F431882

General Info

Members Datasets Scaffolds Average Seq Length
390 226 780 226

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2860837431|2860840603
Length 253
Sequence RIKQHKFFSFLKRENKKTKSRDEVKEMKVTYHGHSVITVETKDHHIIFDPFLTGNSLTDIKPEDVKADVILLTHGHNDHVGDTEQIAKQNNALVIAPNELAVYLGWKGLNVHPMHIGGSRQFDFGKVKLTQAFHGSAITDEENKTITYTGMPAGILLTVEDKTIFHAGDTALFSDMKLIGELNHIDLAFLPIGDNFTMGPEDAKLAAEWLRAKQVVPVHYNTFPVIEQDPEAFADSLPGGVGKVMSVGETIEL

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
67 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
79 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
80 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
81 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
123 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 2860837431 Bacillus sp. WR11 Isolate Unclassified
126 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
127 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
128 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
129 2554235283 Bacillus safensis VK Isolate Rhizosphere
130 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
131 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
132 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
133 2643221729 Bacillus sp. Root11 Isolate Unclassified
134 2643221730 Bacillus sp. Root131 Isolate Unclassified
135 2643221731 Bacillus sp. Root147 Isolate Unclassified
136 2643221732 Bacillus sp. Root239 Isolate Unclassified
137 2643221735 Bacillus sp. Root920 Isolate Unclassified
138 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
139 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
140 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
141 2684622632 Bacillus cereus 905 Isolate Unclassified
142 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
143 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
144 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
145 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
146 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
147 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
148 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
149 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
150 2738541295 Bacillus sp. OK085 Isolate Unclassified
151 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
152 2738541358 Bacillus sp. OV752 Isolate Unclassified
153 2738543006 Bacillus sp. OK077 Isolate Unclassified
154 2738543010 Bacillus sp. YR335 Isolate Unclassified
155 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
156 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
157 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
158 2811994870 Bacillus sp. JB4 Isolate Unclassified
159 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
160 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
161 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
162 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
163 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
164 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
165 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
166 2842682962 Bacillus sp. R-72492 Isolate Unclassified
167 2842882022 Bacillus sp. R-71893 Isolate Unclassified
168 2849139964 Bacillus sp. R-71875 Isolate Unclassified
169 2857581216 Bacillus sp. R-71922 Isolate Unclassified
170 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
171 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
172 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
173 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
174 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
175 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
176 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
177 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
178 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
179 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
180 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
181 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
182 2919720352 Priestia megaterium 4340 Isolate Unclassified
183 2919726948 Bacillus pumilus 4489 Isolate Unclassified
184 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
185 2929004312 Priestia megaterium 1104 Isolate Unclassified
186 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
187 2938917290 Bacillus sp. CR71 Isolate Unclassified
188 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
189 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
190 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
191 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
192 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
193 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
194 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
195 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
196 2965761152 Bacillus sp. COPE52 Isolate Unclassified
197 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
198 2969141011 Bacillus velezensis MH25 Isolate Unclassified
199 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
200 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
201 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
202 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
203 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
204 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
205 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
206 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
207 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
208 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
209 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
210 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
211 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
212 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
213 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
214 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
215 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
216 8022653035 Bacillus sp. Rc4 Isolate Unclassified
217 8022792930 Bacillus sp. Xin Isolate Rhizosphere
218 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
219 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
220 8023438354 Bacillus sp. BH2 Isolate Unclassified
221 8023444577 Bacillus sp. BH32 Isolate Unclassified
222 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
223 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
224 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
225 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
226 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.49
Metatranscriptomes 4.36
Isolates 26.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 0
Rhizoplane 5.64
Rhizosphere 65.64
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007735 3300002987 Bacteria 3041
2 JGI25159J45721_1011574 3300002987 Bacteria 2152
3 JGI25151J46595_10000046 3300003187 Bacteria 168647
4 JGI25151J46595_10005640 3300003187 Bacteria 6435
5 JGI25151J46595_10013727 3300003187 Bacteria 3635
6 JGI25151J46595_10057324 3300003187 Bacteria 1271
7 JGI25151J46595_10072223 3300003187 Bacteria 1039
8 rootH1_10001445 3300003316 Bacteria 56583
9 rootH2_10073913 3300003320 Bacteria 5610
10 rootL2_10013974 3300003322 Bacteria 148551
11 rootH1_10053710 3300003323 Bacteria 5934
12 Ga0006562J51391_1000459 3300003578 Bacteria 8870
13 Ga0006562J51391_1002637 3300003578 Bacteria 17100
14 Ga0055532_1004456 3300003758 Bacteria 2109
15 Ga0055536_1047068 3300003781 Bacteria 975
16 Ga0055528_1003542 3300003790 Bacteria 7784
17 Ga0070676_10106217 3300005328 Bacteria 1742
18 Ga0070671_100005118 3300005355 Bacteria 10442
19 Ga0070685_10002015 3300005466 Bacteria 10520
20 Ga0070686_100000007 3300005544 Bacteria 242709
21 Ga0068861_100786385 3300005719 Bacteria 892
22 Ga0097621_100965096 3300006237 Unclassified 796
23 Ga0105251_10006716 3300009011 Bacteria 7264
24 Ga0105244_10003118 3300009036 Bacteria 12082
25 Ga0105244_10037926 3300009036 Bacteria 2516
26 Ga0105244_10047361 3300009036 Bacteria 2206
27 Ga0105244_10053839 3300009036 Bacteria 2043
28 Ga0105250_10006435 3300009092 Bacteria 5129
29 Ga0105245_10020600 3300009098 Bacteria 5783
30 Ga0105247_10010339 3300009101 Bacteria 5643
31 Ga0114129_11054612 3300009147 Unclassified 1020
32 Ga0105242_10020990 3300009176 Bacteria 5123
33 Ga0105242_10782950 3300009176 Bacteria 942
34 Ga0105238_10000012 3300009551 Bacteria 258862
35 Ga0105249_10228684 3300009553 Bacteria 1834
36 Ga0105249_10566363 3300009553 Unclassified 1188
37 Ga0105249_10692814 3300009553 Bacteria 1078
38 Ga0105239_10284269 3300010375 Bacteria 1863
39 Ga0105246_10007951 3300011119 Bacteria 6509
40 Ga0157371_10002617 3300013102 Bacteria 17082
41 Ga0157371_10279107 3300013102 Bacteria 1207
42 Ga0157378_10007084 3300013297 Bacteria 9789
43 Ga0157376_10350222 3300014969 Bacteria 1413
44 Ga0213875_10052661 3300021388 Bacteria 1906
45 Ga0209784_100114 3300025224 Bacteria 89590
46 Ga0209147_100262 3300025229 Bacteria 48219
47 Ga0209147_100826 3300025229 Bacteria 14631
48 Ga0209147_102104 3300025229 Bacteria 5565
49 Ga0209673_1005315 3300025273 Bacteria 6523
50 Ga0209130_1001035 3300025284 Bacteria 21283
51 Ga0209130_1001976 3300025284 Bacteria 11314
52 Ga0209675_1017798 3300025291 Bacteria 2015
53 Ga0209676_1001089 3300025292 Bacteria 30518
54 Ga0209676_1015135 3300025292 Bacteria 2858
55 Ga0209025_1000001 3300025294 Bacteria 1888151
56 Ga0209025_1000567 3300025294 Bacteria 67307
57 Ga0209025_1001722 3300025294 Bacteria 26473
58 Ga0209025_1002223 3300025294 Bacteria 21381
59 Ga0209025_1005703 3300025294 Bacteria 10020
60 Ga0209025_1005758 3300025294 Bacteria 9948
61 Ga0209025_1009421 3300025294 Bacteria 6806
62 Ga0209025_1015405 3300025294 Bacteria 4610
63 Ga0209025_1035265 3300025294 Bacteria 2263
64 Ga0209025_1035711 3300025294 Bacteria 2240
65 Ga0209025_1037775 3300025294 Bacteria 2135
66 Ga0207696_1001334 3300025711 Bacteria 13622
67 Ga0207696_1004100 3300025711 Bacteria 6374
68 Ga0207696_1032926 3300025711 Bacteria 1557
69 Ga0207655_1004378 3300025728 Bacteria 10038
70 Ga0207655_1039562 3300025728 Bacteria 2045
71 Ga0207655_1046803 3300025728 Bacteria 1792
72 Ga0207655_1069131 3300025728 Bacteria 1321
73 Ga0207713_1000727 3300025735 Bacteria 30847
74 Ga0207713_1006197 3300025735 Bacteria 7332
75 Ga0207662_10045533 3300025918 Bacteria 2593
76 Ga0207681_10806864 3300025923 Bacteria 784
77 Ga0207694_10000025 3300025924 Bacteria 258871
78 Ga0207687_10056051 3300025927 Bacteria 2763
79 Ga0207644_10539891 3300025931 Bacteria 964
80 Ga0207686_10054573 3300025934 Bacteria 2503
81 Ga0237817_10414 3300030083 Bacteria 7011
82 Ga0237817_10420 3300030083 Bacteria 6883
83 Ga0307408_100294566 3300031548 Bacteria 1357
84 Ga0307408_100388232 3300031548 Bacteria 1195
85 Ga0307408_100521445 3300031548 Bacteria 1044
86 Ga0316575_10010302 3300031665 Unclassified 3431
87 Ga0316575_10014151 3300031665 Unclassified 2991
88 Ga0316575_10015872 3300031665 Bacteria 2842
89 Ga0316575_10055233 3300031665 Bacteria 1581
90 Ga0316575_10092680 3300031665 Bacteria 1224
91 Ga0316575_10127479 3300031665 Bacteria 1043
92 Ga0316575_10226752 3300031665 Unclassified 780
93 Ga0316579_10003268 3300031691 Bacteria 6291
94 Ga0316579_10003919 3300031691 Bacteria 5864
95 Ga0316579_10004762 3300031691 Bacteria 5419
96 Ga0316579_10017080 3300031691 Bacteria 3179
97 Ga0316579_10018466 3300031691 Bacteria 3071
98 Ga0316579_10035098 3300031691 Bacteria 2310
99 Ga0316579_10043990 3300031691 Bacteria 2079
100 Ga0316576_10000114 3300031727 Bacteria 30289
101 Ga0316576_10002477 3300031727 Bacteria 10508
102 Ga0316576_10003543 3300031727 Bacteria 9176
103 Ga0316576_10012572 3300031727 Bacteria 5598
104 Ga0316576_10037790 3300031727 Bacteria 3458
105 Ga0316576_10045941 3300031727 Bacteria 3159
106 Ga0316576_10063818 3300031727 Bacteria 2704
107 Ga0316576_10081402 3300031727 Bacteria 2402
108 Ga0316576_10119593 3300031727 Bacteria 1977
109 Ga0316576_10175177 3300031727 Bacteria 1618
110 Ga0316576_10218403 3300031727 Bacteria 1434
111 Ga0316578_10000215 3300031728 Bacteria 16628
112 Ga0316578_10004691 3300031728 Bacteria 6496
113 Ga0316578_10008205 3300031728 Bacteria 5296
114 Ga0316578_10012124 3300031728 Bacteria 4538
115 Ga0316578_10025776 3300031728 Bacteria 3309
116 Ga0316578_10061759 3300031728 Bacteria 2208
117 Ga0316578_10097434 3300031728 Unclassified 1761
118 Ga0316578_10184422 3300031728 Unclassified 1257
119 Ga0316578_10224288 3300031728 Bacteria 1129
120 Ga0316578_10348001 3300031728 Unclassified 882
121 Ga0307405_10228985 3300031731 Bacteria 1369
122 Ga0316577_10001430 3300031733 Bacteria 11292
123 Ga0316577_10002218 3300031733 Bacteria 9552
124 Ga0316577_10002992 3300031733 Bacteria 8460
125 Ga0316577_10010859 3300031733 Bacteria 4924
126 Ga0316577_10023590 3300031733 Bacteria 3416
127 Ga0316577_10055052 3300031733 Bacteria 2220
128 Ga0316577_10070375 3300031733 Unclassified 1953
129 Ga0316577_10084611 3300031733 Bacteria 1774
130 Ga0316577_10094137 3300031733 Bacteria 1677
131 Ga0316577_10165060 3300031733 Unclassified 1249
132 Ga0316577_10243405 3300031733 Bacteria 1017
133 Ga0316577_10334871 3300031733 Bacteria 858
134 Ga0316577_10353188 3300031733 Unclassified 834
135 Ga0307409_100562320 3300031995 Bacteria 1121
136 Ga0307416_100163500 3300032002 Bacteria 2061
137 Ga0307416_100781133 3300032002 Bacteria 1050
138 Ga0307416_101177490 3300032002 Bacteria 872
139 Ga0307411_10571159 3300032005 Bacteria 968
140 Ga0316583_10006412 3300032133 Bacteria 4225
141 Ga0316583_10009545 3300032133 Bacteria 3495
142 Ga0316583_10027905 3300032133 Bacteria 2014
143 Ga0316583_10126017 3300032133 Bacteria 892
144 Ga0316585_10000966 3300032137 Bacteria 7384
145 Ga0316585_10002319 3300032137 Bacteria 5121
146 Ga0316585_10004213 3300032137 Bacteria 3996
147 Ga0316585_10039978 3300032137 Bacteria 1492
148 Ga0316585_10104388 3300032137 Bacteria 930
149 Ga0316580_10000102 3300032139 Bacteria 15459
150 Ga0316580_10002406 3300032139 Bacteria 5131
151 Ga0316580_10014929 3300032139 Bacteria 2374
152 Ga0316580_10035510 3300032139 Unclassified 1542
153 Ga0316580_10048523 3300032139 Bacteria 1308
154 Ga0316593_10009986 3300032168 Unclassified 2705
155 Ga0316593_10146012 3300032168 Bacteria 859
156 Ga0316592_1008057 3300033524 Bacteria 2071
157 Ga0316592_1015098 3300033524 Bacteria 1606
158 Ga0316588_1009049 3300033528 Bacteria 2067
159 Ga0316588_1013494 3300033528 Bacteria 1774
160 Ga0316596_1008730 3300033541 Bacteria 2422
161 Ga0316596_1022214 3300033541 Bacteria 1621
162 Ga0373930_0054017 3300034816 Bacteria 883
163 Ga0373959_0000008 3300034820 Bacteria 54263
164 Ga0316574_0000336 3300035398 Bacteria 18126
165 Ga0316574_0012914 3300035398 Bacteria 4790
166 Ga0316574_0013243 3300035398 Bacteria 4736
167 Ga0316574_0081509 3300035398 Bacteria 2055
168 Ga0316574_0086114 3300035398 Bacteria 1999
169 Ga0316574_0087898 3300035398 Bacteria 1979
170 Ga0316574_0131959 3300035398 Unclassified 1607
171 Ga0316574_0180157 3300035398 Bacteria 1359
172 Ga0316574_0192491 3300035398 Bacteria 1311
173 Ga0316574_0197749 3300035398 Bacteria 1292
174 Ga0316574_0351119 3300035398 Bacteria 933
175 Ga0316574_0356913 3300035398 Bacteria 924
176 Ga0316582_0000910 3300036647 Bacteria 12147
177 Ga0316582_0002581 3300036647 Bacteria 8582
178 Ga0316582_0005830 3300036647 Bacteria 6399
179 Ga0316582_0009142 3300036647 Bacteria 5363
180 Ga0316582_0013124 3300036647 Unclassified 4653
181 Ga0316582_0016956 3300036647 Bacteria 4201
182 Ga0316582_0037777 3300036647 Bacteria 2996
183 Ga0316582_0105444 3300036647 Bacteria 1871
184 Ga0316582_0136351 3300036647 Bacteria 1652
185 Ga0316582_0153604 3300036647 Bacteria 1557
186 Ga0316582_0158458 3300036647 Unclassified 1532
187 Ga0316582_0159547 3300036647 Unclassified 1527
188 Ga0316582_0170603 3300036647 Bacteria 1477
189 Ga0316582_0219262 3300036647 Bacteria 1300
190 Ga0316582_0302220 3300036647 Bacteria 1100
191 Ga0316582_0336798 3300036647 Bacteria 1037
192 Ga0316582_0357019 3300036647 Bacteria 1006
193 Ga0316582_0582666 3300036647 Bacteria 770
194 Ga0316584_0000038 3300036712 Bacteria 47595
195 Ga0316584_0001221 3300036712 Bacteria 15179
196 Ga0316584_0001629 3300036712 Bacteria 13699
197 Ga0316584_0005543 3300036712 Bacteria 8486
198 Ga0316584_0017629 3300036712 Bacteria 5140
199 Ga0316584_0017705 3300036712 Bacteria 5130
200 Ga0316584_0018044 3300036712 Bacteria 5086
201 Ga0316584_0021026 3300036712 Bacteria 4738
202 Ga0316584_0027600 3300036712 Bacteria 4179
203 Ga0316584_0030107 3300036712 Bacteria 4009
204 Ga0316584_0031443 3300036712 Bacteria 3925
205 Ga0316584_0061941 3300036712 Bacteria 2802
206 Ga0316584_0095724 3300036712 Bacteria 2222
207 Ga0316584_0103738 3300036712 Bacteria 2128
208 Ga0316584_0151745 3300036712 Bacteria 1724
209 Ga0316584_0184403 3300036712 Unclassified 1544
210 Ga0316584_0470671 3300036712 Bacteria 886
211 Ga0395899_0008231 3300037312 Bacteria 8032
212 Ga0395900_0045877 3300037418 Bacteria 4501
213 Ga0395898_0082886 3300037466 Bacteria 3091
214 Ga0395898_0765103 3300037466 Bacteria 907
215 Ga0395905_0016608 3300037471 Bacteria 6996
216 Ga0395905_0499826 3300037471 Bacteria 1116
217 Ga0316581_0000297 3300037588 Bacteria 8840
218 Ga0316581_0003213 3300037588 Bacteria 4042
219 Ga0316581_0003649 3300037588 Bacteria 3852
220 Ga0316581_0007243 3300037588 Bacteria 2969
221 Ga0316581_0025747 3300037588 Bacteria 1751
222 Ga0436364_1407754 3300037853 Bacteria 5885
223 Ga0395901_0009137 3300038443 Bacteria 10038
224 Ga0237819_00360 3300038705 Bacteria 16209
225 Ga0237819_00456 3300038705 Bacteria 13928
226 Ga0400484_23468 3300038725 Bacteria 4319
227 Ga0400490_26529 3300038726 Bacteria 1207
228 Ga0400490_43196 3300038726 Bacteria 7780
229 Ga0400488_28825 3300038741 Bacteria 28328
230 Ga0400483_137959 3300039062 Bacteria 1125
231 Ga0400489_50184 3300039093 Bacteria 7751
232 Ga0400487_65955 3300039110 Bacteria 3893
233 Ga0453684_0000627 3300044712 Bacteria 128570
234 Ga0453684_0090471 3300044712 Bacteria 3781
235 Ga0453684_0442695 3300044712 Bacteria 1448
236 Ga0466967_0000077 3300045976 Bacteria 35774
237 Ga0495627_047962 3300046453 Bacteria 1294
238 Ga0495585_0006277 3300046492 Bacteria 7394
239 Ga0495654_0115861 3300046530 Bacteria 1218
240 Ga0495622_0014726 3300046557 Bacteria 3632
241 Ga0495661_0051867 3300046665 Bacteria 2475
242 Ga0495661_0163445 3300046665 Bacteria 1193
243 Ga0495683_0018562 3300047323 Bacteria 3594
244 Ga0495626_0070390 3300048091 Bacteria 1574
245 Ga0496100_0000584 3300048903 Bacteria 17217
246 Ga0496100_0222872 3300048903 Bacteria 1385
247 Ga0496100_0714254 3300048903 Bacteria 783
248 Ga0496101_0330389 3300048904 Bacteria 1197
249 Ga0496101_0424103 3300048904 Bacteria 1048
250 Ga0496102_0004867 3300048905 Bacteria 11360
251 Ga0496103_0007473 3300048906 Bacteria 6513
252 Ga0496104_0163981 3300048907 Bacteria 2131
253 Ga0496105_0000266 3300048908 Bacteria 34749
254 Ga0496106_0000224 3300048909 Bacteria 39551
255 Ga0496107_0011410 3300048910 Bacteria 6188
256 Ga0496108_0002369 3300048911 Bacteria 15094
257 Ga0496109_0003788 3300048912 Bacteria 12621
258 Ga0496109_0199681 3300048912 Bacteria 1880
259 Ga0496110_0000612 3300048913 Bacteria 24597
260 Ga0496110_0162206 3300048913 Bacteria 2026
261 Ga0496110_0202314 3300048913 Bacteria 1805
262 Ga0496111_0026805 3300048914 Bacteria 4071
263 Ga0496112_0002638 3300048915 Bacteria 14492
264 Ga0496112_0054572 3300048915 Bacteria 3926
265 Ga0496113_0114189 3300048916 Bacteria 2105
266 Ga0496113_0208829 3300048916 Bacteria 1554
267 Ga0496116_0055661 3300048919 Bacteria 2597
268 Ga0496118_0087869 3300048921 Bacteria 2153
269 Ga0496119_0003336 3300048922 Bacteria 16723
270 Ga0496120_0048780 3300048923 Bacteria 2435
271 Ga0496122_0078367 3300048925 Bacteria 2314
272 Ga0496123_0049803 3300048926 Bacteria 2805
273 Ga0496125_0006100 3300048928 Bacteria 13156
274 Ga0496126_0036280 3300048929 Bacteria 4610
275 Ga0496126_0513663 3300048929 Bacteria 956
276 Ga0501305_005936 3300049161 Bacteria 1501
277 Ga0501311_019608 3300049527 Bacteria 908
278 Ga0501312_008313 3300049528 Bacteria 1346
279 Ga0501312_013381 3300049528 Bacteria 1140
280 Ga0501312_017751 3300049528 Bacteria 1030
281 Ga0501312_045713 3300049528 Bacteria 726
282 Ga0501315_017801 3300049531 Bacteria 932
283 Ga0501073_0138652 3300049589 Bacteria 1685
284 Ga0501073_0435676 3300049589 Bacteria 906
285 Ga0501076_0821892 3300049592 Bacteria 767
286 Ga0501266_023613 3300049763 Bacteria 850
287 Ga0500628_033845 3300053129 Bacteria 1126
288 Ga0590077_019253 3300059426 Bacteria 1445
289 2860840603 2860837431 Bacteria 4202080
290 2511700602 2511231119 Bacteria 4019861
291 2540607827 2540341094 Bacteria 4061186
292 2545557304 2545555800 Bacteria 4222588
293 2555469877 2554235283 Bacteria 3683090
294 2556062986 2554235469 Bacteria 3590176
295 2578931567 2576861599 Bacteria 4217202
296 2631984496 2630968484 Bacteria 3876276
297 2644706408 2643221729 Bacteria 6621700
298 2644713089 2643221730 Bacteria 6523787
299 2644715530 2643221731 Bacteria 5623886
300 2644726834 2643221732 Bacteria 5756404
301 2644741469 2643221735 Bacteria 3676263
302 2651532676 2648501850 Bacteria 3975476
303 2672337358 2671180330 Bacteria 5521719
304 2674418570 2671180844 Bacteria 4164150
305 2685152580 2684622632 Bacteria 5380049
306 2686997889 2684623153 Bacteria 3878815
307 2687499230 2687453109 Bacteria 3860091
308 2695628597 2695420354 Bacteria 3922431
309 2698320590 2695420987 Bacteria 6152737
310 2705996503 2703719227 Bacteria 5631989
311 2712198196 2711768088 Bacteria 3195027
312 2717915709 2716884898 Bacteria 3928789
313 2721507738 2718218445 Bacteria 5113413
314 2738815501 2738541295 Bacteria 5730091
315 2738838312 2738541299 Bacteria 4020721
316 2739157631 2738541358 Bacteria 5932299
317 2739209723 2738543006 Bacteria 5904091
318 2739229877 2738543010 Bacteria 5583595
319 2791214815 2788500588 Bacteria 4584915
320 2808869740 2808606364 Bacteria 4465927
321 2809056192 2808606399 Bacteria 4021018
322 2812317084 2811994870 Bacteria 3776934
323 2816862220 2816332186 Bacteria 5331395
324 2817481193 2816332295 Bacteria 4352468
325 2819581495 2818991443 Bacteria 6598732
326 2819627816 2818991451 Bacteria 4697364
327 2819708998 2818991465 Bacteria 5388835
328 2819724164 2818991468 Bacteria 3723169
329 2823529042 2823526263 Bacteria 3765752
330 2842684866 2842682962 Bacteria 5589973
331 2842884763 2842882022 Bacteria 6158489
332 2849141422 2849139964 Bacteria 5613304
333 2857584155 2857581216 Bacteria 5522813
334 2857610539 2857609550 Bacteria 3753890
335 2877771510 2877768649 Bacteria 3957164
336 2880172364 2880169592 Bacteria 3900066
337 2897112638 2897109615 Bacteria 4009619
338 2904524207 2904524088 Bacteria 5887454
339 2904564407 2904560550 Bacteria 4029838
340 2904609601 2904606771 Bacteria 4684500
341 2908667743 2908665501 Bacteria 3678115
342 2919095538 2919093281 Bacteria 3660974
343 2919147216 2919143609 Bacteria 6219228
344 2919417624 2919414237 Bacteria 5429133
345 2919519120 2919517244 Bacteria 5858162
346 2919723488 2919720352 Bacteria 5986006
347 2919728754 2919726948 Bacteria 3696050
348 2928095985 2928093941 Bacteria 5965005
349 2929006643 2929004312 Bacteria 5678476
350 2929238285 2929233124 Bacteria 5948380
351 2938922477 2938917290 Bacteria 5914775
352 2939595332 2939593269 Bacteria 4798695
353 2947431370 2947426588 Bacteria 5357194
354 2954773409 2954773129 Bacteria 3741715
355 2956897707 2956897341 Bacteria 5447711
356 2960319604 2960319331 Bacteria 5502575
357 2960381185 2960375949 Bacteria 5361395
358 2962293814 2962290636 Bacteria 4072939
359 2964379351 2964375228 Bacteria 4909004
360 2965765885 2965761152 Bacteria 5806513
361 2969139808 2969136845 Bacteria 3923176
362 2969143958 2969141011 Bacteria 4118468
363 2969769724 2969765954 Bacteria 4216713
364 2969772787 2969770375 Bacteria 4271280
365 2971416730 2971410472 Bacteria 8311090
366 2979088271 2979083700 Bacteria 5894929
367 2980495597 2980492589 Bacteria 4072961
368 3001268716 3001267043 Bacteria 4823521
369 3001274177 3001272096 Bacteria 4729684
370 3001897494 3001892409 Bacteria 6328293
371 3006827214 3006826541 Bacteria 4678913
372 3006861608 3006858327 Bacteria 4317835
373 3006882233 3006879489 Bacteria 4064221
374 3006971889 3006969106 Bacteria 4739423
375 3006976218 3006973921 Bacteria 4423788
376 3006982156 3006978542 Bacteria 5328100
377 3006988650 3006988479 Bacteria 4767936
378 8022624534 8022621104 Bacteria 5241040
379 8022632236 8022630665 Bacteria 3886130
380 8022654761 8022653035 Bacteria 4035078
381 8022797997 8022792930 Bacteria 5693794
382 8022898466 8022893055 Bacteria 5300455
383 8022917617 8022914991 Bacteria 5584517
384 8023443697 8023438354 Bacteria 5779374
385 8023445480 8023444577 Bacteria 5661597
386 8051954861 8051952484 Bacteria 3926774
387 8052176422 8052174270 Bacteria 3881265
388 8056537010 8056533031 Bacteria 8964429
389 8057587034 8057582654 Bacteria 5218944
390 8057635743 8057632132 Bacteria 4726859
391 JGI25159J45721_1007735
392 JGI25159J45721_1011574
393 JGI25151J46595_10000046
394 JGI25151J46595_10005640
395 JGI25151J46595_10013727
396 JGI25151J46595_10057324
397 JGI25151J46595_10072223
398 rootH1_10001445
399 rootH2_10073913
400 rootL2_10013974
401 rootH1_10053710
402 Ga0006562J51391_1000459
403 Ga0006562J51391_1002637
404 Ga0055532_1004456
405 Ga0055536_1047068
406 Ga0055528_1003542
407 Ga0070676_10106217
408 Ga0070671_100005118
409 Ga0070685_10002015
410 Ga0070686_100000007
411 Ga0068861_100786385
412 Ga0097621_100965096
413 Ga0105251_10006716
414 Ga0105244_10003118
415 Ga0105244_10037926
416 Ga0105244_10047361
417 Ga0105244_10053839
418 Ga0105250_10006435
419 Ga0105245_10020600
420 Ga0105247_10010339
421 Ga0114129_11054612
422 Ga0105242_10020990
423 Ga0105242_10782950
424 Ga0105238_10000012
425 Ga0105249_10228684
426 Ga0105249_10566363
427 Ga0105249_10692814
428 Ga0105239_10284269
429 Ga0105246_10007951
430 Ga0157371_10002617
431 Ga0157371_10279107
432 Ga0157378_10007084
433 Ga0157376_10350222
434 Ga0213875_10052661
435 Ga0209784_100114
436 Ga0209147_100262
437 Ga0209147_100826
438 Ga0209147_102104
439 Ga0209673_1005315
440 Ga0209130_1001035
441 Ga0209130_1001976
442 Ga0209675_1017798
443 Ga0209676_1001089
444 Ga0209676_1015135
445 Ga0209025_1000001
446 Ga0209025_1000567
447 Ga0209025_1001722
448 Ga0209025_1002223
449 Ga0209025_1005703
450 Ga0209025_1005758
451 Ga0209025_1009421
452 Ga0209025_1015405
453 Ga0209025_1035265
454 Ga0209025_1035711
455 Ga0209025_1037775
456 Ga0207696_1001334
457 Ga0207696_1004100
458 Ga0207696_1032926
459 Ga0207655_1004378
460 Ga0207655_1039562
461 Ga0207655_1046803
462 Ga0207655_1069131
463 Ga0207713_1000727
464 Ga0207713_1006197
465 Ga0207662_10045533
466 Ga0207681_10806864
467 Ga0207694_10000025
468 Ga0207687_10056051
469 Ga0207644_10539891
470 Ga0207686_10054573
471 Ga0237817_10414
472 Ga0237817_10420
473 Ga0307408_100294566
474 Ga0307408_100388232
475 Ga0307408_100521445
476 Ga0316575_10010302
477 Ga0316575_10014151
478 Ga0316575_10015872
479 Ga0316575_10055233
480 Ga0316575_10092680
481 Ga0316575_10127479
482 Ga0316575_10226752
483 Ga0316579_10003268
484 Ga0316579_10003919
485 Ga0316579_10004762
486 Ga0316579_10017080
487 Ga0316579_10018466
488 Ga0316579_10035098
489 Ga0316579_10043990
490 Ga0316576_10000114
491 Ga0316576_10002477
492 Ga0316576_10003543
493 Ga0316576_10012572
494 Ga0316576_10037790
495 Ga0316576_10045941
496 Ga0316576_10063818
497 Ga0316576_10081402
498 Ga0316576_10119593
499 Ga0316576_10175177
500 Ga0316576_10218403
501 Ga0316578_10000215
502 Ga0316578_10004691
503 Ga0316578_10008205
504 Ga0316578_10012124
505 Ga0316578_10025776
506 Ga0316578_10061759
507 Ga0316578_10097434
508 Ga0316578_10184422
509 Ga0316578_10224288
510 Ga0316578_10348001
511 Ga0307405_10228985
512 Ga0316577_10001430
513 Ga0316577_10002218
514 Ga0316577_10002992
515 Ga0316577_10010859
516 Ga0316577_10023590
517 Ga0316577_10055052
518 Ga0316577_10070375
519 Ga0316577_10084611
520 Ga0316577_10094137
521 Ga0316577_10165060
522 Ga0316577_10243405
523 Ga0316577_10334871
524 Ga0316577_10353188
525 Ga0307409_100562320
526 Ga0307416_100163500
527 Ga0307416_100781133
528 Ga0307416_101177490
529 Ga0307411_10571159
530 Ga0316583_10006412
531 Ga0316583_10009545
532 Ga0316583_10027905
533 Ga0316583_10126017
534 Ga0316585_10000966
535 Ga0316585_10002319
536 Ga0316585_10004213
537 Ga0316585_10039978
538 Ga0316585_10104388
539 Ga0316580_10000102
540 Ga0316580_10002406
541 Ga0316580_10014929
542 Ga0316580_10035510
543 Ga0316580_10048523
544 Ga0316593_10009986
545 Ga0316593_10146012
546 Ga0316592_1008057
547 Ga0316592_1015098
548 Ga0316588_1009049
549 Ga0316588_1013494
550 Ga0316596_1008730
551 Ga0316596_1022214
552 Ga0373930_0054017
553 Ga0373959_0000008
554 Ga0316574_0000336
555 Ga0316574_0012914
556 Ga0316574_0013243
557 Ga0316574_0081509
558 Ga0316574_0086114
559 Ga0316574_0087898
560 Ga0316574_0131959
561 Ga0316574_0180157
562 Ga0316574_0192491
563 Ga0316574_0197749
564 Ga0316574_0351119
565 Ga0316574_0356913
566 Ga0316582_0000910
567 Ga0316582_0002581
568 Ga0316582_0005830
569 Ga0316582_0009142
570 Ga0316582_0013124
571 Ga0316582_0016956
572 Ga0316582_0037777
573 Ga0316582_0105444
574 Ga0316582_0136351
575 Ga0316582_0153604
576 Ga0316582_0158458
577 Ga0316582_0159547
578 Ga0316582_0170603
579 Ga0316582_0219262
580 Ga0316582_0302220
581 Ga0316582_0336798
582 Ga0316582_0357019
583 Ga0316582_0582666
584 Ga0316584_0000038
585 Ga0316584_0001221
586 Ga0316584_0001629
587 Ga0316584_0005543
588 Ga0316584_0017629
589 Ga0316584_0017705
590 Ga0316584_0018044
591 Ga0316584_0021026
592 Ga0316584_0027600
593 Ga0316584_0030107
594 Ga0316584_0031443
595 Ga0316584_0061941
596 Ga0316584_0095724
597 Ga0316584_0103738
598 Ga0316584_0151745
599 Ga0316584_0184403
600 Ga0316584_0470671
601 Ga0395899_0008231
602 Ga0395900_0045877
603 Ga0395898_0082886
604 Ga0395898_0765103
605 Ga0395905_0016608
606 Ga0395905_0499826
607 Ga0316581_0000297
608 Ga0316581_0003213
609 Ga0316581_0003649
610 Ga0316581_0007243
611 Ga0316581_0025747
612 Ga0436364_1407754
613 Ga0395901_0009137
614 Ga0237819_00360
615 Ga0237819_00456
616 Ga0400484_23468
617 Ga0400490_26529
618 Ga0400490_43196
619 Ga0400488_28825
620 Ga0400483_137959
621 Ga0400489_50184
622 Ga0400487_65955
623 Ga0453684_0000627
624 Ga0453684_0090471
625 Ga0453684_0442695
626 Ga0466967_0000077
627 Ga0495627_047962
628 Ga0495585_0006277
629 Ga0495654_0115861
630 Ga0495622_0014726
631 Ga0495661_0051867
632 Ga0495661_0163445
633 Ga0495683_0018562
634 Ga0495626_0070390
635 Ga0496100_0000584
636 Ga0496100_0222872
637 Ga0496100_0714254
638 Ga0496101_0330389
639 Ga0496101_0424103
640 Ga0496102_0004867
641 Ga0496103_0007473
642 Ga0496104_0163981
643 Ga0496105_0000266
644 Ga0496106_0000224
645 Ga0496107_0011410
646 Ga0496108_0002369
647 Ga0496109_0003788
648 Ga0496109_0199681
649 Ga0496110_0000612
650 Ga0496110_0162206
651 Ga0496110_0202314
652 Ga0496111_0026805
653 Ga0496112_0002638
654 Ga0496112_0054572
655 Ga0496113_0114189
656 Ga0496113_0208829
657 Ga0496116_0055661
658 Ga0496118_0087869
659 Ga0496119_0003336
660 Ga0496120_0048780
661 Ga0496122_0078367
662 Ga0496123_0049803
663 Ga0496125_0006100
664 Ga0496126_0036280
665 Ga0496126_0513663
666 Ga0501305_005936
667 Ga0501311_019608
668 Ga0501312_008313
669 Ga0501312_013381
670 Ga0501312_017751
671 Ga0501312_045713
672 Ga0501315_017801
673 Ga0501073_0138652
674 Ga0501073_0435676
675 Ga0501076_0821892
676 Ga0501266_023613
677 Ga0500628_033845
678 Ga0590077_019253
679 2860840603
680 2511700602
681 2540607827
682 2545557304
683 2555469877
684 2556062986
685 2578931567
686 2631984496
687 2644706408
688 2644713089
689 2644715530
690 2644726834
691 2644741469
692 2651532676
693 2672337358
694 2674418570
695 2685152580
696 2686997889
697 2687499230
698 2695628597
699 2698320590
700 2705996503
701 2712198196
702 2717915709
703 2721507738
704 2738815501
705 2738838312
706 2739157631
707 2739209723
708 2739229877
709 2791214815
710 2808869740
711 2809056192
712 2812317084
713 2816862220
714 2817481193
715 2819581495
716 2819627816
717 2819708998
718 2819724164
719 2823529042
720 2842684866
721 2842884763
722 2849141422
723 2857584155
724 2857610539
725 2877771510
726 2880172364
727 2897112638
728 2904524207
729 2904564407
730 2904609601
731 2908667743
732 2919095538
733 2919147216
734 2919417624
735 2919519120
736 2919723488
737 2919728754
738 2928095985
739 2929006643
740 2929238285
741 2938922477
742 2939595332
743 2947431370
744 2954773409
745 2956897707
746 2960319604
747 2960381185
748 2962293814
749 2964379351
750 2965765885
751 2969139808
752 2969143958
753 2969769724
754 2969772787
755 2971416730
756 2979088271
757 2980495597
758 3001268716
759 3001274177
760 3001897494
761 3006827214
762 3006861608
763 3006882233
764 3006971889
765 3006976218
766 3006982156
767 3006988650
768 8022624534
769 8022632236
770 8022654761
771 8022797997
772 8022898466
773 8022917617
774 8023443697
775 8023445480
776 8051954861
777 8052176422
778 8056537010
779 8057587034
780 8057635743

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

29

220

0.91

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

44

220

0.85

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

28

219

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.9714 1 227
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.9672 1 227
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.9668 1 227
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.9631 1 227
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.9489 2 227
ID Description Score Start End Superfamily
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9758 1 227 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9716 1 227 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9617 1 227 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9574 1 227 3.60.15.10
af_Q58563_1_217_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.932 3 227 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2V2KWV2-F1-model_v4 deleted 1.006 1 85
AF-A0A4Q2HNX0-F1-model_v4 deleted 1.003 1 111
AF-A0A855WSV6-F1-model_v4 deleted 1 1 147
AF-A0A2V2KWV2-F1-model_v4 deleted 0.9941 1 85
AF-A0A4Q2HNX0-F1-model_v4 deleted 0.9936 1 111

Map