F431882
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 390 | 226 | 780 | 226 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2860837431|2860840603 |
| Length | 253 |
| Sequence | RIKQHKFFSFLKRENKKTKSRDEVKEMKVTYHGHSVITVETKDHHIIFDPFLTGNSLTDIKPEDVKADVILLTHGHNDHVGDTEQIAKQNNALVIAPNELAVYLGWKGLNVHPMHIGGSRQFDFGKVKLTQAFHGSAITDEENKTITYTGMPAGILLTVEDKTIFHAGDTALFSDMKLIGELNHIDLAFLPIGDNFTMGPEDAKLAAEWLRAKQVVPVHYNTFPVIEQDPEAFADSLPGGVGKVMSVGETIEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 16 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 32 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 35 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 37 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 49 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 50 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 51 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 52 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 53 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 54 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 55 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 56 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 57 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 58 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 59 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 60 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 61 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 62 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 67 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 68 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 69 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 70 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 71 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 72 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 73 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 74 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 75 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 76 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 79 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 80 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 81 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 82 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 83 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 84 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 85 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 86 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 87 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 97 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 98 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 99 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 100 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 101 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 102 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 104 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 105 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 106 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 107 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 108 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 109 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 110 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 111 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 112 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 113 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 114 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 115 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 116 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 123 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 124 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 125 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 126 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 127 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 128 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 129 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 130 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 131 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 132 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 133 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 134 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 135 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 136 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 137 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 138 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 139 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 140 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 141 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 142 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 143 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 144 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 145 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 146 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 147 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 148 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 149 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 150 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 151 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 152 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 153 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 154 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 155 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 156 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 157 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 158 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 159 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 160 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 161 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 162 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 163 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 164 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 165 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 166 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 167 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 168 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 169 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 170 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 171 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 172 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 173 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 174 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 175 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 176 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 177 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 178 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 179 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 180 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 181 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 182 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 183 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 184 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 185 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 186 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 187 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 188 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 189 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 190 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 191 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 192 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 193 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 194 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 195 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 196 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 197 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 198 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 199 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 200 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 201 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 202 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 203 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 204 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 205 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 206 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 207 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 208 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 209 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 210 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 211 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 212 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 213 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 214 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 215 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 216 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 217 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 218 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 219 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 220 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 221 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 222 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 223 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 224 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 225 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 226 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.49 |
| Metatranscriptomes | 4.36 |
| Isolates | 26.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.21 |
| Nodule | 0 |
| Rhizoplane | 5.64 |
| Rhizosphere | 65.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1007735 | 3300002987 | Bacteria | 3041 |
| 2 | JGI25159J45721_1011574 | 3300002987 | Bacteria | 2152 |
| 3 | JGI25151J46595_10000046 | 3300003187 | Bacteria | 168647 |
| 4 | JGI25151J46595_10005640 | 3300003187 | Bacteria | 6435 |
| 5 | JGI25151J46595_10013727 | 3300003187 | Bacteria | 3635 |
| 6 | JGI25151J46595_10057324 | 3300003187 | Bacteria | 1271 |
| 7 | JGI25151J46595_10072223 | 3300003187 | Bacteria | 1039 |
| 8 | rootH1_10001445 | 3300003316 | Bacteria | 56583 |
| 9 | rootH2_10073913 | 3300003320 | Bacteria | 5610 |
| 10 | rootL2_10013974 | 3300003322 | Bacteria | 148551 |
| 11 | rootH1_10053710 | 3300003323 | Bacteria | 5934 |
| 12 | Ga0006562J51391_1000459 | 3300003578 | Bacteria | 8870 |
| 13 | Ga0006562J51391_1002637 | 3300003578 | Bacteria | 17100 |
| 14 | Ga0055532_1004456 | 3300003758 | Bacteria | 2109 |
| 15 | Ga0055536_1047068 | 3300003781 | Bacteria | 975 |
| 16 | Ga0055528_1003542 | 3300003790 | Bacteria | 7784 |
| 17 | Ga0070676_10106217 | 3300005328 | Bacteria | 1742 |
| 18 | Ga0070671_100005118 | 3300005355 | Bacteria | 10442 |
| 19 | Ga0070685_10002015 | 3300005466 | Bacteria | 10520 |
| 20 | Ga0070686_100000007 | 3300005544 | Bacteria | 242709 |
| 21 | Ga0068861_100786385 | 3300005719 | Bacteria | 892 |
| 22 | Ga0097621_100965096 | 3300006237 | Unclassified | 796 |
| 23 | Ga0105251_10006716 | 3300009011 | Bacteria | 7264 |
| 24 | Ga0105244_10003118 | 3300009036 | Bacteria | 12082 |
| 25 | Ga0105244_10037926 | 3300009036 | Bacteria | 2516 |
| 26 | Ga0105244_10047361 | 3300009036 | Bacteria | 2206 |
| 27 | Ga0105244_10053839 | 3300009036 | Bacteria | 2043 |
| 28 | Ga0105250_10006435 | 3300009092 | Bacteria | 5129 |
| 29 | Ga0105245_10020600 | 3300009098 | Bacteria | 5783 |
| 30 | Ga0105247_10010339 | 3300009101 | Bacteria | 5643 |
| 31 | Ga0114129_11054612 | 3300009147 | Unclassified | 1020 |
| 32 | Ga0105242_10020990 | 3300009176 | Bacteria | 5123 |
| 33 | Ga0105242_10782950 | 3300009176 | Bacteria | 942 |
| 34 | Ga0105238_10000012 | 3300009551 | Bacteria | 258862 |
| 35 | Ga0105249_10228684 | 3300009553 | Bacteria | 1834 |
| 36 | Ga0105249_10566363 | 3300009553 | Unclassified | 1188 |
| 37 | Ga0105249_10692814 | 3300009553 | Bacteria | 1078 |
| 38 | Ga0105239_10284269 | 3300010375 | Bacteria | 1863 |
| 39 | Ga0105246_10007951 | 3300011119 | Bacteria | 6509 |
| 40 | Ga0157371_10002617 | 3300013102 | Bacteria | 17082 |
| 41 | Ga0157371_10279107 | 3300013102 | Bacteria | 1207 |
| 42 | Ga0157378_10007084 | 3300013297 | Bacteria | 9789 |
| 43 | Ga0157376_10350222 | 3300014969 | Bacteria | 1413 |
| 44 | Ga0213875_10052661 | 3300021388 | Bacteria | 1906 |
| 45 | Ga0209784_100114 | 3300025224 | Bacteria | 89590 |
| 46 | Ga0209147_100262 | 3300025229 | Bacteria | 48219 |
| 47 | Ga0209147_100826 | 3300025229 | Bacteria | 14631 |
| 48 | Ga0209147_102104 | 3300025229 | Bacteria | 5565 |
| 49 | Ga0209673_1005315 | 3300025273 | Bacteria | 6523 |
| 50 | Ga0209130_1001035 | 3300025284 | Bacteria | 21283 |
| 51 | Ga0209130_1001976 | 3300025284 | Bacteria | 11314 |
| 52 | Ga0209675_1017798 | 3300025291 | Bacteria | 2015 |
| 53 | Ga0209676_1001089 | 3300025292 | Bacteria | 30518 |
| 54 | Ga0209676_1015135 | 3300025292 | Bacteria | 2858 |
| 55 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 56 | Ga0209025_1000567 | 3300025294 | Bacteria | 67307 |
| 57 | Ga0209025_1001722 | 3300025294 | Bacteria | 26473 |
| 58 | Ga0209025_1002223 | 3300025294 | Bacteria | 21381 |
| 59 | Ga0209025_1005703 | 3300025294 | Bacteria | 10020 |
| 60 | Ga0209025_1005758 | 3300025294 | Bacteria | 9948 |
| 61 | Ga0209025_1009421 | 3300025294 | Bacteria | 6806 |
| 62 | Ga0209025_1015405 | 3300025294 | Bacteria | 4610 |
| 63 | Ga0209025_1035265 | 3300025294 | Bacteria | 2263 |
| 64 | Ga0209025_1035711 | 3300025294 | Bacteria | 2240 |
| 65 | Ga0209025_1037775 | 3300025294 | Bacteria | 2135 |
| 66 | Ga0207696_1001334 | 3300025711 | Bacteria | 13622 |
| 67 | Ga0207696_1004100 | 3300025711 | Bacteria | 6374 |
| 68 | Ga0207696_1032926 | 3300025711 | Bacteria | 1557 |
| 69 | Ga0207655_1004378 | 3300025728 | Bacteria | 10038 |
| 70 | Ga0207655_1039562 | 3300025728 | Bacteria | 2045 |
| 71 | Ga0207655_1046803 | 3300025728 | Bacteria | 1792 |
| 72 | Ga0207655_1069131 | 3300025728 | Bacteria | 1321 |
| 73 | Ga0207713_1000727 | 3300025735 | Bacteria | 30847 |
| 74 | Ga0207713_1006197 | 3300025735 | Bacteria | 7332 |
| 75 | Ga0207662_10045533 | 3300025918 | Bacteria | 2593 |
| 76 | Ga0207681_10806864 | 3300025923 | Bacteria | 784 |
| 77 | Ga0207694_10000025 | 3300025924 | Bacteria | 258871 |
| 78 | Ga0207687_10056051 | 3300025927 | Bacteria | 2763 |
| 79 | Ga0207644_10539891 | 3300025931 | Bacteria | 964 |
| 80 | Ga0207686_10054573 | 3300025934 | Bacteria | 2503 |
| 81 | Ga0237817_10414 | 3300030083 | Bacteria | 7011 |
| 82 | Ga0237817_10420 | 3300030083 | Bacteria | 6883 |
| 83 | Ga0307408_100294566 | 3300031548 | Bacteria | 1357 |
| 84 | Ga0307408_100388232 | 3300031548 | Bacteria | 1195 |
| 85 | Ga0307408_100521445 | 3300031548 | Bacteria | 1044 |
| 86 | Ga0316575_10010302 | 3300031665 | Unclassified | 3431 |
| 87 | Ga0316575_10014151 | 3300031665 | Unclassified | 2991 |
| 88 | Ga0316575_10015872 | 3300031665 | Bacteria | 2842 |
| 89 | Ga0316575_10055233 | 3300031665 | Bacteria | 1581 |
| 90 | Ga0316575_10092680 | 3300031665 | Bacteria | 1224 |
| 91 | Ga0316575_10127479 | 3300031665 | Bacteria | 1043 |
| 92 | Ga0316575_10226752 | 3300031665 | Unclassified | 780 |
| 93 | Ga0316579_10003268 | 3300031691 | Bacteria | 6291 |
| 94 | Ga0316579_10003919 | 3300031691 | Bacteria | 5864 |
| 95 | Ga0316579_10004762 | 3300031691 | Bacteria | 5419 |
| 96 | Ga0316579_10017080 | 3300031691 | Bacteria | 3179 |
| 97 | Ga0316579_10018466 | 3300031691 | Bacteria | 3071 |
| 98 | Ga0316579_10035098 | 3300031691 | Bacteria | 2310 |
| 99 | Ga0316579_10043990 | 3300031691 | Bacteria | 2079 |
| 100 | Ga0316576_10000114 | 3300031727 | Bacteria | 30289 |
| 101 | Ga0316576_10002477 | 3300031727 | Bacteria | 10508 |
| 102 | Ga0316576_10003543 | 3300031727 | Bacteria | 9176 |
| 103 | Ga0316576_10012572 | 3300031727 | Bacteria | 5598 |
| 104 | Ga0316576_10037790 | 3300031727 | Bacteria | 3458 |
| 105 | Ga0316576_10045941 | 3300031727 | Bacteria | 3159 |
| 106 | Ga0316576_10063818 | 3300031727 | Bacteria | 2704 |
| 107 | Ga0316576_10081402 | 3300031727 | Bacteria | 2402 |
| 108 | Ga0316576_10119593 | 3300031727 | Bacteria | 1977 |
| 109 | Ga0316576_10175177 | 3300031727 | Bacteria | 1618 |
| 110 | Ga0316576_10218403 | 3300031727 | Bacteria | 1434 |
| 111 | Ga0316578_10000215 | 3300031728 | Bacteria | 16628 |
| 112 | Ga0316578_10004691 | 3300031728 | Bacteria | 6496 |
| 113 | Ga0316578_10008205 | 3300031728 | Bacteria | 5296 |
| 114 | Ga0316578_10012124 | 3300031728 | Bacteria | 4538 |
| 115 | Ga0316578_10025776 | 3300031728 | Bacteria | 3309 |
| 116 | Ga0316578_10061759 | 3300031728 | Bacteria | 2208 |
| 117 | Ga0316578_10097434 | 3300031728 | Unclassified | 1761 |
| 118 | Ga0316578_10184422 | 3300031728 | Unclassified | 1257 |
| 119 | Ga0316578_10224288 | 3300031728 | Bacteria | 1129 |
| 120 | Ga0316578_10348001 | 3300031728 | Unclassified | 882 |
| 121 | Ga0307405_10228985 | 3300031731 | Bacteria | 1369 |
| 122 | Ga0316577_10001430 | 3300031733 | Bacteria | 11292 |
| 123 | Ga0316577_10002218 | 3300031733 | Bacteria | 9552 |
| 124 | Ga0316577_10002992 | 3300031733 | Bacteria | 8460 |
| 125 | Ga0316577_10010859 | 3300031733 | Bacteria | 4924 |
| 126 | Ga0316577_10023590 | 3300031733 | Bacteria | 3416 |
| 127 | Ga0316577_10055052 | 3300031733 | Bacteria | 2220 |
| 128 | Ga0316577_10070375 | 3300031733 | Unclassified | 1953 |
| 129 | Ga0316577_10084611 | 3300031733 | Bacteria | 1774 |
| 130 | Ga0316577_10094137 | 3300031733 | Bacteria | 1677 |
| 131 | Ga0316577_10165060 | 3300031733 | Unclassified | 1249 |
| 132 | Ga0316577_10243405 | 3300031733 | Bacteria | 1017 |
| 133 | Ga0316577_10334871 | 3300031733 | Bacteria | 858 |
| 134 | Ga0316577_10353188 | 3300031733 | Unclassified | 834 |
| 135 | Ga0307409_100562320 | 3300031995 | Bacteria | 1121 |
| 136 | Ga0307416_100163500 | 3300032002 | Bacteria | 2061 |
| 137 | Ga0307416_100781133 | 3300032002 | Bacteria | 1050 |
| 138 | Ga0307416_101177490 | 3300032002 | Bacteria | 872 |
| 139 | Ga0307411_10571159 | 3300032005 | Bacteria | 968 |
| 140 | Ga0316583_10006412 | 3300032133 | Bacteria | 4225 |
| 141 | Ga0316583_10009545 | 3300032133 | Bacteria | 3495 |
| 142 | Ga0316583_10027905 | 3300032133 | Bacteria | 2014 |
| 143 | Ga0316583_10126017 | 3300032133 | Bacteria | 892 |
| 144 | Ga0316585_10000966 | 3300032137 | Bacteria | 7384 |
| 145 | Ga0316585_10002319 | 3300032137 | Bacteria | 5121 |
| 146 | Ga0316585_10004213 | 3300032137 | Bacteria | 3996 |
| 147 | Ga0316585_10039978 | 3300032137 | Bacteria | 1492 |
| 148 | Ga0316585_10104388 | 3300032137 | Bacteria | 930 |
| 149 | Ga0316580_10000102 | 3300032139 | Bacteria | 15459 |
| 150 | Ga0316580_10002406 | 3300032139 | Bacteria | 5131 |
| 151 | Ga0316580_10014929 | 3300032139 | Bacteria | 2374 |
| 152 | Ga0316580_10035510 | 3300032139 | Unclassified | 1542 |
| 153 | Ga0316580_10048523 | 3300032139 | Bacteria | 1308 |
| 154 | Ga0316593_10009986 | 3300032168 | Unclassified | 2705 |
| 155 | Ga0316593_10146012 | 3300032168 | Bacteria | 859 |
| 156 | Ga0316592_1008057 | 3300033524 | Bacteria | 2071 |
| 157 | Ga0316592_1015098 | 3300033524 | Bacteria | 1606 |
| 158 | Ga0316588_1009049 | 3300033528 | Bacteria | 2067 |
| 159 | Ga0316588_1013494 | 3300033528 | Bacteria | 1774 |
| 160 | Ga0316596_1008730 | 3300033541 | Bacteria | 2422 |
| 161 | Ga0316596_1022214 | 3300033541 | Bacteria | 1621 |
| 162 | Ga0373930_0054017 | 3300034816 | Bacteria | 883 |
| 163 | Ga0373959_0000008 | 3300034820 | Bacteria | 54263 |
| 164 | Ga0316574_0000336 | 3300035398 | Bacteria | 18126 |
| 165 | Ga0316574_0012914 | 3300035398 | Bacteria | 4790 |
| 166 | Ga0316574_0013243 | 3300035398 | Bacteria | 4736 |
| 167 | Ga0316574_0081509 | 3300035398 | Bacteria | 2055 |
| 168 | Ga0316574_0086114 | 3300035398 | Bacteria | 1999 |
| 169 | Ga0316574_0087898 | 3300035398 | Bacteria | 1979 |
| 170 | Ga0316574_0131959 | 3300035398 | Unclassified | 1607 |
| 171 | Ga0316574_0180157 | 3300035398 | Bacteria | 1359 |
| 172 | Ga0316574_0192491 | 3300035398 | Bacteria | 1311 |
| 173 | Ga0316574_0197749 | 3300035398 | Bacteria | 1292 |
| 174 | Ga0316574_0351119 | 3300035398 | Bacteria | 933 |
| 175 | Ga0316574_0356913 | 3300035398 | Bacteria | 924 |
| 176 | Ga0316582_0000910 | 3300036647 | Bacteria | 12147 |
| 177 | Ga0316582_0002581 | 3300036647 | Bacteria | 8582 |
| 178 | Ga0316582_0005830 | 3300036647 | Bacteria | 6399 |
| 179 | Ga0316582_0009142 | 3300036647 | Bacteria | 5363 |
| 180 | Ga0316582_0013124 | 3300036647 | Unclassified | 4653 |
| 181 | Ga0316582_0016956 | 3300036647 | Bacteria | 4201 |
| 182 | Ga0316582_0037777 | 3300036647 | Bacteria | 2996 |
| 183 | Ga0316582_0105444 | 3300036647 | Bacteria | 1871 |
| 184 | Ga0316582_0136351 | 3300036647 | Bacteria | 1652 |
| 185 | Ga0316582_0153604 | 3300036647 | Bacteria | 1557 |
| 186 | Ga0316582_0158458 | 3300036647 | Unclassified | 1532 |
| 187 | Ga0316582_0159547 | 3300036647 | Unclassified | 1527 |
| 188 | Ga0316582_0170603 | 3300036647 | Bacteria | 1477 |
| 189 | Ga0316582_0219262 | 3300036647 | Bacteria | 1300 |
| 190 | Ga0316582_0302220 | 3300036647 | Bacteria | 1100 |
| 191 | Ga0316582_0336798 | 3300036647 | Bacteria | 1037 |
| 192 | Ga0316582_0357019 | 3300036647 | Bacteria | 1006 |
| 193 | Ga0316582_0582666 | 3300036647 | Bacteria | 770 |
| 194 | Ga0316584_0000038 | 3300036712 | Bacteria | 47595 |
| 195 | Ga0316584_0001221 | 3300036712 | Bacteria | 15179 |
| 196 | Ga0316584_0001629 | 3300036712 | Bacteria | 13699 |
| 197 | Ga0316584_0005543 | 3300036712 | Bacteria | 8486 |
| 198 | Ga0316584_0017629 | 3300036712 | Bacteria | 5140 |
| 199 | Ga0316584_0017705 | 3300036712 | Bacteria | 5130 |
| 200 | Ga0316584_0018044 | 3300036712 | Bacteria | 5086 |
| 201 | Ga0316584_0021026 | 3300036712 | Bacteria | 4738 |
| 202 | Ga0316584_0027600 | 3300036712 | Bacteria | 4179 |
| 203 | Ga0316584_0030107 | 3300036712 | Bacteria | 4009 |
| 204 | Ga0316584_0031443 | 3300036712 | Bacteria | 3925 |
| 205 | Ga0316584_0061941 | 3300036712 | Bacteria | 2802 |
| 206 | Ga0316584_0095724 | 3300036712 | Bacteria | 2222 |
| 207 | Ga0316584_0103738 | 3300036712 | Bacteria | 2128 |
| 208 | Ga0316584_0151745 | 3300036712 | Bacteria | 1724 |
| 209 | Ga0316584_0184403 | 3300036712 | Unclassified | 1544 |
| 210 | Ga0316584_0470671 | 3300036712 | Bacteria | 886 |
| 211 | Ga0395899_0008231 | 3300037312 | Bacteria | 8032 |
| 212 | Ga0395900_0045877 | 3300037418 | Bacteria | 4501 |
| 213 | Ga0395898_0082886 | 3300037466 | Bacteria | 3091 |
| 214 | Ga0395898_0765103 | 3300037466 | Bacteria | 907 |
| 215 | Ga0395905_0016608 | 3300037471 | Bacteria | 6996 |
| 216 | Ga0395905_0499826 | 3300037471 | Bacteria | 1116 |
| 217 | Ga0316581_0000297 | 3300037588 | Bacteria | 8840 |
| 218 | Ga0316581_0003213 | 3300037588 | Bacteria | 4042 |
| 219 | Ga0316581_0003649 | 3300037588 | Bacteria | 3852 |
| 220 | Ga0316581_0007243 | 3300037588 | Bacteria | 2969 |
| 221 | Ga0316581_0025747 | 3300037588 | Bacteria | 1751 |
| 222 | Ga0436364_1407754 | 3300037853 | Bacteria | 5885 |
| 223 | Ga0395901_0009137 | 3300038443 | Bacteria | 10038 |
| 224 | Ga0237819_00360 | 3300038705 | Bacteria | 16209 |
| 225 | Ga0237819_00456 | 3300038705 | Bacteria | 13928 |
| 226 | Ga0400484_23468 | 3300038725 | Bacteria | 4319 |
| 227 | Ga0400490_26529 | 3300038726 | Bacteria | 1207 |
| 228 | Ga0400490_43196 | 3300038726 | Bacteria | 7780 |
| 229 | Ga0400488_28825 | 3300038741 | Bacteria | 28328 |
| 230 | Ga0400483_137959 | 3300039062 | Bacteria | 1125 |
| 231 | Ga0400489_50184 | 3300039093 | Bacteria | 7751 |
| 232 | Ga0400487_65955 | 3300039110 | Bacteria | 3893 |
| 233 | Ga0453684_0000627 | 3300044712 | Bacteria | 128570 |
| 234 | Ga0453684_0090471 | 3300044712 | Bacteria | 3781 |
| 235 | Ga0453684_0442695 | 3300044712 | Bacteria | 1448 |
| 236 | Ga0466967_0000077 | 3300045976 | Bacteria | 35774 |
| 237 | Ga0495627_047962 | 3300046453 | Bacteria | 1294 |
| 238 | Ga0495585_0006277 | 3300046492 | Bacteria | 7394 |
| 239 | Ga0495654_0115861 | 3300046530 | Bacteria | 1218 |
| 240 | Ga0495622_0014726 | 3300046557 | Bacteria | 3632 |
| 241 | Ga0495661_0051867 | 3300046665 | Bacteria | 2475 |
| 242 | Ga0495661_0163445 | 3300046665 | Bacteria | 1193 |
| 243 | Ga0495683_0018562 | 3300047323 | Bacteria | 3594 |
| 244 | Ga0495626_0070390 | 3300048091 | Bacteria | 1574 |
| 245 | Ga0496100_0000584 | 3300048903 | Bacteria | 17217 |
| 246 | Ga0496100_0222872 | 3300048903 | Bacteria | 1385 |
| 247 | Ga0496100_0714254 | 3300048903 | Bacteria | 783 |
| 248 | Ga0496101_0330389 | 3300048904 | Bacteria | 1197 |
| 249 | Ga0496101_0424103 | 3300048904 | Bacteria | 1048 |
| 250 | Ga0496102_0004867 | 3300048905 | Bacteria | 11360 |
| 251 | Ga0496103_0007473 | 3300048906 | Bacteria | 6513 |
| 252 | Ga0496104_0163981 | 3300048907 | Bacteria | 2131 |
| 253 | Ga0496105_0000266 | 3300048908 | Bacteria | 34749 |
| 254 | Ga0496106_0000224 | 3300048909 | Bacteria | 39551 |
| 255 | Ga0496107_0011410 | 3300048910 | Bacteria | 6188 |
| 256 | Ga0496108_0002369 | 3300048911 | Bacteria | 15094 |
| 257 | Ga0496109_0003788 | 3300048912 | Bacteria | 12621 |
| 258 | Ga0496109_0199681 | 3300048912 | Bacteria | 1880 |
| 259 | Ga0496110_0000612 | 3300048913 | Bacteria | 24597 |
| 260 | Ga0496110_0162206 | 3300048913 | Bacteria | 2026 |
| 261 | Ga0496110_0202314 | 3300048913 | Bacteria | 1805 |
| 262 | Ga0496111_0026805 | 3300048914 | Bacteria | 4071 |
| 263 | Ga0496112_0002638 | 3300048915 | Bacteria | 14492 |
| 264 | Ga0496112_0054572 | 3300048915 | Bacteria | 3926 |
| 265 | Ga0496113_0114189 | 3300048916 | Bacteria | 2105 |
| 266 | Ga0496113_0208829 | 3300048916 | Bacteria | 1554 |
| 267 | Ga0496116_0055661 | 3300048919 | Bacteria | 2597 |
| 268 | Ga0496118_0087869 | 3300048921 | Bacteria | 2153 |
| 269 | Ga0496119_0003336 | 3300048922 | Bacteria | 16723 |
| 270 | Ga0496120_0048780 | 3300048923 | Bacteria | 2435 |
| 271 | Ga0496122_0078367 | 3300048925 | Bacteria | 2314 |
| 272 | Ga0496123_0049803 | 3300048926 | Bacteria | 2805 |
| 273 | Ga0496125_0006100 | 3300048928 | Bacteria | 13156 |
| 274 | Ga0496126_0036280 | 3300048929 | Bacteria | 4610 |
| 275 | Ga0496126_0513663 | 3300048929 | Bacteria | 956 |
| 276 | Ga0501305_005936 | 3300049161 | Bacteria | 1501 |
| 277 | Ga0501311_019608 | 3300049527 | Bacteria | 908 |
| 278 | Ga0501312_008313 | 3300049528 | Bacteria | 1346 |
| 279 | Ga0501312_013381 | 3300049528 | Bacteria | 1140 |
| 280 | Ga0501312_017751 | 3300049528 | Bacteria | 1030 |
| 281 | Ga0501312_045713 | 3300049528 | Bacteria | 726 |
| 282 | Ga0501315_017801 | 3300049531 | Bacteria | 932 |
| 283 | Ga0501073_0138652 | 3300049589 | Bacteria | 1685 |
| 284 | Ga0501073_0435676 | 3300049589 | Bacteria | 906 |
| 285 | Ga0501076_0821892 | 3300049592 | Bacteria | 767 |
| 286 | Ga0501266_023613 | 3300049763 | Bacteria | 850 |
| 287 | Ga0500628_033845 | 3300053129 | Bacteria | 1126 |
| 288 | Ga0590077_019253 | 3300059426 | Bacteria | 1445 |
| 289 | 2860840603 | 2860837431 | Bacteria | 4202080 |
| 290 | 2511700602 | 2511231119 | Bacteria | 4019861 |
| 291 | 2540607827 | 2540341094 | Bacteria | 4061186 |
| 292 | 2545557304 | 2545555800 | Bacteria | 4222588 |
| 293 | 2555469877 | 2554235283 | Bacteria | 3683090 |
| 294 | 2556062986 | 2554235469 | Bacteria | 3590176 |
| 295 | 2578931567 | 2576861599 | Bacteria | 4217202 |
| 296 | 2631984496 | 2630968484 | Bacteria | 3876276 |
| 297 | 2644706408 | 2643221729 | Bacteria | 6621700 |
| 298 | 2644713089 | 2643221730 | Bacteria | 6523787 |
| 299 | 2644715530 | 2643221731 | Bacteria | 5623886 |
| 300 | 2644726834 | 2643221732 | Bacteria | 5756404 |
| 301 | 2644741469 | 2643221735 | Bacteria | 3676263 |
| 302 | 2651532676 | 2648501850 | Bacteria | 3975476 |
| 303 | 2672337358 | 2671180330 | Bacteria | 5521719 |
| 304 | 2674418570 | 2671180844 | Bacteria | 4164150 |
| 305 | 2685152580 | 2684622632 | Bacteria | 5380049 |
| 306 | 2686997889 | 2684623153 | Bacteria | 3878815 |
| 307 | 2687499230 | 2687453109 | Bacteria | 3860091 |
| 308 | 2695628597 | 2695420354 | Bacteria | 3922431 |
| 309 | 2698320590 | 2695420987 | Bacteria | 6152737 |
| 310 | 2705996503 | 2703719227 | Bacteria | 5631989 |
| 311 | 2712198196 | 2711768088 | Bacteria | 3195027 |
| 312 | 2717915709 | 2716884898 | Bacteria | 3928789 |
| 313 | 2721507738 | 2718218445 | Bacteria | 5113413 |
| 314 | 2738815501 | 2738541295 | Bacteria | 5730091 |
| 315 | 2738838312 | 2738541299 | Bacteria | 4020721 |
| 316 | 2739157631 | 2738541358 | Bacteria | 5932299 |
| 317 | 2739209723 | 2738543006 | Bacteria | 5904091 |
| 318 | 2739229877 | 2738543010 | Bacteria | 5583595 |
| 319 | 2791214815 | 2788500588 | Bacteria | 4584915 |
| 320 | 2808869740 | 2808606364 | Bacteria | 4465927 |
| 321 | 2809056192 | 2808606399 | Bacteria | 4021018 |
| 322 | 2812317084 | 2811994870 | Bacteria | 3776934 |
| 323 | 2816862220 | 2816332186 | Bacteria | 5331395 |
| 324 | 2817481193 | 2816332295 | Bacteria | 4352468 |
| 325 | 2819581495 | 2818991443 | Bacteria | 6598732 |
| 326 | 2819627816 | 2818991451 | Bacteria | 4697364 |
| 327 | 2819708998 | 2818991465 | Bacteria | 5388835 |
| 328 | 2819724164 | 2818991468 | Bacteria | 3723169 |
| 329 | 2823529042 | 2823526263 | Bacteria | 3765752 |
| 330 | 2842684866 | 2842682962 | Bacteria | 5589973 |
| 331 | 2842884763 | 2842882022 | Bacteria | 6158489 |
| 332 | 2849141422 | 2849139964 | Bacteria | 5613304 |
| 333 | 2857584155 | 2857581216 | Bacteria | 5522813 |
| 334 | 2857610539 | 2857609550 | Bacteria | 3753890 |
| 335 | 2877771510 | 2877768649 | Bacteria | 3957164 |
| 336 | 2880172364 | 2880169592 | Bacteria | 3900066 |
| 337 | 2897112638 | 2897109615 | Bacteria | 4009619 |
| 338 | 2904524207 | 2904524088 | Bacteria | 5887454 |
| 339 | 2904564407 | 2904560550 | Bacteria | 4029838 |
| 340 | 2904609601 | 2904606771 | Bacteria | 4684500 |
| 341 | 2908667743 | 2908665501 | Bacteria | 3678115 |
| 342 | 2919095538 | 2919093281 | Bacteria | 3660974 |
| 343 | 2919147216 | 2919143609 | Bacteria | 6219228 |
| 344 | 2919417624 | 2919414237 | Bacteria | 5429133 |
| 345 | 2919519120 | 2919517244 | Bacteria | 5858162 |
| 346 | 2919723488 | 2919720352 | Bacteria | 5986006 |
| 347 | 2919728754 | 2919726948 | Bacteria | 3696050 |
| 348 | 2928095985 | 2928093941 | Bacteria | 5965005 |
| 349 | 2929006643 | 2929004312 | Bacteria | 5678476 |
| 350 | 2929238285 | 2929233124 | Bacteria | 5948380 |
| 351 | 2938922477 | 2938917290 | Bacteria | 5914775 |
| 352 | 2939595332 | 2939593269 | Bacteria | 4798695 |
| 353 | 2947431370 | 2947426588 | Bacteria | 5357194 |
| 354 | 2954773409 | 2954773129 | Bacteria | 3741715 |
| 355 | 2956897707 | 2956897341 | Bacteria | 5447711 |
| 356 | 2960319604 | 2960319331 | Bacteria | 5502575 |
| 357 | 2960381185 | 2960375949 | Bacteria | 5361395 |
| 358 | 2962293814 | 2962290636 | Bacteria | 4072939 |
| 359 | 2964379351 | 2964375228 | Bacteria | 4909004 |
| 360 | 2965765885 | 2965761152 | Bacteria | 5806513 |
| 361 | 2969139808 | 2969136845 | Bacteria | 3923176 |
| 362 | 2969143958 | 2969141011 | Bacteria | 4118468 |
| 363 | 2969769724 | 2969765954 | Bacteria | 4216713 |
| 364 | 2969772787 | 2969770375 | Bacteria | 4271280 |
| 365 | 2971416730 | 2971410472 | Bacteria | 8311090 |
| 366 | 2979088271 | 2979083700 | Bacteria | 5894929 |
| 367 | 2980495597 | 2980492589 | Bacteria | 4072961 |
| 368 | 3001268716 | 3001267043 | Bacteria | 4823521 |
| 369 | 3001274177 | 3001272096 | Bacteria | 4729684 |
| 370 | 3001897494 | 3001892409 | Bacteria | 6328293 |
| 371 | 3006827214 | 3006826541 | Bacteria | 4678913 |
| 372 | 3006861608 | 3006858327 | Bacteria | 4317835 |
| 373 | 3006882233 | 3006879489 | Bacteria | 4064221 |
| 374 | 3006971889 | 3006969106 | Bacteria | 4739423 |
| 375 | 3006976218 | 3006973921 | Bacteria | 4423788 |
| 376 | 3006982156 | 3006978542 | Bacteria | 5328100 |
| 377 | 3006988650 | 3006988479 | Bacteria | 4767936 |
| 378 | 8022624534 | 8022621104 | Bacteria | 5241040 |
| 379 | 8022632236 | 8022630665 | Bacteria | 3886130 |
| 380 | 8022654761 | 8022653035 | Bacteria | 4035078 |
| 381 | 8022797997 | 8022792930 | Bacteria | 5693794 |
| 382 | 8022898466 | 8022893055 | Bacteria | 5300455 |
| 383 | 8022917617 | 8022914991 | Bacteria | 5584517 |
| 384 | 8023443697 | 8023438354 | Bacteria | 5779374 |
| 385 | 8023445480 | 8023444577 | Bacteria | 5661597 |
| 386 | 8051954861 | 8051952484 | Bacteria | 3926774 |
| 387 | 8052176422 | 8052174270 | Bacteria | 3881265 |
| 388 | 8056537010 | 8056533031 | Bacteria | 8964429 |
| 389 | 8057587034 | 8057582654 | Bacteria | 5218944 |
| 390 | 8057635743 | 8057632132 | Bacteria | 4726859 |
| 391 | JGI25159J45721_1007735 | |||
| 392 | JGI25159J45721_1011574 | |||
| 393 | JGI25151J46595_10000046 | |||
| 394 | JGI25151J46595_10005640 | |||
| 395 | JGI25151J46595_10013727 | |||
| 396 | JGI25151J46595_10057324 | |||
| 397 | JGI25151J46595_10072223 | |||
| 398 | rootH1_10001445 | |||
| 399 | rootH2_10073913 | |||
| 400 | rootL2_10013974 | |||
| 401 | rootH1_10053710 | |||
| 402 | Ga0006562J51391_1000459 | |||
| 403 | Ga0006562J51391_1002637 | |||
| 404 | Ga0055532_1004456 | |||
| 405 | Ga0055536_1047068 | |||
| 406 | Ga0055528_1003542 | |||
| 407 | Ga0070676_10106217 | |||
| 408 | Ga0070671_100005118 | |||
| 409 | Ga0070685_10002015 | |||
| 410 | Ga0070686_100000007 | |||
| 411 | Ga0068861_100786385 | |||
| 412 | Ga0097621_100965096 | |||
| 413 | Ga0105251_10006716 | |||
| 414 | Ga0105244_10003118 | |||
| 415 | Ga0105244_10037926 | |||
| 416 | Ga0105244_10047361 | |||
| 417 | Ga0105244_10053839 | |||
| 418 | Ga0105250_10006435 | |||
| 419 | Ga0105245_10020600 | |||
| 420 | Ga0105247_10010339 | |||
| 421 | Ga0114129_11054612 | |||
| 422 | Ga0105242_10020990 | |||
| 423 | Ga0105242_10782950 | |||
| 424 | Ga0105238_10000012 | |||
| 425 | Ga0105249_10228684 | |||
| 426 | Ga0105249_10566363 | |||
| 427 | Ga0105249_10692814 | |||
| 428 | Ga0105239_10284269 | |||
| 429 | Ga0105246_10007951 | |||
| 430 | Ga0157371_10002617 | |||
| 431 | Ga0157371_10279107 | |||
| 432 | Ga0157378_10007084 | |||
| 433 | Ga0157376_10350222 | |||
| 434 | Ga0213875_10052661 | |||
| 435 | Ga0209784_100114 | |||
| 436 | Ga0209147_100262 | |||
| 437 | Ga0209147_100826 | |||
| 438 | Ga0209147_102104 | |||
| 439 | Ga0209673_1005315 | |||
| 440 | Ga0209130_1001035 | |||
| 441 | Ga0209130_1001976 | |||
| 442 | Ga0209675_1017798 | |||
| 443 | Ga0209676_1001089 | |||
| 444 | Ga0209676_1015135 | |||
| 445 | Ga0209025_1000001 | |||
| 446 | Ga0209025_1000567 | |||
| 447 | Ga0209025_1001722 | |||
| 448 | Ga0209025_1002223 | |||
| 449 | Ga0209025_1005703 | |||
| 450 | Ga0209025_1005758 | |||
| 451 | Ga0209025_1009421 | |||
| 452 | Ga0209025_1015405 | |||
| 453 | Ga0209025_1035265 | |||
| 454 | Ga0209025_1035711 | |||
| 455 | Ga0209025_1037775 | |||
| 456 | Ga0207696_1001334 | |||
| 457 | Ga0207696_1004100 | |||
| 458 | Ga0207696_1032926 | |||
| 459 | Ga0207655_1004378 | |||
| 460 | Ga0207655_1039562 | |||
| 461 | Ga0207655_1046803 | |||
| 462 | Ga0207655_1069131 | |||
| 463 | Ga0207713_1000727 | |||
| 464 | Ga0207713_1006197 | |||
| 465 | Ga0207662_10045533 | |||
| 466 | Ga0207681_10806864 | |||
| 467 | Ga0207694_10000025 | |||
| 468 | Ga0207687_10056051 | |||
| 469 | Ga0207644_10539891 | |||
| 470 | Ga0207686_10054573 | |||
| 471 | Ga0237817_10414 | |||
| 472 | Ga0237817_10420 | |||
| 473 | Ga0307408_100294566 | |||
| 474 | Ga0307408_100388232 | |||
| 475 | Ga0307408_100521445 | |||
| 476 | Ga0316575_10010302 | |||
| 477 | Ga0316575_10014151 | |||
| 478 | Ga0316575_10015872 | |||
| 479 | Ga0316575_10055233 | |||
| 480 | Ga0316575_10092680 | |||
| 481 | Ga0316575_10127479 | |||
| 482 | Ga0316575_10226752 | |||
| 483 | Ga0316579_10003268 | |||
| 484 | Ga0316579_10003919 | |||
| 485 | Ga0316579_10004762 | |||
| 486 | Ga0316579_10017080 | |||
| 487 | Ga0316579_10018466 | |||
| 488 | Ga0316579_10035098 | |||
| 489 | Ga0316579_10043990 | |||
| 490 | Ga0316576_10000114 | |||
| 491 | Ga0316576_10002477 | |||
| 492 | Ga0316576_10003543 | |||
| 493 | Ga0316576_10012572 | |||
| 494 | Ga0316576_10037790 | |||
| 495 | Ga0316576_10045941 | |||
| 496 | Ga0316576_10063818 | |||
| 497 | Ga0316576_10081402 | |||
| 498 | Ga0316576_10119593 | |||
| 499 | Ga0316576_10175177 | |||
| 500 | Ga0316576_10218403 | |||
| 501 | Ga0316578_10000215 | |||
| 502 | Ga0316578_10004691 | |||
| 503 | Ga0316578_10008205 | |||
| 504 | Ga0316578_10012124 | |||
| 505 | Ga0316578_10025776 | |||
| 506 | Ga0316578_10061759 | |||
| 507 | Ga0316578_10097434 | |||
| 508 | Ga0316578_10184422 | |||
| 509 | Ga0316578_10224288 | |||
| 510 | Ga0316578_10348001 | |||
| 511 | Ga0307405_10228985 | |||
| 512 | Ga0316577_10001430 | |||
| 513 | Ga0316577_10002218 | |||
| 514 | Ga0316577_10002992 | |||
| 515 | Ga0316577_10010859 | |||
| 516 | Ga0316577_10023590 | |||
| 517 | Ga0316577_10055052 | |||
| 518 | Ga0316577_10070375 | |||
| 519 | Ga0316577_10084611 | |||
| 520 | Ga0316577_10094137 | |||
| 521 | Ga0316577_10165060 | |||
| 522 | Ga0316577_10243405 | |||
| 523 | Ga0316577_10334871 | |||
| 524 | Ga0316577_10353188 | |||
| 525 | Ga0307409_100562320 | |||
| 526 | Ga0307416_100163500 | |||
| 527 | Ga0307416_100781133 | |||
| 528 | Ga0307416_101177490 | |||
| 529 | Ga0307411_10571159 | |||
| 530 | Ga0316583_10006412 | |||
| 531 | Ga0316583_10009545 | |||
| 532 | Ga0316583_10027905 | |||
| 533 | Ga0316583_10126017 | |||
| 534 | Ga0316585_10000966 | |||
| 535 | Ga0316585_10002319 | |||
| 536 | Ga0316585_10004213 | |||
| 537 | Ga0316585_10039978 | |||
| 538 | Ga0316585_10104388 | |||
| 539 | Ga0316580_10000102 | |||
| 540 | Ga0316580_10002406 | |||
| 541 | Ga0316580_10014929 | |||
| 542 | Ga0316580_10035510 | |||
| 543 | Ga0316580_10048523 | |||
| 544 | Ga0316593_10009986 | |||
| 545 | Ga0316593_10146012 | |||
| 546 | Ga0316592_1008057 | |||
| 547 | Ga0316592_1015098 | |||
| 548 | Ga0316588_1009049 | |||
| 549 | Ga0316588_1013494 | |||
| 550 | Ga0316596_1008730 | |||
| 551 | Ga0316596_1022214 | |||
| 552 | Ga0373930_0054017 | |||
| 553 | Ga0373959_0000008 | |||
| 554 | Ga0316574_0000336 | |||
| 555 | Ga0316574_0012914 | |||
| 556 | Ga0316574_0013243 | |||
| 557 | Ga0316574_0081509 | |||
| 558 | Ga0316574_0086114 | |||
| 559 | Ga0316574_0087898 | |||
| 560 | Ga0316574_0131959 | |||
| 561 | Ga0316574_0180157 | |||
| 562 | Ga0316574_0192491 | |||
| 563 | Ga0316574_0197749 | |||
| 564 | Ga0316574_0351119 | |||
| 565 | Ga0316574_0356913 | |||
| 566 | Ga0316582_0000910 | |||
| 567 | Ga0316582_0002581 | |||
| 568 | Ga0316582_0005830 | |||
| 569 | Ga0316582_0009142 | |||
| 570 | Ga0316582_0013124 | |||
| 571 | Ga0316582_0016956 | |||
| 572 | Ga0316582_0037777 | |||
| 573 | Ga0316582_0105444 | |||
| 574 | Ga0316582_0136351 | |||
| 575 | Ga0316582_0153604 | |||
| 576 | Ga0316582_0158458 | |||
| 577 | Ga0316582_0159547 | |||
| 578 | Ga0316582_0170603 | |||
| 579 | Ga0316582_0219262 | |||
| 580 | Ga0316582_0302220 | |||
| 581 | Ga0316582_0336798 | |||
| 582 | Ga0316582_0357019 | |||
| 583 | Ga0316582_0582666 | |||
| 584 | Ga0316584_0000038 | |||
| 585 | Ga0316584_0001221 | |||
| 586 | Ga0316584_0001629 | |||
| 587 | Ga0316584_0005543 | |||
| 588 | Ga0316584_0017629 | |||
| 589 | Ga0316584_0017705 | |||
| 590 | Ga0316584_0018044 | |||
| 591 | Ga0316584_0021026 | |||
| 592 | Ga0316584_0027600 | |||
| 593 | Ga0316584_0030107 | |||
| 594 | Ga0316584_0031443 | |||
| 595 | Ga0316584_0061941 | |||
| 596 | Ga0316584_0095724 | |||
| 597 | Ga0316584_0103738 | |||
| 598 | Ga0316584_0151745 | |||
| 599 | Ga0316584_0184403 | |||
| 600 | Ga0316584_0470671 | |||
| 601 | Ga0395899_0008231 | |||
| 602 | Ga0395900_0045877 | |||
| 603 | Ga0395898_0082886 | |||
| 604 | Ga0395898_0765103 | |||
| 605 | Ga0395905_0016608 | |||
| 606 | Ga0395905_0499826 | |||
| 607 | Ga0316581_0000297 | |||
| 608 | Ga0316581_0003213 | |||
| 609 | Ga0316581_0003649 | |||
| 610 | Ga0316581_0007243 | |||
| 611 | Ga0316581_0025747 | |||
| 612 | Ga0436364_1407754 | |||
| 613 | Ga0395901_0009137 | |||
| 614 | Ga0237819_00360 | |||
| 615 | Ga0237819_00456 | |||
| 616 | Ga0400484_23468 | |||
| 617 | Ga0400490_26529 | |||
| 618 | Ga0400490_43196 | |||
| 619 | Ga0400488_28825 | |||
| 620 | Ga0400483_137959 | |||
| 621 | Ga0400489_50184 | |||
| 622 | Ga0400487_65955 | |||
| 623 | Ga0453684_0000627 | |||
| 624 | Ga0453684_0090471 | |||
| 625 | Ga0453684_0442695 | |||
| 626 | Ga0466967_0000077 | |||
| 627 | Ga0495627_047962 | |||
| 628 | Ga0495585_0006277 | |||
| 629 | Ga0495654_0115861 | |||
| 630 | Ga0495622_0014726 | |||
| 631 | Ga0495661_0051867 | |||
| 632 | Ga0495661_0163445 | |||
| 633 | Ga0495683_0018562 | |||
| 634 | Ga0495626_0070390 | |||
| 635 | Ga0496100_0000584 | |||
| 636 | Ga0496100_0222872 | |||
| 637 | Ga0496100_0714254 | |||
| 638 | Ga0496101_0330389 | |||
| 639 | Ga0496101_0424103 | |||
| 640 | Ga0496102_0004867 | |||
| 641 | Ga0496103_0007473 | |||
| 642 | Ga0496104_0163981 | |||
| 643 | Ga0496105_0000266 | |||
| 644 | Ga0496106_0000224 | |||
| 645 | Ga0496107_0011410 | |||
| 646 | Ga0496108_0002369 | |||
| 647 | Ga0496109_0003788 | |||
| 648 | Ga0496109_0199681 | |||
| 649 | Ga0496110_0000612 | |||
| 650 | Ga0496110_0162206 | |||
| 651 | Ga0496110_0202314 | |||
| 652 | Ga0496111_0026805 | |||
| 653 | Ga0496112_0002638 | |||
| 654 | Ga0496112_0054572 | |||
| 655 | Ga0496113_0114189 | |||
| 656 | Ga0496113_0208829 | |||
| 657 | Ga0496116_0055661 | |||
| 658 | Ga0496118_0087869 | |||
| 659 | Ga0496119_0003336 | |||
| 660 | Ga0496120_0048780 | |||
| 661 | Ga0496122_0078367 | |||
| 662 | Ga0496123_0049803 | |||
| 663 | Ga0496125_0006100 | |||
| 664 | Ga0496126_0036280 | |||
| 665 | Ga0496126_0513663 | |||
| 666 | Ga0501305_005936 | |||
| 667 | Ga0501311_019608 | |||
| 668 | Ga0501312_008313 | |||
| 669 | Ga0501312_013381 | |||
| 670 | Ga0501312_017751 | |||
| 671 | Ga0501312_045713 | |||
| 672 | Ga0501315_017801 | |||
| 673 | Ga0501073_0138652 | |||
| 674 | Ga0501073_0435676 | |||
| 675 | Ga0501076_0821892 | |||
| 676 | Ga0501266_023613 | |||
| 677 | Ga0500628_033845 | |||
| 678 | Ga0590077_019253 | |||
| 679 | 2860840603 | |||
| 680 | 2511700602 | |||
| 681 | 2540607827 | |||
| 682 | 2545557304 | |||
| 683 | 2555469877 | |||
| 684 | 2556062986 | |||
| 685 | 2578931567 | |||
| 686 | 2631984496 | |||
| 687 | 2644706408 | |||
| 688 | 2644713089 | |||
| 689 | 2644715530 | |||
| 690 | 2644726834 | |||
| 691 | 2644741469 | |||
| 692 | 2651532676 | |||
| 693 | 2672337358 | |||
| 694 | 2674418570 | |||
| 695 | 2685152580 | |||
| 696 | 2686997889 | |||
| 697 | 2687499230 | |||
| 698 | 2695628597 | |||
| 699 | 2698320590 | |||
| 700 | 2705996503 | |||
| 701 | 2712198196 | |||
| 702 | 2717915709 | |||
| 703 | 2721507738 | |||
| 704 | 2738815501 | |||
| 705 | 2738838312 | |||
| 706 | 2739157631 | |||
| 707 | 2739209723 | |||
| 708 | 2739229877 | |||
| 709 | 2791214815 | |||
| 710 | 2808869740 | |||
| 711 | 2809056192 | |||
| 712 | 2812317084 | |||
| 713 | 2816862220 | |||
| 714 | 2817481193 | |||
| 715 | 2819581495 | |||
| 716 | 2819627816 | |||
| 717 | 2819708998 | |||
| 718 | 2819724164 | |||
| 719 | 2823529042 | |||
| 720 | 2842684866 | |||
| 721 | 2842884763 | |||
| 722 | 2849141422 | |||
| 723 | 2857584155 | |||
| 724 | 2857610539 | |||
| 725 | 2877771510 | |||
| 726 | 2880172364 | |||
| 727 | 2897112638 | |||
| 728 | 2904524207 | |||
| 729 | 2904564407 | |||
| 730 | 2904609601 | |||
| 731 | 2908667743 | |||
| 732 | 2919095538 | |||
| 733 | 2919147216 | |||
| 734 | 2919417624 | |||
| 735 | 2919519120 | |||
| 736 | 2919723488 | |||
| 737 | 2919728754 | |||
| 738 | 2928095985 | |||
| 739 | 2929006643 | |||
| 740 | 2929238285 | |||
| 741 | 2938922477 | |||
| 742 | 2939595332 | |||
| 743 | 2947431370 | |||
| 744 | 2954773409 | |||
| 745 | 2956897707 | |||
| 746 | 2960319604 | |||
| 747 | 2960381185 | |||
| 748 | 2962293814 | |||
| 749 | 2964379351 | |||
| 750 | 2965765885 | |||
| 751 | 2969139808 | |||
| 752 | 2969143958 | |||
| 753 | 2969769724 | |||
| 754 | 2969772787 | |||
| 755 | 2971416730 | |||
| 756 | 2979088271 | |||
| 757 | 2980495597 | |||
| 758 | 3001268716 | |||
| 759 | 3001274177 | |||
| 760 | 3001897494 | |||
| 761 | 3006827214 | |||
| 762 | 3006861608 | |||
| 763 | 3006882233 | |||
| 764 | 3006971889 | |||
| 765 | 3006976218 | |||
| 766 | 3006982156 | |||
| 767 | 3006988650 | |||
| 768 | 8022624534 | |||
| 769 | 8022632236 | |||
| 770 | 8022654761 | |||
| 771 | 8022797997 | |||
| 772 | 8022898466 | |||
| 773 | 8022917617 | |||
| 774 | 8023443697 | |||
| 775 | 8023445480 | |||
| 776 | 8051954861 | |||
| 777 | 8052176422 | |||
| 778 | 8056537010 | |||
| 779 | 8057587034 | |||
| 780 | 8057635743 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e3w-assembly1.cif.gz_C | metallo beta-lactamase fold protein (camp bound) | 0.9714 | 1 | 227 |
| 7e3w-assembly1.cif.gz_C | metallo beta-lactamase fold protein (camp bound) | 0.9672 | 1 | 227 |
| 3x30-assembly1.cif.gz_A | crystal structure of metallo-beta-lactamase from thermotoga maritima | 0.9668 | 1 | 227 |
| 3x2x-assembly1.cif.gz_C | crystal structure of metallo-beta-lactamase h48a from thermotoga maritima | 0.9631 | 1 | 227 |
| 3x2y-assembly1.cif.gz_C | crystal structure of metallo-beta-lactamase h8a from thermotoga maritima | 0.9489 | 2 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM0_1_229_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9758 | 1 | 227 | 3.60.15.10 |
| af_Q2FXM0_1_229_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9716 | 1 | 227 | 3.60.15.10 |
| 3x30A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9617 | 1 | 227 | 3.60.15.10 |
| 3x30A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9574 | 1 | 227 | 3.60.15.10 |
| af_Q58563_1_217_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.932 | 3 | 227 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V2KWV2-F1-model_v4 | deleted | 1.006 | 1 | 85 |
|
| AF-A0A4Q2HNX0-F1-model_v4 | deleted | 1.003 | 1 | 111 |
|
| AF-A0A855WSV6-F1-model_v4 | deleted | 1 | 1 | 147 |
|
| AF-A0A2V2KWV2-F1-model_v4 | deleted | 0.9941 | 1 | 85 |
|
| AF-A0A4Q2HNX0-F1-model_v4 | deleted | 0.9936 | 1 | 111 |
|