ga0114129_10390628 Ga0114129_103906281 186
317 3300009148 Ga0105243_10407175 Ga0105243_104071752 186
318 3300009553 Ga0105249_10108931 Ga0105249_101089312 186
319 3300011119 Ga0105246_10032831 Ga0105246_100328312 186
320 3300011119 Ga0105246_10115310 Ga0105246_101153102 186
321 3300011119 Ga0105246_11421002 Ga0105246_114210021 186
322 3300025910 Ga0207684_10103935 Ga0207684_101039354 186
323 3300032139 Ga0316580_10065670 Ga0316580_100656702 186
324 3300035088 Ga0373940_0089593 Ga0373940_0089593_127_687 186
325 3300035398 Ga0316574_0008259 Ga0316574_0008259_543_1112 186
326 3300036647 Ga0316582_0002774 Ga0316582_0002774_4271_4840 186
327 3300037853 Ga0436364_0074556 Ga0436364_0074556_636_1205 186
328 3300042876 Ga0451577_0063812 Ga0451577_0063812_1387_1956 186
329 3300042876 Ga0451577_0347364 Ga0451577_0347364_294_863 186
330 3300042876 Ga0451577_0393538 Ga0451577_0393538_393_953 186
331 3300042876 Ga0451577_0578380 Ga0451577_0578380_376_945 186
332 3300044673 Ga0453683_0002533 Ga0453683_0002533_7816_8385 186
333 3300044673 Ga0453683_0139689 Ga0453683_0139689_771_1340 186
334 3300044712 Ga0453684_0003482 Ga0453684_0003482_29703_30272 186
335 3300044712 Ga0453684_0006006 Ga0453684_0006006_21827_22396 186
336 3300044712 Ga0453684_0011900 Ga0453684_0011900_2276_2845 186
337 3300044712 Ga0453684_0018718 Ga0453684_0018718_5164_5733 186
338 3300044712 Ga0453684_0032135 Ga0453684_0032135_4309_4878 186
339 3300044712 Ga0453684_0033052 Ga0453684_0033052_136_705 186
340 3300044712 Ga0453684_0036874 Ga0453684_0036874_5077_5646 186
341 3300044712 Ga0453684_0045519 Ga0453684_0045519_2609_3178 186
342 3300044712 Ga0453684_0142076 Ga0453684_0142076_1802_2563 186
343 3300044712 Ga0453684_0143643 Ga0453684_0143643_753_1313 186
344 3300044712 Ga0453684_0235393 Ga0453684_0235393_1433_2002 186
345 3300044712 Ga0453684_0345613 Ga0453684_0345613_746_1315 186
346 3300044712 Ga0453684_0351796 Ga0453684_0351796_1080_1649 186
347 3300044712 Ga0453684_0491151 Ga0453684_0491151_562_1143 186
348 3300044712 Ga0453684_0553432 Ga0453684_0553432_348_917 186
349 3300044712 Ga0453684_0871604 Ga0453684_0871604_99_659 186
350 3300044712 Ga0453684_0941752 Ga0453684_0941752_58_618 186
351 3300044712 Ga0453684_1032189 Ga0453684_1032189_256_822 186
352 3300044712 Ga0453684_1524886 Ga0453684_1524886_99_668 186
353 3300045051 Ga0451576_0026475 Ga0451576_0026475_3771_4352 186
354 3300045051 Ga0451576_0030459 Ga0451576_0030459_3511_4128 186
355 3300045051 Ga0451576_0151350 Ga0451576_0151350_1319_1888 186
356 3300045051 Ga0451576_0252667 Ga0451576_0252667_1243_1812 186
357 3300045976 Ga0466967_0626443 Ga0466967_0626443_383_952 186
358 3300048911 Ga0496108_0640613 Ga0496108_0640613_241_801 186
359 3300048918 Ga0496115_0526840 Ga0496115_0526840_162_731 186
360 3300049521 Ga0501298_039450 Ga0501298_039450_179_772 186
361 3300049568 Ga0501031_0227248 Ga0501031_0227248_413_973 186
362 3300049575 Ga0501039_0138068 Ga0501039_0138068_200_760 186
363 3300049576 Ga0501040_0376308 Ga0501040_0376308_447_1007 186
364 3300049577 Ga0501041_0264463 Ga0501041_0264463_275_943 186
365 3300049587 Ga0501071_1031698 Ga0501071_1031698_64_624 186
366 3300049588 Ga0501072_0114063 Ga0501072_0114063_1555_2115 186
367 3300049591 Ga0501075_0129584 Ga0501075_0129584_847_1407 186
368 3300049591 Ga0501075_0185803 Ga0501075_0185803_656_1324 186
369 3300049592 Ga0501076_0121760 Ga0501076_0121760_603_1163 186
370 3300049592 Ga0501076_0590290 Ga0501076_0590290_51_611 186
371 3300049667 Ga0501230_042282 Ga0501230_042282_92_685 186
372 3300049743 Ga0501081_0118412 Ga0501081_0118412_1177_1845 186
373 3300049743 Ga0501081_0700044 Ga0501081_0700044_61_621 186
374 3300049744 Ga0501083_0256751 Ga0501083_0256751_351_911 186
375 3300049824 Ga0501045_0514886 Ga0501045_0514886_293_853 186
376 3300050491 nmdc:mga00v17_72728_c1 nmdc:mga00v17_72728_c1_1112_1675 186
377 3300050492 nmdc:mga0yw44_86205_c2 nmdc:mga0yw44_86205_c2_156_719 186
378 3300050507 nmdc:mga05p37_10588_c1 nmdc:mga05p37_10588_c1_8208_8768 186
379 3300050507 nmdc:mga05p37_320166_c1 nmdc:mga05p37_320166_c1_248_808 186
380 3300050507 nmdc:mga05p37_421465_c1 nmdc:mga05p37_421465_c1_606_1166 186
381 3300050507 nmdc:mga05p37_893956_c1 nmdc:mga05p37_893956_c1_299_859 186
382 3300050508 nmdc:mga09592_106988_c1 nmdc:mga09592_106988_c1_711_1271 186
383 3300050508 nmdc:mga09592_3031_c1 nmdc:mga09592_3031_c1_9214_9774 186
384 3300050509 nmdc:mga0qj67_185142_c1 nmdc:mga0qj67_185142_c1_394_954 186
385 3300050509 nmdc:mga0qj67_344251_c1 nmdc:mga0qj67_344251_c1_62_640 186
386 3300050510 nmdc:mga06r32_164622_c1 nmdc:mga06r32_164622_c1_405_965 186
387 3300050512 nmdc:mga0n895_50819_c1 nmdc:mga0n895_50819_c1_1836_2396 186
388 3300050515 nmdc:mga0a205_14206_c1 nmdc:mga0a205_14206_c1_5293_5853 186
389 3300060353 Ga0501082_0151746 Ga0501082_0151746_539_1099 186
390 3300061734 Ga0530510_0164803 Ga0530510_0164803_239_907 186
391 3300061734 Ga0530510_0494452 Ga0530510_0494452_111_671 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

25

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1is1-assembly1.cif.gz_A crystal structure of ribosome recycling factor from vibrio parahaemolyticus 0.9666 3 186
1is1-assembly1.cif.gz_A crystal structure of ribosome recycling factor from vibrio parahaemolyticus 0.9565 3 186
3lhp-assembly2.cif.gz_T crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9531 107 181
1ise-assembly1.cif.gz_A crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly 0.9483 4 186
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9449 3 186
ID Description Score Start End Superfamily
1dd5A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9899 5 186 1.10.132.20
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9827 4 186 1.10.132.20
4gfqA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9822 4 186 1.10.132.20
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9818 4 186 1.10.132.20
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9774 32 106 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A3S4RG84-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9919 3 186 GO:0002184
GO:0005829
GO:0043023
AF-A0A1V3JZV5-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9919 3 186 GO:0002184
GO:0005829
GO:0043023
AF-A0A1T0B5E9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9907 3 186 GO:0002184
GO:0005829
GO:0043023
AF-I0QP36-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9901 3 186 GO:0002184
GO:0005829
GO:0043023
AF-A0A1V5VD08-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.989 3 186 GO:0005737
GO:0006415
GO:0043023

Feature Viewer

pLDDT pTM Quality
91.15 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map