F431858

General Info

Members Datasets Scaffolds Average Seq Length
390 242 780 140

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_1161579|Ga0501081_1161579_84_572
Length 162
Sequence LHEPGPRAPYRARSELEENRTVSETQTTLAIIKPDAVAAGRAGAILAHLEREGFALRGVKLLRLSTEQAKAFYAVHAGRPFYGSLVEFMTSGPVVPVALERADAVAHLRRVMGATDVAKAEPGTIRALYGSSIERNAIHGSDSPENAALELAFFFSRAELLV

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_1161579 3300049743 Bacteria 585
2 JGI26145J50221_1006532 3300003371 Bacteria 978
3 Ga0065715_10481556 3300005293 Bacteria 797
4 Ga0065707_10364572 3300005295 Unclassified 899
5 Ga0070658_10023814 3300005327 Bacteria 4910
6 Ga0070658_10321152 3300005327 Bacteria 1322
7 Ga0070690_100000135 3300005330 Bacteria 38479
8 Ga0070690_100109526 3300005330 Bacteria 1841
9 Ga0070690_100346777 3300005330 Unclassified 1077
10 Ga0070670_100232758 3300005331 Bacteria 1603
11 Ga0070677_10028378 3300005333 Bacteria 2114
12 Ga0070677_10037503 3300005333 Bacteria 1891
13 Ga0068869_100015786 3300005334 Bacteria 5075
14 Ga0070666_10000370 3300005335 Bacteria 28303
15 Ga0070666_10004514 3300005335 Bacteria 8481
16 Ga0070666_10042388 3300005335 Bacteria 3045
17 Ga0070689_100729246 3300005340 Bacteria 867
18 Ga0070691_10140718 3300005341 Unclassified 1229
19 Ga0070687_100347501 3300005343 Bacteria 956
20 Ga0070687_100406613 3300005343 Unclassified 894
21 Ga0070661_100316498 3300005344 Bacteria 1218
22 Ga0070692_10330835 3300005345 Bacteria 940
23 Ga0070668_101464919 3300005347 Bacteria 623
24 Ga0070669_100000046 3300005353 Bacteria 119919
25 Ga0070669_100094290 3300005353 Bacteria 2249
26 Ga0070669_100659968 3300005353 Bacteria 880
27 Ga0070675_100251366 3300005354 Unclassified 1547
28 Ga0070675_100405794 3300005354 Unclassified 1216
29 Ga0070671_100007426 3300005355 Bacteria 8761
30 Ga0070674_100058417 3300005356 Bacteria 2681
31 Ga0070674_100082889 3300005356 Bacteria 2295
32 Ga0070674_102018848 3300005356 Unclassified 525
33 Ga0070688_100114172 3300005365 Bacteria 1800
34 Ga0070659_100030186 3300005366 Bacteria 4194
35 Ga0070667_100001808 3300005367 Bacteria 19041
36 Ga0070667_100244292 3300005367 Bacteria 1604
37 Ga0070667_101493307 3300005367 Bacteria 635
38 Ga0070709_10000256 3300005434 Bacteria 34164
39 Ga0070713_100729342 3300005436 Unclassified 947
40 Ga0070710_10012753 3300005437 Bacteria 4184
41 Ga0070701_10048770 3300005438 Bacteria 2187
42 Ga0070705_100813817 3300005440 Bacteria 744
43 Ga0070694_100249911 3300005444 Bacteria 1341
44 Ga0070708_100019959 3300005445 Bacteria 5642
45 Ga0070708_100878465 3300005445 Bacteria 842
46 Ga0070708_102203190 3300005445 Bacteria 509
47 Ga0070663_100005067 3300005455 Bacteria 7785
48 Ga0070663_100696927 3300005455 Bacteria 863
49 Ga0070662_101078028 3300005457 Bacteria 689
50 Ga0068867_100039137 3300005459 Bacteria 3456
51 Ga0068867_100160499 3300005459 Bacteria 1772
52 Ga0070685_10003691 3300005466 Bacteria 7755
53 Ga0070706_100125557 3300005467 Bacteria 2392
54 Ga0070706_100294525 3300005467 Bacteria 1514
55 Ga0070706_100855074 3300005467 Bacteria 841
56 Ga0070707_100005184 3300005468 Bacteria 12209
57 Ga0070707_100051084 3300005468 Bacteria 3963
58 Ga0070707_100079281 3300005468 Bacteria 3169
59 Ga0070707_100096961 3300005468 Unclassified 2856
60 Ga0070707_101025689 3300005468 Unclassified 790
61 Ga0070698_100000137 3300005471 Bacteria 65232
62 Ga0070698_100001463 3300005471 Bacteria 26218
63 Ga0070698_100065731 3300005471 Bacteria 3651
64 Ga0070698_100519475 3300005471 Bacteria 1129
65 Ga0070699_100001850 3300005518 Bacteria 19198
66 Ga0070699_100490529 3300005518 Bacteria 1115
67 Ga0070697_100009104 3300005536 Bacteria 7756
68 Ga0070697_100030957 3300005536 Bacteria 4301
69 Ga0070697_100875709 3300005536 Bacteria 796
70 Ga0068853_101747559 3300005539 Bacteria 603
71 Ga0070672_100028578 3300005543 Bacteria 4173
72 Ga0070686_100933294 3300005544 Bacteria 708
73 Ga0070695_100626780 3300005545 Bacteria 847
74 Ga0070696_100164786 3300005546 Unclassified 1635
75 Ga0070696_100206079 3300005546 Bacteria 1470
76 Ga0070693_100065052 3300005547 Bacteria 2131
77 Ga0070693_100145149 3300005547 Bacteria 1498
78 Ga0070693_100363294 3300005547 Bacteria 994
79 Ga0070665_100007653 3300005548 Bacteria 10983
80 Ga0070665_100205605 3300005548 Bacteria 1969
81 Ga0070665_100302416 3300005548 Bacteria 1603
82 Ga0070704_100141712 3300005549 Bacteria 1878
83 Ga0070704_100550507 3300005549 Bacteria 1008
84 Ga0068855_101405037 3300005563 Bacteria 719
85 Ga0070664_100021691 3300005564 Bacteria 5297
86 Ga0070664_100239370 3300005564 Bacteria 1629
87 Ga0068857_100050964 3300005577 Bacteria 3671
88 Ga0068854_100496835 3300005578 Unclassified 1027
89 Ga0068856_100258678 3300005614 Bacteria 1756
90 Ga0068856_100493400 3300005614 Bacteria 1245
91 Ga0068852_100321986 3300005616 Bacteria 1502
92 Ga0068852_100932396 3300005616 Unclassified 886
93 Ga0068859_100016676 3300005617 Bacteria 7375
94 Ga0068864_100498505 3300005618 Bacteria 1171
95 Ga0068864_100621332 3300005618 Bacteria 1050
96 Ga0068864_102046547 3300005618 Unclassified 579
97 Ga0068866_10000024 3300005718 Bacteria 60263
98 Ga0068866_10068793 3300005718 Bacteria 1863
99 Ga0068861_100160203 3300005719 Bacteria 1855
100 Ga0068861_100336799 3300005719 Bacteria 1319
101 Ga0068851_10730329 3300005834 Unclassified 611
102 Ga0068870_10318488 3300005840 Bacteria 987
103 Ga0068863_100053773 3300005841 Bacteria 3817
104 Ga0068863_100055301 3300005841 Bacteria 3758
105 Ga0068863_100777398 3300005841 Bacteria 954
106 Ga0068858_100002265 3300005842 Bacteria 19457
107 Ga0068858_100024773 3300005842 Bacteria 5588
108 Ga0068858_100150110 3300005842 Bacteria 2191
109 Ga0068860_100004282 3300005843 Bacteria 14591
110 Ga0068860_100016164 3300005843 Bacteria 7281
111 Ga0068862_100006315 3300005844 Bacteria 9854
112 Ga0068862_100016306 3300005844 Bacteria 6182
113 Ga0070717_10084816 3300006028 Bacteria 2665
114 Ga0070716_100025291 3300006173 Bacteria 3166
115 Ga0097621_100017498 3300006237 Bacteria 5444
116 Ga0097621_100280935 3300006237 Bacteria 1465
117 Ga0068871_100517175 3300006358 Bacteria 1077
118 Ga0068871_100604408 3300006358 Bacteria 998
119 Ga0075428_100523743 3300006844 Unclassified 1268
120 Ga0075428_101195047 3300006844 Bacteria 802
121 Ga0075433_10031610 3300006852 Bacteria 4526
122 Ga0075433_10543312 3300006852 Bacteria 1022
123 Ga0075434_100067335 3300006871 Bacteria 3567
124 Ga0075434_100189605 3300006871 Bacteria 2076
125 Ga0075434_100901373 3300006871 Bacteria 899
126 Ga0075436_100015962 3300006914 Bacteria 5141
127 Ga0075436_100072237 3300006914 Bacteria 2387
128 Ga0075436_100214054 3300006914 Unclassified 1366
129 Ga0075436_100451498 3300006914 Bacteria 936
130 Ga0097620_100016676 3300006931 Bacteria 7375
131 Ga0075435_100007305 3300007076 Bacteria 7867
132 Ga0075435_100117010 3300007076 Unclassified 2221
133 Ga0075435_100186932 3300007076 Bacteria 1752
134 Ga0075435_100513951 3300007076 Bacteria 1036
135 Ga0105240_10000605 3300009093 Bacteria 66551
136 Ga0111539_10025316 3300009094 Bacteria 7274
137 Ga0105245_10660957 3300009098 Bacteria 1076
138 Ga0105247_10523000 3300009101 Bacteria 868
139 Ga0114129_10004337 3300009147 Bacteria 20051
140 Ga0114129_10007160 3300009147 Bacteria 15874
141 Ga0114129_10146665 3300009147 Bacteria 3232
142 Ga0114129_10361309 3300009147 Bacteria 1921
143 Ga0105241_11556021 3300009174 Unclassified 638
144 Ga0105242_10000041 3300009176 Bacteria 86955
145 Ga0105248_10020633 3300009177 Bacteria 7303
146 Ga0105248_11231059 3300009177 Bacteria 846
147 Ga0105237_10102231 3300009545 Bacteria 2858
148 Ga0105249_10002174 3300009553 Bacteria 16990
149 Ga0105239_10000206 3300010375 Bacteria 86955
150 Ga0157371_11334071 3300013102 Bacteria 556
151 Ga0157374_12785249 3300013296 Unclassified 517
152 Ga0157378_10013857 3300013297 Bacteria 7052
153 Ga0157378_10110056 3300013297 Bacteria 2524
154 Ga0157375_10002600 3300013308 Bacteria 15670
155 Ga0157375_10045366 3300013308 Bacteria 4277
156 Ga0163163_10051987 3300014325 Bacteria 4040
157 Ga0163163_10285240 3300014325 Bacteria 1703
158 Ga0163163_10410900 3300014325 Bacteria 1412
159 Ga0157380_10360506 3300014326 Bacteria 1364
160 Ga0157379_10000715 3300014968 Bacteria 26939
161 Ga0157376_10004899 3300014969 Bacteria 9329
162 Ga0157376_10180926 3300014969 Bacteria 1927
163 Ga0207697_10002762 3300025315 Bacteria 8953
164 Ga0207656_10672150 3300025321 Unclassified 530
165 Ga0207682_10014323 3300025893 Bacteria 3088
166 Ga0207692_10419163 3300025898 Bacteria 838
167 Ga0207642_10000015 3300025899 Bacteria 69010
168 Ga0207642_10018832 3300025899 Bacteria 2660
169 Ga0207680_10000542 3300025903 Bacteria 17913
170 Ga0207680_10025099 3300025903 Bacteria 3283
171 Ga0207647_10081497 3300025904 Bacteria 1939
172 Ga0207699_10000111 3300025906 Bacteria 57717
173 Ga0207645_10006294 3300025907 Bacteria 8532
174 Ga0207645_10153227 3300025907 Bacteria 1505
175 Ga0207643_10051733 3300025908 Bacteria 2332
176 Ga0207705_10062824 3300025909 Bacteria 2683
177 Ga0207705_10185054 3300025909 Bacteria 1573
178 Ga0207684_10002486 3300025910 Bacteria 18539
179 Ga0207684_10022219 3300025910 Bacteria 5418
180 Ga0207684_10095806 3300025910 Bacteria 2533
181 Ga0207684_10221782 3300025910 Bacteria 1632
182 Ga0207671_10094837 3300025914 Bacteria 2252
183 Ga0207660_10309565 3300025917 Bacteria 1259
184 Ga0207662_10031884 3300025918 Unclassified 3064
185 Ga0207657_10083986 3300025919 Bacteria 2670
186 Ga0207649_10178706 3300025920 Bacteria 1484
187 Ga0207646_10085300 3300025922 Bacteria 2825
188 Ga0207646_10607529 3300025922 Bacteria 981
189 Ga0207646_10641794 3300025922 Unclassified 951
190 Ga0207681_10000080 3300025923 Bacteria 86343
191 Ga0207681_10019944 3300025923 Bacteria 4246
192 Ga0207681_10080559 3300025923 Bacteria 2297
193 Ga0207650_10026310 3300025925 Bacteria 4148
194 Ga0207659_10134241 3300025926 Bacteria 1914
195 Ga0207659_11115408 3300025926 Bacteria 679
196 Ga0207700_10511947 3300025928 Unclassified 1063
197 Ga0207644_10011508 3300025931 Bacteria 5856
198 Ga0207706_10009091 3300025933 Bacteria 9134
199 Ga0207706_10512373 3300025933 Bacteria 1035
200 Ga0207686_10000050 3300025934 Bacteria 114997
201 Ga0207670_10069797 3300025936 Bacteria 2425
202 Ga0207669_10733530 3300025937 Unclassified 814
203 Ga0207704_10067802 3300025938 Bacteria 2246
204 Ga0207704_10253002 3300025938 Bacteria 1324
205 Ga0207665_10029055 3300025939 Bacteria 3656
206 Ga0207665_10118829 3300025939 Unclassified 1865
207 Ga0207691_10003615 3300025940 Bacteria 15005
208 Ga0207691_10247703 3300025940 Bacteria 1539
209 Ga0207711_10003571 3300025941 Bacteria 13454
210 Ga0207689_10033819 3300025942 Bacteria 4246
211 Ga0207679_10005696 3300025945 Bacteria 7810
212 Ga0207679_10151871 3300025945 Bacteria 1886
213 Ga0207679_10189103 3300025945 Bacteria 1710
214 Ga0207667_10118710 3300025949 Bacteria 2726
215 Ga0207651_10458455 3300025960 Unclassified 1095
216 Ga0207712_10900985 3300025961 Bacteria 782
217 Ga0207658_10085202 3300025986 Bacteria 2433
218 Ga0207658_10288698 3300025986 Bacteria 1409
219 Ga0207658_11000325 3300025986 Unclassified 763
220 Ga0207658_11397032 3300025986 Bacteria 640
221 Ga0207703_10007161 3300026035 Bacteria 8873
222 Ga0207703_10098846 3300026035 Bacteria 2469
223 Ga0207703_10129021 3300026035 Bacteria 2181
224 Ga0207678_10017919 3300026067 Bacteria 6220
225 Ga0207678_11599763 3300026067 Bacteria 574
226 Ga0207708_10816974 3300026075 Bacteria 803
227 Ga0207702_10029309 3300026078 Bacteria 4579
228 Ga0207702_10162688 3300026078 Bacteria 2039
229 Ga0207641_10014084 3300026088 Bacteria 6555
230 Ga0207641_10018089 3300026088 Bacteria 5775
231 Ga0207641_10315215 3300026088 Bacteria 1481
232 Ga0207641_10774272 3300026088 Bacteria 948
233 Ga0207641_11369874 3300026088 Bacteria 708
234 Ga0207641_12196609 3300026088 Bacteria 552
235 Ga0207648_10003187 3300026089 Bacteria 17283
236 Ga0207648_10052789 3300026089 Bacteria 3555
237 Ga0207648_10224357 3300026089 Bacteria 1671
238 Ga0207648_10469695 3300026089 Bacteria 1148
239 Ga0207648_10839841 3300026089 Unclassified 856
240 Ga0207676_10177608 3300026095 Bacteria 1861
241 Ga0207675_100003779 3300026118 Bacteria 14738
242 Ga0207675_100131466 3300026118 Bacteria 2374
243 Ga0207683_10093792 3300026121 Bacteria 2675
244 Ga0209967_1041798 3300027364 Bacteria 697
245 Ga0210000_1029264 3300027462 Bacteria 859
246 Ga0209995_1028260 3300027471 Bacteria 937
247 Ga0209999_1011717 3300027543 Bacteria 1588
248 Ga0209970_1000988 3300027614 Bacteria 5057
249 Ga0210002_1012864 3300027617 Unclassified 1303
250 Ga0209983_1006688 3300027665 Bacteria 2366
251 Ga0209983_1126601 3300027665 Bacteria 584
252 Ga0209971_1000431 3300027682 Bacteria 11194
253 Ga0209966_1003345 3300027695 Bacteria 2693
254 Ga0209998_10009773 3300027717 Bacteria 1990
255 Ga0209974_10003383 3300027876 Bacteria 5764
256 Ga0209974_10354918 3300027876 Bacteria 569
257 Ga0268266_10006009 3300028379 Bacteria 11203
258 Ga0268266_10247241 3300028379 Bacteria 1648
259 Ga0268265_10002105 3300028380 Bacteria 15471
260 Ga0268265_10261231 3300028380 Bacteria 1539
261 Ga0268264_10004644 3300028381 Bacteria 11670
262 Ga0268264_10282218 3300028381 Bacteria 1556
263 Ga0265330_10119614 3300031235 Unclassified 1123
264 Ga0265328_10036450 3300031239 Bacteria 1817
265 Ga0265327_10357672 3300031251 Bacteria 637
266 Ga0307408_100650500 3300031548 Unclassified 942
267 Ga0307508_10505145 3300031616 Unclassified 804
268 Ga0307405_10123820 3300031731 Bacteria 1774
269 Ga0307413_10264824 3300031824 Bacteria 1283
270 Ga0307410_10017120 3300031852 Bacteria 4342
271 Ga0307406_10391837 3300031901 Bacteria 1098
272 Ga0307406_11071083 3300031901 Unclassified 695
273 Ga0307407_10071227 3300031903 Bacteria 2069
274 Ga0307412_11358368 3300031911 Bacteria 642
275 Ga0307409_100006156 3300031995 Bacteria 7017
276 Ga0307416_100046245 3300032002 Bacteria 3433
277 Ga0307414_10221686 3300032004 Unclassified 1553
278 Ga0307411_10003099 3300032005 Bacteria 7609
279 Ga0307415_100009562 3300032126 Bacteria 5443
280 Ga0316583_10000240 3300032133 Bacteria 14849
281 Ga0316583_10094389 3300032133 Unclassified 1043
282 Ga0373929_0000001 3300035085 Bacteria 956023
283 Ga0373932_0393406 3300035112 Unclassified 535
284 Ga0373936_0296616 3300035113 Bacteria 729
285 Ga0373956_0220419 3300035119 Bacteria 901
286 Ga0373960_0132971 3300035121 Bacteria 836
287 Ga0373943_0060670 3300035170 Bacteria 1888
288 Ga0373955_0023832 3300035172 Bacteria 3123
289 Ga0373955_0084202 3300035172 Bacteria 1803
290 Ga0373961_0000263 3300035241 Bacteria 24255
291 Ga0316574_0292802 3300035398 Bacteria 1036
292 Ga0316574_0750828 3300035398 Bacteria 596
293 Ga0373935_0024020 3300035692 Bacteria 3748
294 Ga0373937_0269710 3300036401 Bacteria 1606
295 Ga0373937_0647707 3300036401 Bacteria 1002
296 Ga0395899_0812555 3300037312 Unclassified 577
297 Ga0395900_0662003 3300037418 Bacteria 980
298 Ga0436360_0027280 3300039438 Bacteria 703
299 Ga0451798_1149792 3300041458 Unclassified 1014
300 Ga0451807_0671126 3300041486 Unclassified 908
301 Ga0451833_1479962 3300041491 Bacteria 1038
302 Ga0451839_0767486 3300041496 Unclassified 528
303 Ga0451577_0004271 3300042876 Bacteria 15192
304 Ga0451577_0059406 3300042876 Bacteria 3409
305 Ga0451577_0552991 3300042876 Bacteria 1045
306 Ga0451577_1283698 3300042876 Bacteria 651
307 Ga0466963_0871757 3300044694 Bacteria 635
308 Ga0453684_0319856 3300044712 Bacteria 1758
309 Ga0453684_0334968 3300044712 Unclassified 1710
310 Ga0466958_0233903 3300045836 Bacteria 1174
311 Ga0466967_0681434 3300045976 Bacteria 1018
312 Ga0495582_0280397 3300046473 Bacteria 957
313 Ga0495582_0880985 3300046473 Bacteria 517
314 Ga0495662_0511934 3300046476 Bacteria 588
315 Ga0495618_0391603 3300046514 Unclassified 851
316 Ga0495633_0337272 3300046558 Unclassified 683
317 Ga0495634_0629485 3300046642 Bacteria 621
318 Ga0495635_0046971 3300046663 Bacteria 2979
319 Ga0495588_0689359 3300046674 Unclassified 534
320 Ga0495670_0551825 3300046691 Bacteria 627
321 Ga0495684_0098971 3300047471 Bacteria 2205
322 Ga0495684_0102392 3300047471 Bacteria 2164
323 Ga0495615_0006441 3300048090 Unclassified 2175
324 Ga0496101_0030640 3300048904 Bacteria 3774
325 Ga0496102_0031274 3300048905 Bacteria 4773
326 Ga0496102_1618473 3300048905 Bacteria 566
327 Ga0496105_0365101 3300048908 Bacteria 1151
328 Ga0496106_0044723 3300048909 Bacteria 3324
329 Ga0496107_0004191 3300048910 Bacteria 9737
330 Ga0496108_1002023 3300048911 Bacteria 713
331 Ga0496109_0893771 3300048912 Bacteria 826
332 Ga0496110_0199806 3300048913 Bacteria 1816
333 Ga0496111_0019843 3300048914 Bacteria 4674
334 Ga0496111_0937695 3300048914 Bacteria 622
335 Ga0496112_0601419 3300048915 Bacteria 1032
336 Ga0496114_0000009 3300048917 Bacteria 370373
337 Ga0501036_0594871 3300049572 Bacteria 918
338 Ga0501041_0391935 3300049577 Bacteria 879
339 Ga0501042_0675313 3300049578 Unclassified 751
340 Ga0501069_0692094 3300049585 Bacteria 615
341 Ga0501071_0374199 3300049587 Bacteria 1086
342 Ga0501071_0526767 3300049587 Bacteria 907
343 Ga0501071_0615411 3300049587 Bacteria 835
344 Ga0501071_1019689 3300049587 Bacteria 639
345 Ga0501072_0346941 3300049588 Bacteria 1179
346 Ga0501072_0437380 3300049588 Bacteria 1036
347 Ga0501074_0093530 3300049590 Bacteria 2153
348 Ga0501075_0002156 3300049591 Bacteria 13039
349 Ga0501075_0082942 3300049591 Bacteria 2428
350 Ga0501075_0451817 3300049591 Bacteria 980
351 Ga0501076_0020934 3300049592 Bacteria 5010
352 Ga0501076_1637524 3300049592 Bacteria 528
353 Ga0501077_0000052 3300049593 Bacteria 59284
354 Ga0501079_0378273 3300049741 Bacteria 1110
355 Ga0501079_0597910 3300049741 Bacteria 868
356 Ga0501079_0846009 3300049741 Bacteria 720
357 Ga0501080_0002296 3300049742 Bacteria 16663
358 Ga0501080_0093450 3300049742 Bacteria 2793
359 Ga0501080_0282391 3300049742 Bacteria 1509
360 Ga0501081_0035561 3300049743 Bacteria 3391
361 Ga0501081_0977229 3300049743 Bacteria 639
362 Ga0501083_0001595 3300049744 Bacteria 15502
363 Ga0501273_053805 3300049770 Bacteria 621
364 Ga0501045_0689473 3300049824 Bacteria 754
365 nmdc:mga05p37_13977_c1 3300050507 Bacteria 9626
366 nmdc:mga05p37_1657650_c1 3300050507 Unclassified 626
367 nmdc:mga05p37_314005_c1 3300050507 Bacteria 1857
368 nmdc:mga05p37_54587_c1 3300050507 Bacteria 4915
369 nmdc:mga06r32_1805070_c1 3300050510 Unclassified 547
370 nmdc:mga08y16_249928_c1 3300050511 Bacteria 1832
371 nmdc:mga0n895_28923_c1 3300050512 Bacteria 5278
372 nmdc:mga0n895_34685_c1 3300050512 Bacteria 4859
373 nmdc:mga0n895_904791_c1 3300050512 Bacteria 868
374 nmdc:mga0n895_99983_c1 3300050512 Bacteria 2909
375 nmdc:mga0rr50_105032_c1 3300050513 Unclassified 2226
376 nmdc:mga0rr50_293551_c1 3300050513 Bacteria 1359
377 nmdc:mga0rr50_3977_c2 3300050513 Bacteria 7671
378 nmdc:mga08x19_288_c1 3300050514 Bacteria 37103
379 nmdc:mga08x19_424396_c1 3300050514 Unclassified 934
380 nmdc:mga08x19_928936_c1 3300050514 Unclassified 618
381 nmdc:mga0a205_180005_c1 3300050515 Bacteria 2008
382 nmdc:mga0a205_2861_c1 3300050515 Bacteria 15274
383 Ga0495601_0481515 3300053077 Bacteria 802
384 Ga0495595_0102102 3300053084 Bacteria 1385
385 Ga0495619_0006825 3300053085 Bacteria 7215
386 Ga0501084_0048241 3300054114 Bacteria 3565
387 Ga0501082_0002868 3300060353 Bacteria 15017
388 Ga0501082_1458068 3300060353 Bacteria 598
389 Ga0466962_0413373 3300061719 Bacteria 676
390 Ga0530510_0687835 3300061734 Bacteria 779
391 Ga0501081_1161579
392 JGI26145J50221_1006532
393 Ga0065715_10481556
394 Ga0065707_10364572
395 Ga0070658_10023814
396 Ga0070658_10321152
397 Ga0070690_100000135
398 Ga0070690_100109526
399 Ga0070690_100346777
400 Ga0070670_100232758
401 Ga0070677_10028378
402 Ga0070677_10037503
403 Ga0068869_100015786
404 Ga0070666_10000370
405 Ga0070666_10004514
406 Ga0070666_10042388
407 Ga0070689_100729246
408 Ga0070691_10140718
409 Ga0070687_100347501
410 Ga0070687_100406613
411 Ga0070661_100316498
412 Ga0070692_10330835
413 Ga0070668_101464919
414 Ga0070669_100000046
415 Ga0070669_100094290
416 Ga0070669_100659968
417 Ga0070675_100251366
418 Ga0070675_100405794
419 Ga0070671_100007426
420 Ga0070674_100058417
421 Ga0070674_100082889
422 Ga0070674_102018848
423 Ga0070688_100114172
424 Ga0070659_100030186
425 Ga0070667_100001808
426 Ga0070667_100244292
427 Ga0070667_101493307
428 Ga0070709_10000256
429 Ga0070713_100729342
430 Ga0070710_10012753
431 Ga0070701_10048770
432 Ga0070705_100813817
433 Ga0070694_100249911
434 Ga0070708_100019959
435 Ga0070708_100878465
436 Ga0070708_102203190
437 Ga0070663_100005067
438 Ga0070663_100696927
439 Ga0070662_101078028
440 Ga0068867_100039137
441 Ga0068867_100160499
442 Ga0070685_10003691
443 Ga0070706_100125557
444 Ga0070706_100294525
445 Ga0070706_100855074
446 Ga0070707_100005184
447 Ga0070707_100051084
448 Ga0070707_100079281
449 Ga0070707_100096961
450 Ga0070707_101025689
451 Ga0070698_100000137
452 Ga0070698_100001463
453 Ga0070698_100065731
454 Ga0070698_100519475
455 Ga0070699_100001850
456 Ga0070699_100490529
457 Ga0070697_100009104
458 Ga0070697_100030957
459 Ga0070697_100875709
460 Ga0068853_101747559
461 Ga0070672_100028578
462 Ga0070686_100933294
463 Ga0070695_100626780
464 Ga0070696_100164786
465 Ga0070696_100206079
466 Ga0070693_100065052
467 Ga0070693_100145149
468 Ga0070693_100363294
469 Ga0070665_100007653
470 Ga0070665_100205605
471 Ga0070665_100302416
472 Ga0070704_100141712
473 Ga0070704_100550507
474 Ga0068855_101405037
475 Ga0070664_100021691
476 Ga0070664_100239370
477 Ga0068857_100050964
478 Ga0068854_100496835
479 Ga0068856_100258678
480 Ga0068856_100493400
481 Ga0068852_100321986
482 Ga0068852_100932396
483 Ga0068859_100016676
484 Ga0068864_100498505
485 Ga0068864_100621332
486 Ga0068864_102046547
487 Ga0068866_10000024
488 Ga0068866_10068793
489 Ga0068861_100160203
490 Ga0068861_100336799
491 Ga0068851_10730329
492 Ga0068870_10318488
493 Ga0068863_100053773
494 Ga0068863_100055301
495 Ga0068863_100777398
496 Ga0068858_100002265
497 Ga0068858_100024773
498 Ga0068858_100150110
499 Ga0068860_100004282
500 Ga0068860_100016164
501 Ga0068862_100006315
502 Ga0068862_100016306
503 Ga0070717_10084816
504 Ga0070716_100025291
505 Ga0097621_100017498
506 Ga0097621_100280935
507 Ga0068871_100517175
508 Ga0068871_100604408
509 Ga0075428_100523743
510 Ga0075428_101195047
511 Ga0075433_10031610
512 Ga0075433_10543312
513 Ga0075434_100067335
514 Ga0075434_100189605
515 Ga0075434_100901373
516 Ga0075436_100015962
517 Ga0075436_100072237
518 Ga0075436_100214054
519 Ga0075436_100451498
520 Ga0097620_100016676
521 Ga0075435_100007305
522 Ga0075435_100117010
523 Ga0075435_100186932
524 Ga0075435_100513951
525 Ga0105240_10000605
526 Ga0111539_10025316
527 Ga0105245_10660957
528 Ga0105247_10523000
529 Ga0114129_10004337
530 Ga0114129_10007160
531 Ga0114129_10146665
532 Ga0114129_10361309
533 Ga0105241_11556021
534 Ga0105242_10000041
535 Ga0105248_10020633
536 Ga0105248_11231059
537 Ga0105237_10102231
538 Ga0105249_10002174
539 Ga0105239_10000206
540 Ga0157371_11334071
541 Ga0157374_12785249
542 Ga0157378_10013857
543 Ga0157378_10110056
544 Ga0157375_10002600
545 Ga0157375_10045366
546 Ga0163163_10051987
547 Ga0163163_10285240
548 Ga0163163_10410900
549 Ga0157380_10360506
550 Ga0157379_10000715
551 Ga0157376_10004899
552 Ga0157376_10180926
553 Ga0207697_10002762
554 Ga0207656_10672150
555 Ga0207682_10014323
556 Ga0207692_10419163
557 Ga0207642_10000015
558 Ga0207642_10018832
559 Ga0207680_10000542
560 Ga0207680_10025099
561 Ga0207647_10081497
562 Ga0207699_10000111
563 Ga0207645_10006294
564 Ga0207645_10153227
565 Ga0207643_10051733
566 Ga0207705_10062824
567 Ga0207705_10185054
568 Ga0207684_10002486
569 Ga0207684_10022219
570 Ga0207684_10095806
571 Ga0207684_10221782
572 Ga0207671_10094837
573 Ga0207660_10309565
574 Ga0207662_10031884
575 Ga0207657_10083986
576 Ga0207649_10178706
577 Ga0207646_10085300
578 Ga0207646_10607529
579 Ga0207646_10641794
580 Ga0207681_10000080
581 Ga0207681_10019944
582 Ga0207681_10080559
583 Ga0207650_10026310
584 Ga0207659_10134241
585 Ga0207659_11115408
586 Ga0207700_10511947
587 Ga0207644_10011508
588 Ga0207706_10009091
589 Ga0207706_10512373
590 Ga0207686_10000050
591 Ga0207670_10069797
592 Ga0207669_10733530
593 Ga0207704_10067802
594 Ga0207704_10253002
595 Ga0207665_10029055
596 Ga0207665_10118829
597 Ga0207691_10003615
598 Ga0207691_10247703
599 Ga0207711_10003571
600 Ga0207689_10033819
601 Ga0207679_10005696
602 Ga0207679_10151871
603 Ga0207679_10189103
604 Ga0207667_10118710
605 Ga0207651_10458455
606 Ga0207712_10900985
607 Ga0207658_10085202
608 Ga0207658_10288698
609 Ga0207658_11000325
610 Ga0207658_11397032
611 Ga0207703_10007161
612 Ga0207703_10098846
613 Ga0207703_10129021
614 Ga0207678_10017919
615 Ga0207678_11599763
616 Ga0207708_10816974
617 Ga0207702_10029309
618 Ga0207702_10162688
619 Ga0207641_10014084
620 Ga0207641_10018089
621 Ga0207641_10315215
622 Ga0207641_10774272
623 Ga0207641_11369874
624 Ga0207641_12196609
625 Ga0207648_10003187
626 Ga0207648_10052789
627 Ga0207648_10224357
628 Ga0207648_10469695
629 Ga0207648_10839841
630 Ga0207676_10177608
631 Ga0207675_100003779
632 Ga0207675_100131466
633 Ga0207683_10093792
634 Ga0209967_1041798
635 Ga0210000_1029264
636 Ga0209995_1028260
637 Ga0209999_1011717
638 Ga0209970_1000988
639 Ga0210002_1012864
640 Ga0209983_1006688
641 Ga0209983_1126601
642 Ga0209971_1000431
643 Ga0209966_1003345
644 Ga0209998_10009773
645 Ga0209974_10003383
646 Ga0209974_10354918
647 Ga0268266_10006009
648 Ga0268266_10247241
649 Ga0268265_10002105
650 Ga0268265_10261231
651 Ga0268264_10004644
652 Ga0268264_10282218
653 Ga0265330_10119614
654 Ga0265328_10036450
655 Ga0265327_10357672
656 Ga0307408_100650500
657 Ga0307508_10505145
658 Ga0307405_10123820
659 Ga0307413_10264824
660 Ga0307410_10017120
661 Ga0307406_10391837
662 Ga0307406_11071083
663 Ga0307407_10071227
664 Ga0307412_11358368
665 Ga0307409_100006156
666 Ga0307416_100046245
667 Ga0307414_10221686
668 Ga0307411_10003099
669 Ga0307415_100009562
670 Ga0316583_10000240
671 Ga0316583_10094389
672 Ga0373929_0000001
673 Ga0373932_0393406
674 Ga0373936_0296616
675 Ga0373956_0220419
676 Ga0373960_0132971
677 Ga0373943_0060670
678 Ga0373955_0023832
679 Ga0373955_0084202
680 Ga0373961_0000263
681 Ga0316574_0292802
682 Ga0316574_0750828
683 Ga0373935_0024020
684 Ga0373937_0269710
685 Ga0373937_0647707
686 Ga0395899_0812555
687 Ga0395900_0662003
688 Ga0436360_0027280
689 Ga0451798_1149792
690 Ga0451807_0671126
691 Ga0451833_1479962
692 Ga0451839_0767486
693 Ga0451577_0004271
694 Ga0451577_0059406
695 Ga0451577_0552991
696 Ga0451577_1283698
697 Ga0466963_0871757
698 Ga0453684_0319856
699 Ga0453684_0334968
700 Ga0466958_0233903
701 Ga0466967_0681434
702 Ga0495582_0280397
703 Ga0495582_0880985
704 Ga0495662_0511934
705 Ga0495618_0391603
706 Ga0495633_0337272
707 Ga0495634_0629485
708 Ga0495635_0046971
709 Ga0495588_0689359
710 Ga0495670_0551825
711 Ga0495684_0098971
712 Ga0495684_0102392
713 Ga0495615_0006441
714 Ga0496101_0030640
715 Ga0496102_0031274
716 Ga0496102_1618473
717 Ga0496105_0365101
718 Ga0496106_0044723
719 Ga0496107_0004191
720 Ga0496108_1002023
721 Ga0496109_0893771
722 Ga0496110_0199806
723 Ga0496111_0019843
724 Ga0496111_0937695
725 Ga0496112_0601419
726 Ga0496114_0000009
727 Ga0501036_0594871
728 Ga0501041_0391935
729 Ga0501042_0675313
730 Ga0501069_0692094
731 Ga0501071_0374199
732 Ga0501071_0526767
733 Ga0501071_0615411
734 Ga0501071_1019689
735 Ga0501072_0346941
736 Ga0501072_0437380
737 Ga0501074_0093530
738 Ga0501075_0002156
739 Ga0501075_0082942
740 Ga0501075_0451817
741 Ga0501076_0020934
742 Ga0501076_1637524
743 Ga0501077_0000052
744 Ga0501079_0378273
745 Ga0501079_0597910
746 Ga0501079_0846009
747 Ga0501080_0002296
748 Ga0501080_0093450
749 Ga0501080_0282391
750 Ga0501081_0035561
751 Ga0501081_0977229
752 Ga0501083_0001595
753 Ga0501273_053805
754 Ga0501045_0689473
755 nmdc:mga05p37_13977_c1
756 nmdc:mga05p37_1657650_c1
757 nmdc:mga05p37_314005_c1
758 nmdc:mga05p37_54587_c1
759 nmdc:mga06r32_1805070_c1
760 nmdc:mga08y16_249928_c1
761 nmdc:mga0n895_28923_c1
762 nmdc:mga0n895_34685_c1
763 nmdc:mga0n895_904791_c1
764 nmdc:mga0n895_99983_c1
765 nmdc:mga0rr50_105032_c1
766 nmdc:mga0rr50_293551_c1
767 nmdc:mga0rr50_3977_c2
768 nmdc:mga08x19_288_c1
769 nmdc:mga08x19_424396_c1
770 nmdc:mga08x19_928936_c1
771 nmdc:mga0a205_180005_c1
772 nmdc:mga0a205_2861_c1
773 Ga0495601_0481515
774 Ga0495595_0102102
775 Ga0495619_0006825
776 Ga0501084_0048241
777 Ga0501082_0002868
778 Ga0501082_1458068
779 Ga0466962_0413373
780 Ga0530510_0687835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

26

160

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9934 3 136
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9908 1 136
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9908 1 136
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9898 1 137
6ay1-assembly8.cif.gz_H crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9892 1 136
ID Description Score Start End Superfamily
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.988 1 132 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9818 1 136 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.979 3 138 3.30.70.141
af_A4IG45_154_309_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9782 2 132 3.30.70.141
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9781 3 78 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A2E0LEK8-F1-model_v4 deleted 1.002 3 132
AF-A0A5C4SRB4-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9998 4 136 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A1M7JGP2-F1-model_v4 deleted 0.9988 4 136
AF-L7YEQ3-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9988 3 136 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-V6DH04-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9984 1 133 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Map