F431847

General Info

Members Datasets Scaffolds Average Seq Length
390 230 780 148

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0872540|Ga0501034_0872540_269_778
Length 169
Sequence MAGKASGGGPVSDSIAAHILIVEARFYEDLADEMAAGAIAEIEARGGTWERIGVPGALEIPQVVRAASDAGRFRFQRDDDAGFDGVVAIGCVIRGETYHFEVVCNESNHWLMEVAARHGVPVGNAILTVDTREQALERAGGGRAGKGGDAARACLRLIEIEQGFAEGEE

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
230 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 2.82
Rhizosphere 91.28
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0872540 3300049571 Bacteria 789
2 JGI25155J39150_1000008 3300002704 Bacteria 236146
3 Ga0055540_1074742 3300003792 Bacteria 657
4 Ga0070658_10204292 3300005327 Bacteria 1668
5 Ga0070676_10012480 3300005328 Bacteria 4640
6 Ga0070676_10068940 3300005328 Bacteria 2119
7 Ga0070676_10419408 3300005328 Bacteria 935
8 Ga0070676_10582524 3300005328 Bacteria 805
9 Ga0070690_100016924 3300005330 Bacteria 4376
10 Ga0070690_100268084 3300005330 Bacteria 1214
11 Ga0070670_100043568 3300005331 Bacteria 3857
12 Ga0070670_100049622 3300005331 Bacteria 3608
13 Ga0070670_100163979 3300005331 Bacteria 1926
14 Ga0070670_100207872 3300005331 Bacteria 1701
15 Ga0070670_100413004 3300005331 Bacteria 1192
16 Ga0070677_10148076 3300005333 Bacteria 1090
17 Ga0070677_10227282 3300005333 Bacteria 915
18 Ga0068869_100483145 3300005334 Bacteria 1032
19 Ga0070666_10003262 3300005335 Bacteria 9851
20 Ga0070666_10111684 3300005335 Bacteria 1890
21 Ga0068868_100046103 3300005338 Bacteria 3412
22 Ga0070689_100007984 3300005340 Bacteria 7427
23 Ga0070689_100264090 3300005340 Bacteria 1423
24 Ga0070687_100003820 3300005343 Bacteria 5915
25 Ga0070687_100199005 3300005343 Bacteria 1213
26 Ga0070687_100840800 3300005343 Bacteria 654
27 Ga0070661_100487260 3300005344 Bacteria 985
28 Ga0070661_100684550 3300005344 Bacteria 835
29 Ga0070661_101238525 3300005344 Bacteria 625
30 Ga0070668_100005186 3300005347 Bacteria 9664
31 Ga0070668_102148808 3300005347 Bacteria 516
32 Ga0070669_100004897 3300005353 Bacteria 9666
33 Ga0070669_100364643 3300005353 Bacteria 1175
34 Ga0070669_100876441 3300005353 Bacteria 766
35 Ga0070675_100004224 3300005354 Bacteria 10926
36 Ga0070675_100047100 3300005354 Bacteria 3532
37 Ga0070675_100258090 3300005354 Bacteria 1527
38 Ga0070675_100403660 3300005354 Bacteria 1219
39 Ga0070675_100425809 3300005354 Bacteria 1187
40 Ga0070671_100004652 3300005355 Bacteria 10882
41 Ga0070671_100183633 3300005355 Bacteria 1771
42 Ga0070674_100123826 3300005356 Bacteria 1917
43 Ga0070674_101259422 3300005356 Bacteria 658
44 Ga0070673_100004349 3300005364 Bacteria 8949
45 Ga0070673_100835601 3300005364 Bacteria 852
46 Ga0070688_100148344 3300005365 Bacteria 1601
47 Ga0070659_101145227 3300005366 Bacteria 687
48 Ga0070667_100025867 3300005367 Bacteria 4882
49 Ga0070667_100355720 3300005367 Bacteria 1326
50 Ga0070710_10559468 3300005437 Bacteria 791
51 Ga0070701_10096791 3300005438 Bacteria 1628
52 Ga0070700_100028172 3300005441 Bacteria 3338
53 Ga0070678_100209190 3300005456 Bacteria 1615
54 Ga0070678_100231518 3300005456 Bacteria 1541
55 Ga0070678_100248852 3300005456 Bacteria 1489
56 Ga0070678_100424725 3300005456 Bacteria 1159
57 Ga0070678_100745004 3300005456 Bacteria 886
58 Ga0070662_100004259 3300005457 Bacteria 9024
59 Ga0070662_100050265 3300005457 Bacteria 3007
60 Ga0068867_100183647 3300005459 Bacteria 1664
61 Ga0068867_100968453 3300005459 Bacteria 770
62 Ga0070706_100310480 3300005467 Bacteria 1471
63 Ga0070699_100587454 3300005518 Bacteria 1015
64 Ga0070672_100025955 3300005543 Bacteria 4352
65 Ga0070672_100049245 3300005543 Bacteria 3277
66 Ga0070672_100052399 3300005543 Bacteria 3185
67 Ga0070672_100406486 3300005543 Bacteria 1168
68 Ga0070672_100642449 3300005543 Bacteria 926
69 Ga0070672_100760952 3300005543 Bacteria 850
70 Ga0070693_100362068 3300005547 Bacteria 995
71 Ga0070693_100622512 3300005547 Bacteria 782
72 Ga0070665_100661296 3300005548 Bacteria 1058
73 Ga0068855_100000024 3300005563 Bacteria 184241
74 Ga0070664_100423474 3300005564 Bacteria 1220
75 Ga0070664_100496485 3300005564 Bacteria 1124
76 Ga0070664_101013503 3300005564 Bacteria 781
77 Ga0068854_100382252 3300005578 Bacteria 1160
78 Ga0068854_100460454 3300005578 Bacteria 1064
79 Ga0068854_100476972 3300005578 Bacteria 1047
80 Ga0068852_100213835 3300005616 Bacteria 1830
81 Ga0068852_100225045 3300005616 Bacteria 1786
82 Ga0068852_100961023 3300005616 Bacteria 872
83 Ga0068859_100071566 3300005617 Bacteria 3504
84 Ga0068864_100001212 3300005618 Bacteria 21428
85 Ga0068864_100443330 3300005618 Bacteria 1240
86 Ga0068864_100490530 3300005618 Bacteria 1180
87 Ga0068866_10005162 3300005718 Bacteria 5382
88 Ga0068866_10259299 3300005718 Bacteria 1067
89 Ga0068861_100002269 3300005719 Bacteria 12489
90 Ga0068861_100078100 3300005719 Bacteria 2584
91 Ga0068861_101113093 3300005719 Bacteria 759
92 Ga0068851_10185872 3300005834 Bacteria 1153
93 Ga0068870_10417853 3300005840 Bacteria 877
94 Ga0068870_10584331 3300005840 Bacteria 757
95 Ga0068863_100006407 3300005841 Bacteria 11540
96 Ga0068863_100396432 3300005841 Bacteria 1349
97 Ga0068858_100001935 3300005842 Bacteria 21109
98 Ga0068858_100002260 3300005842 Bacteria 19472
99 Ga0068860_100000605 3300005843 Bacteria 42776
100 Ga0068860_100481719 3300005843 Bacteria 1237
101 Ga0068862_100012678 3300005844 Bacteria 6976
102 Ga0068862_100028887 3300005844 Bacteria 4671
103 Ga0075365_10028707 3300006038 Bacteria 3550
104 Ga0075368_10092565 3300006042 Bacteria 1237
105 Ga0070715_10156532 3300006163 Bacteria 1122
106 Ga0075362_10146582 3300006177 Bacteria 1130
107 Ga0075366_10378336 3300006195 Bacteria 870
108 Ga0097621_100063199 3300006237 Bacteria 3042
109 Ga0097621_100618217 3300006237 Bacteria 992
110 Ga0097621_101422494 3300006237 Bacteria 657
111 Ga0068871_100324053 3300006358 Bacteria 1357
112 Ga0068871_100337450 3300006358 Bacteria 1330
113 Ga0068871_100431755 3300006358 Bacteria 1178
114 Ga0068865_100003066 3300006881 Bacteria 9995
115 Ga0068865_100184552 3300006881 Bacteria 1609
116 Ga0097620_100071564 3300006931 Bacteria 3504
117 Ga0105240_10000132 3300009093 Bacteria 152512
118 Ga0105245_10048697 3300009098 Bacteria 3791
119 Ga0105245_12163004 3300009098 Bacteria 610
120 Ga0105242_12041834 3300009176 Bacteria 616
121 Ga0105248_10009986 3300009177 Bacteria 10450
122 Ga0105248_10952839 3300009177 Bacteria 969
123 Ga0105237_10219022 3300009545 Bacteria 1904
124 Ga0105238_10021900 3300009551 Bacteria 6512
125 Ga0105249_10030933 3300009553 Bacteria 4839
126 Ga0105249_10035939 3300009553 Bacteria 4494
127 Ga0105239_10054986 3300010375 Bacteria 4366
128 Ga0105239_10060277 3300010375 Bacteria 4165
129 Ga0157369_10030339 3300013105 Bacteria 5964
130 Ga0157374_10021541 3300013296 Bacteria 5738
131 Ga0157374_12483447 3300013296 Bacteria 546
132 Ga0163162_10003811 3300013306 Bacteria 14456
133 Ga0163162_10053794 3300013306 Bacteria 4047
134 Ga0163162_10840432 3300013306 Bacteria 1034
135 Ga0157375_10003084 3300013308 Bacteria 14466
136 Ga0157375_10307917 3300013308 Bacteria 1748
137 Ga0157375_10610316 3300013308 Bacteria 1250
138 Ga0157375_10962953 3300013308 Bacteria 995
139 Ga0157375_13260785 3300013308 Bacteria 541
140 Ga0163163_10000676 3300014325 Bacteria 29151
141 Ga0163163_10126173 3300014325 Bacteria 2597
142 Ga0157380_10035189 3300014326 Bacteria 3867
143 Ga0157380_10054690 3300014326 Bacteria 3168
144 Ga0157380_10725633 3300014326 Bacteria 1002
145 Ga0157380_11384147 3300014326 Bacteria 753
146 Ga0157377_10740193 3300014745 Bacteria 718
147 Ga0157379_10004997 3300014968 Bacteria 11384
148 Ga0157379_10021595 3300014968 Bacteria 5700
149 Ga0157379_10993943 3300014968 Bacteria 800
150 Ga0157376_10034232 3300014969 Bacteria 4100
151 Ga0207666_1070313 3300025271 Bacteria 563
152 Ga0209130_1024768 3300025284 Bacteria 1306
153 Ga0209675_1005129 3300025291 Bacteria 5576
154 Ga0209676_1023445 3300025292 Bacteria 2020
155 Ga0209051_1023875 3300025303 Bacteria 2531
156 Ga0207697_10072322 3300025315 Bacteria 1446
157 Ga0207697_10474798 3300025315 Bacteria 553
158 Ga0207656_10070836 3300025321 Bacteria 1549
159 Ga0207682_10120649 3300025893 Bacteria 1162
160 Ga0207682_10154401 3300025893 Bacteria 1037
161 Ga0207682_10158039 3300025893 Bacteria 1026
162 Ga0207692_10145001 3300025898 Bacteria 1354
163 Ga0207642_10004494 3300025899 Bacteria 4502
164 Ga0207688_10106484 3300025901 Bacteria 1624
165 Ga0207680_10001093 3300025903 Bacteria 12807
166 Ga0207680_10014161 3300025903 Bacteria 4118
167 Ga0207647_10172729 3300025904 Bacteria 1258
168 Ga0207685_10022538 3300025905 Bacteria 2130
169 Ga0207685_10700641 3300025905 Bacteria 551
170 Ga0207645_10010500 3300025907 Bacteria 6359
171 Ga0207645_10035564 3300025907 Bacteria 3198
172 Ga0207645_10304286 3300025907 Bacteria 1062
173 Ga0207643_10415422 3300025908 Bacteria 852
174 Ga0207705_10299766 3300025909 Bacteria 1233
175 Ga0207684_10410611 3300025910 Bacteria 1164
176 Ga0207695_10000003 3300025913 Bacteria 1368691
177 Ga0207662_10001423 3300025918 Bacteria 11605
178 Ga0207662_10170326 3300025918 Bacteria 1396
179 Ga0207657_10098668 3300025919 Bacteria 2427
180 Ga0207649_10308833 3300025920 Bacteria 1158
181 Ga0207649_10339972 3300025920 Bacteria 1108
182 Ga0207649_10438080 3300025920 Bacteria 984
183 Ga0207652_11449945 3300025921 Bacteria 590
184 Ga0207646_10220669 3300025922 Bacteria 1713
185 Ga0207681_10000893 3300025923 Bacteria 19479
186 Ga0207681_10025411 3300025923 Bacteria 3809
187 Ga0207694_10000016 3300025924 Bacteria 349087
188 Ga0207650_10002227 3300025925 Bacteria 13538
189 Ga0207650_11108015 3300025925 Bacteria 674
190 Ga0207659_10003689 3300025926 Bacteria 9233
191 Ga0207659_10262927 3300025926 Bacteria 1404
192 Ga0207659_10419034 3300025926 Bacteria 1123
193 Ga0207659_10425604 3300025926 Bacteria 1114
194 Ga0207664_10100293 3300025929 Bacteria 2391
195 Ga0207644_10000895 3300025931 Bacteria 18853
196 Ga0207644_10168635 3300025931 Bacteria 1707
197 Ga0207644_10849026 3300025931 Bacteria 764
198 Ga0207644_10946429 3300025931 Bacteria 722
199 Ga0207644_11054517 3300025931 Bacteria 683
200 Ga0207706_10280871 3300025933 Bacteria 1452
201 Ga0207706_10359255 3300025933 Bacteria 1265
202 Ga0207706_10397797 3300025933 Bacteria 1195
203 Ga0207670_10004635 3300025936 Bacteria 7446
204 Ga0207670_10351860 3300025936 Bacteria 1167
205 Ga0207669_10345050 3300025937 Bacteria 1148
206 Ga0207704_10082356 3300025938 Bacteria 2084
207 Ga0207665_10061903 3300025939 Bacteria 2538
208 Ga0207691_10182848 3300025940 Bacteria 1831
209 Ga0207691_10183273 3300025940 Bacteria 1829
210 Ga0207691_10404610 3300025940 Bacteria 1164
211 Ga0207691_10429701 3300025940 Bacteria 1125
212 Ga0207691_10440081 3300025940 Bacteria 1110
213 Ga0207691_10709832 3300025940 Bacteria 848
214 Ga0207711_10052995 3300025941 Bacteria 3478
215 Ga0207711_10762216 3300025941 Bacteria 902
216 Ga0207689_10010552 3300025942 Bacteria 7954
217 Ga0207689_10060883 3300025942 Bacteria 3104
218 Ga0207679_10588099 3300025945 Bacteria 1002
219 Ga0207667_10000021 3300025949 Bacteria 370524
220 Ga0207651_10001789 3300025960 Bacteria 9991
221 Ga0207651_10278367 3300025960 Bacteria 1381
222 Ga0207651_10558263 3300025960 Bacteria 996
223 Ga0207712_10025071 3300025961 Bacteria 3958
224 Ga0207712_10142375 3300025961 Bacteria 1842
225 Ga0207668_10076402 3300025972 Bacteria 2411
226 Ga0207640_10123497 3300025981 Bacteria 1860
227 Ga0207658_10001920 3300025986 Bacteria 15518
228 Ga0207658_10007397 3300025986 Bacteria 7488
229 Ga0207658_10459609 3300025986 Bacteria 1128
230 Ga0207677_10003981 3300026023 Bacteria 7880
231 Ga0207677_10447568 3300026023 Bacteria 1106
232 Ga0207677_10589051 3300026023 Bacteria 974
233 Ga0207703_10002935 3300026035 Bacteria 14503
234 Ga0207703_10004468 3300026035 Bacteria 11486
235 Ga0207639_10229016 3300026041 Bacteria 1610
236 Ga0207639_10856688 3300026041 Bacteria 848
237 Ga0207678_10024964 3300026067 Bacteria 5220
238 Ga0207708_10032460 3300026075 Bacteria 3965
239 Ga0207708_10403168 3300026075 Bacteria 1131
240 Ga0207702_10622002 3300026078 Bacteria 1061
241 Ga0207641_10002852 3300026088 Bacteria 15708
242 Ga0207641_10003345 3300026088 Bacteria 14255
243 Ga0207648_10032750 3300026089 Bacteria 4587
244 Ga0207648_10043853 3300026089 Bacteria 3926
245 Ga0207676_10006414 3300026095 Bacteria 8312
246 Ga0207676_10274719 3300026095 Bacteria 1527
247 Ga0207676_10743043 3300026095 Bacteria 954
248 Ga0207675_100039414 3300026118 Bacteria 4409
249 Ga0207675_100213519 3300026118 Bacteria 1857
250 Ga0207675_100289046 3300026118 Bacteria 1594
251 Ga0207683_10302038 3300026121 Bacteria 1465
252 Ga0207683_10460266 3300026121 Bacteria 1173
253 Ga0207683_10563258 3300026121 Bacteria 1054
254 Ga0207683_10628364 3300026121 Bacteria 995
255 Ga0207698_10010123 3300026142 Bacteria 6040
256 Ga0207698_10156857 3300026142 Bacteria 1985
257 Ga0207698_10178271 3300026142 Bacteria 1879
258 Ga0207698_10327218 3300026142 Bacteria 1438
259 Ga0207698_11226518 3300026142 Bacteria 764
260 Ga0209995_1005880 3300027471 Bacteria 1975
261 Ga0209983_1040234 3300027665 Bacteria 1010
262 Ga0209813_10141721 3300027866 Bacteria 854
263 Ga0268265_10125441 3300028380 Bacteria 2123
264 Ga0268264_10002432 3300028381 Bacteria 16381
265 Ga0268264_10143098 3300028381 Bacteria 2135
266 Ga0265334_10124394 3300028573 Bacteria 920
267 Ga0265330_10000014 3300031235 Bacteria 175673
268 Ga0265332_10000011 3300031238 Bacteria 284299
269 Ga0265320_10224390 3300031240 Bacteria 836
270 Ga0265325_10026795 3300031241 Bacteria 3119
271 Ga0265340_10032358 3300031247 Bacteria 2611
272 Ga0265340_10154276 3300031247 Bacteria 1045
273 Ga0307513_10550880 3300031456 Bacteria 866
274 Ga0265314_10000026 3300031711 Bacteria 284299
275 Ga0265314_10186721 3300031711 Bacteria 1237
276 Ga0265342_10030212 3300031712 Bacteria 3359
277 Ga0307516_10050762 3300031730 Bacteria 4068
278 Ga0307406_10810713 3300031901 Bacteria 791
279 Ga0307412_10569838 3300031911 Bacteria 954
280 Ga0307414_10942005 3300032004 Bacteria 793
281 Ga0307411_10149131 3300032005 Bacteria 1736
282 Ga0373944_0196647 3300035089 Bacteria 729
283 Ga0373923_0120136 3300035111 Bacteria 1174
284 Ga0373936_0168091 3300035113 Bacteria 958
285 Ga0373945_0021627 3300035116 Bacteria 2211
286 Ga0373953_0125109 3300035117 Bacteria 1094
287 Ga0373954_0570502 3300035118 Bacteria 561
288 Ga0373943_0004886 3300035170 Bacteria 6058
289 Ga0373946_0008594 3300035171 Bacteria 3748
290 Ga0373946_0392138 3300035171 Bacteria 700
291 Ga0373955_0585296 3300035172 Bacteria 683
292 Ga0373924_0228145 3300035410 Bacteria 823
293 Ga0373935_0051871 3300035692 Bacteria 2606
294 Ga0373935_0063821 3300035692 Bacteria 2361
295 Ga0373927_0268893 3300035695 Bacteria 1121
296 Ga0373927_0535185 3300035695 Bacteria 774
297 Ga0373933_0352061 3300035724 Bacteria 957
298 Ga0373933_0579210 3300035724 Bacteria 737
299 Ga0373947_0024892 3300035725 Bacteria 3490
300 Ga0373947_0074086 3300035725 Bacteria 2094
301 Ga0373947_0818795 3300035725 Bacteria 636
302 Ga0373937_0826551 3300036401 Bacteria 875
303 Ga0373937_0897000 3300036401 Bacteria 835
304 Ga0373925_0001803 3300037068 Bacteria 17861
305 Ga0373925_0039527 3300037068 Bacteria 3490
306 Ga0373925_0210533 3300037068 Bacteria 1549
307 Ga0436365_1163316 3300039437 Bacteria 506
308 Ga0451789_1010449 3300041443 Bacteria 905
309 Ga0466969_0078595 3300044656 Bacteria 1577
310 Ga0466966_0003381 3300044684 Bacteria 10519
311 Ga0466961_0029241 3300044693 Bacteria 3543
312 Ga0453684_0158789 3300044712 Bacteria 2677
313 Ga0466968_0013592 3300044735 Bacteria 3201
314 Ga0466959_0157371 3300045049 Bacteria 1598
315 Ga0495629_0047248 3300046459 Bacteria 3019
316 Ga0495639_0337141 3300046475 Bacteria 756
317 Ga0495628_0294214 3300046516 Bacteria 1203
318 Ga0495628_0528661 3300046516 Bacteria 849
319 Ga0495630_0753686 3300046517 Bacteria 744
320 Ga0495652_0045448 3300046529 Bacteria 3775
321 Ga0495586_0211410 3300046535 Bacteria 1101
322 Ga0495645_0084958 3300046543 Bacteria 2266
323 Ga0495645_0221523 3300046543 Bacteria 1272
324 Ga0495634_0452191 3300046642 Bacteria 758
325 Ga0495647_0010028 3300046681 Bacteria 3220
326 Ga0495658_0143433 3300046683 Bacteria 1462
327 Ga0495658_0278859 3300046683 Bacteria 1055
328 Ga0495613_0104979 3300046689 Bacteria 2040
329 Ga0495674_0053855 3300047319 Bacteria 3535
330 Ga0495674_0324730 3300047319 Bacteria 1253
331 Ga0495672_0384279 3300047320 Bacteria 645
332 Ga0495684_0120946 3300047471 Bacteria 1972
333 Ga0496100_0332599 3300048903 Bacteria 1144
334 Ga0496101_0607499 3300048904 Bacteria 865
335 Ga0496104_0423617 3300048907 Bacteria 1243
336 Ga0496105_0058679 3300048908 Bacteria 3176
337 Ga0496105_0277610 3300048908 Bacteria 1352
338 Ga0496108_0956543 3300048911 Bacteria 733
339 Ga0496110_0195100 3300048913 Bacteria 1839
340 Ga0496114_0052541 3300048917 Bacteria 3395
341 Ga0496114_0352418 3300048917 Bacteria 1302
342 Ga0496115_0477219 3300048918 Bacteria 1005
343 Ga0496126_1223435 3300048929 Bacteria 551
344 Ga0495682_0004183 3300049460 Bacteria 6249
345 Ga0495682_0169818 3300049460 Bacteria 776
346 Ga0501031_0043142 3300049568 Bacteria 2944
347 Ga0501032_0000012 3300049569 Bacteria 193329
348 Ga0501032_0037013 3300049569 Bacteria 3329
349 Ga0501032_0403889 3300049569 Unclassified 877
350 Ga0501034_0000001 3300049571 Bacteria 2184493
351 Ga0501034_0010687 3300049571 Bacteria 9535
352 Ga0501034_0115941 3300049571 Bacteria 2667
353 Ga0501036_0031732 3300049572 Bacteria 4464
354 Ga0501036_1074100 3300049572 Bacteria 658
355 Ga0501037_0263569 3300049573 Bacteria 1204
356 Ga0501038_0601957 3300049574 Unclassified 831
357 Ga0501039_0000020 3300049575 Bacteria 162656
358 Ga0501040_0566847 3300049576 Bacteria 820
359 Ga0501046_0241377 3300049580 Bacteria 1332
360 Ga0501047_0021145 3300049581 Bacteria 6248
361 Ga0501048_0004226 3300049582 Bacteria 10946
362 Ga0501069_0006676 3300049585 Bacteria 6039
363 Ga0501070_0075299 3300049586 Bacteria 2794
364 Ga0501072_0617811 3300049588 Bacteria 854
365 Ga0501073_0049385 3300049589 Bacteria 2950
366 Ga0501073_0174086 3300049589 Bacteria 1490
367 Ga0501074_0069003 3300049590 Bacteria 2541
368 Ga0501079_0034653 3300049741 Bacteria 3884
369 Ga0501080_0083838 3300049742 Bacteria 2961
370 Ga0501080_0757158 3300049742 Bacteria 854
371 Ga0501083_0493422 3300049744 Bacteria 797
372 Ga0501035_0019767 3300049822 Bacteria 6187
373 Ga0501035_0046724 3300049822 Bacteria 3894
374 Ga0501035_0362667 3300049822 Bacteria 1211
375 Ga0501044_0022320 3300049823 Bacteria 6745
376 Ga0501044_0091648 3300049823 Bacteria 3066
377 nmdc:mga03683_111451_c1 3300050489 Bacteria 1210
378 nmdc:mga0yw44_170718_c1 3300050492 Bacteria 1428
379 nmdc:mga0k408_20227_c1 3300050493 Bacteria 3726
380 Ga0495601_0026809 3300053077 Bacteria 3560
381 Ga0495601_0417683 3300053077 Bacteria 869
382 Ga0495619_0057471 3300053085 Bacteria 2582
383 Ga0500595_044585 3300053119 Bacteria 1404
384 Ga0500655_020878 3300053133 Bacteria 1225
385 Ga0500655_047493 3300053133 Bacteria 851
386 Ga0500616_0007404 3300053153 Bacteria 6986
387 Ga0501084_0007984 3300054114 Bacteria 8713
388 Ga0466962_0188655 3300061719 Bacteria 1006
389 2585392812 2582581866 Bacteria 6859583
390 2644338916 2643221660 Bacteria 4208257
391 Ga0501034_0872540
392 JGI25155J39150_1000008
393 Ga0055540_1074742
394 Ga0070658_10204292
395 Ga0070676_10012480
396 Ga0070676_10068940
397 Ga0070676_10419408
398 Ga0070676_10582524
399 Ga0070690_100016924
400 Ga0070690_100268084
401 Ga0070670_100043568
402 Ga0070670_100049622
403 Ga0070670_100163979
404 Ga0070670_100207872
405 Ga0070670_100413004
406 Ga0070677_10148076
407 Ga0070677_10227282
408 Ga0068869_100483145
409 Ga0070666_10003262
410 Ga0070666_10111684
411 Ga0068868_100046103
412 Ga0070689_100007984
413 Ga0070689_100264090
414 Ga0070687_100003820
415 Ga0070687_100199005
416 Ga0070687_100840800
417 Ga0070661_100487260
418 Ga0070661_100684550
419 Ga0070661_101238525
420 Ga0070668_100005186
421 Ga0070668_102148808
422 Ga0070669_100004897
423 Ga0070669_100364643
424 Ga0070669_100876441
425 Ga0070675_100004224
426 Ga0070675_100047100
427 Ga0070675_100258090
428 Ga0070675_100403660
429 Ga0070675_100425809
430 Ga0070671_100004652
431 Ga0070671_100183633
432 Ga0070674_100123826
433 Ga0070674_101259422
434 Ga0070673_100004349
435 Ga0070673_100835601
436 Ga0070688_100148344
437 Ga0070659_101145227
438 Ga0070667_100025867
439 Ga0070667_100355720
440 Ga0070710_10559468
441 Ga0070701_10096791
442 Ga0070700_100028172
443 Ga0070678_100209190
444 Ga0070678_100231518
445 Ga0070678_100248852
446 Ga0070678_100424725
447 Ga0070678_100745004
448 Ga0070662_100004259
449 Ga0070662_100050265
450 Ga0068867_100183647
451 Ga0068867_100968453
452 Ga0070706_100310480
453 Ga0070699_100587454
454 Ga0070672_100025955
455 Ga0070672_100049245
456 Ga0070672_100052399
457 Ga0070672_100406486
458 Ga0070672_100642449
459 Ga0070672_100760952
460 Ga0070693_100362068
461 Ga0070693_100622512
462 Ga0070665_100661296
463 Ga0068855_100000024
464 Ga0070664_100423474
465 Ga0070664_100496485
466 Ga0070664_101013503
467 Ga0068854_100382252
468 Ga0068854_100460454
469 Ga0068854_100476972
470 Ga0068852_100213835
471 Ga0068852_100225045
472 Ga0068852_100961023
473 Ga0068859_100071566
474 Ga0068864_100001212
475 Ga0068864_100443330
476 Ga0068864_100490530
477 Ga0068866_10005162
478 Ga0068866_10259299
479 Ga0068861_100002269
480 Ga0068861_100078100
481 Ga0068861_101113093
482 Ga0068851_10185872
483 Ga0068870_10417853
484 Ga0068870_10584331
485 Ga0068863_100006407
486 Ga0068863_100396432
487 Ga0068858_100001935
488 Ga0068858_100002260
489 Ga0068860_100000605
490 Ga0068860_100481719
491 Ga0068862_100012678
492 Ga0068862_100028887
493 Ga0075365_10028707
494 Ga0075368_10092565
495 Ga0070715_10156532
496 Ga0075362_10146582
497 Ga0075366_10378336
498 Ga0097621_100063199
499 Ga0097621_100618217
500 Ga0097621_101422494
501 Ga0068871_100324053
502 Ga0068871_100337450
503 Ga0068871_100431755
504 Ga0068865_100003066
505 Ga0068865_100184552
506 Ga0097620_100071564
507 Ga0105240_10000132
508 Ga0105245_10048697
509 Ga0105245_12163004
510 Ga0105242_12041834
511 Ga0105248_10009986
512 Ga0105248_10952839
513 Ga0105237_10219022
514 Ga0105238_10021900
515 Ga0105249_10030933
516 Ga0105249_10035939
517 Ga0105239_10054986
518 Ga0105239_10060277
519 Ga0157369_10030339
520 Ga0157374_10021541
521 Ga0157374_12483447
522 Ga0163162_10003811
523 Ga0163162_10053794
524 Ga0163162_10840432
525 Ga0157375_10003084
526 Ga0157375_10307917
527 Ga0157375_10610316
528 Ga0157375_10962953
529 Ga0157375_13260785
530 Ga0163163_10000676
531 Ga0163163_10126173
532 Ga0157380_10035189
533 Ga0157380_10054690
534 Ga0157380_10725633
535 Ga0157380_11384147
536 Ga0157377_10740193
537 Ga0157379_10004997
538 Ga0157379_10021595
539 Ga0157379_10993943
540 Ga0157376_10034232
541 Ga0207666_1070313
542 Ga0209130_1024768
543 Ga0209675_1005129
544 Ga0209676_1023445
545 Ga0209051_1023875
546 Ga0207697_10072322
547 Ga0207697_10474798
548 Ga0207656_10070836
549 Ga0207682_10120649
550 Ga0207682_10154401
551 Ga0207682_10158039
552 Ga0207692_10145001
553 Ga0207642_10004494
554 Ga0207688_10106484
555 Ga0207680_10001093
556 Ga0207680_10014161
557 Ga0207647_10172729
558 Ga0207685_10022538
559 Ga0207685_10700641
560 Ga0207645_10010500
561 Ga0207645_10035564
562 Ga0207645_10304286
563 Ga0207643_10415422
564 Ga0207705_10299766
565 Ga0207684_10410611
566 Ga0207695_10000003
567 Ga0207662_10001423
568 Ga0207662_10170326
569 Ga0207657_10098668
570 Ga0207649_10308833
571 Ga0207649_10339972
572 Ga0207649_10438080
573 Ga0207652_11449945
574 Ga0207646_10220669
575 Ga0207681_10000893
576 Ga0207681_10025411
577 Ga0207694_10000016
578 Ga0207650_10002227
579 Ga0207650_11108015
580 Ga0207659_10003689
581 Ga0207659_10262927
582 Ga0207659_10419034
583 Ga0207659_10425604
584 Ga0207664_10100293
585 Ga0207644_10000895
586 Ga0207644_10168635
587 Ga0207644_10849026
588 Ga0207644_10946429
589 Ga0207644_11054517
590 Ga0207706_10280871
591 Ga0207706_10359255
592 Ga0207706_10397797
593 Ga0207670_10004635
594 Ga0207670_10351860
595 Ga0207669_10345050
596 Ga0207704_10082356
597 Ga0207665_10061903
598 Ga0207691_10182848
599 Ga0207691_10183273
600 Ga0207691_10404610
601 Ga0207691_10429701
602 Ga0207691_10440081
603 Ga0207691_10709832
604 Ga0207711_10052995
605 Ga0207711_10762216
606 Ga0207689_10010552
607 Ga0207689_10060883
608 Ga0207679_10588099
609 Ga0207667_10000021
610 Ga0207651_10001789
611 Ga0207651_10278367
612 Ga0207651_10558263
613 Ga0207712_10025071
614 Ga0207712_10142375
615 Ga0207668_10076402
616 Ga0207640_10123497
617 Ga0207658_10001920
618 Ga0207658_10007397
619 Ga0207658_10459609
620 Ga0207677_10003981
621 Ga0207677_10447568
622 Ga0207677_10589051
623 Ga0207703_10002935
624 Ga0207703_10004468
625 Ga0207639_10229016
626 Ga0207639_10856688
627 Ga0207678_10024964
628 Ga0207708_10032460
629 Ga0207708_10403168
630 Ga0207702_10622002
631 Ga0207641_10002852
632 Ga0207641_10003345
633 Ga0207648_10032750
634 Ga0207648_10043853
635 Ga0207676_10006414
636 Ga0207676_10274719
637 Ga0207676_10743043
638 Ga0207675_100039414
639 Ga0207675_100213519
640 Ga0207675_100289046
641 Ga0207683_10302038
642 Ga0207683_10460266
643 Ga0207683_10563258
644 Ga0207683_10628364
645 Ga0207698_10010123
646 Ga0207698_10156857
647 Ga0207698_10178271
648 Ga0207698_10327218
649 Ga0207698_11226518
650 Ga0209995_1005880
651 Ga0209983_1040234
652 Ga0209813_10141721
653 Ga0268265_10125441
654 Ga0268264_10002432
655 Ga0268264_10143098
656 Ga0265334_10124394
657 Ga0265330_10000014
658 Ga0265332_10000011
659 Ga0265320_10224390
660 Ga0265325_10026795
661 Ga0265340_10032358
662 Ga0265340_10154276
663 Ga0307513_10550880
664 Ga0265314_10000026
665 Ga0265314_10186721
666 Ga0265342_10030212
667 Ga0307516_10050762
668 Ga0307406_10810713
669 Ga0307412_10569838
670 Ga0307414_10942005
671 Ga0307411_10149131
672 Ga0373944_0196647
673 Ga0373923_0120136
674 Ga0373936_0168091
675 Ga0373945_0021627
676 Ga0373953_0125109
677 Ga0373954_0570502
678 Ga0373943_0004886
679 Ga0373946_0008594
680 Ga0373946_0392138
681 Ga0373955_0585296
682 Ga0373924_0228145
683 Ga0373935_0051871
684 Ga0373935_0063821
685 Ga0373927_0268893
686 Ga0373927_0535185
687 Ga0373933_0352061
688 Ga0373933_0579210
689 Ga0373947_0024892
690 Ga0373947_0074086
691 Ga0373947_0818795
692 Ga0373937_0826551
693 Ga0373937_0897000
694 Ga0373925_0001803
695 Ga0373925_0039527
696 Ga0373925_0210533
697 Ga0436365_1163316
698 Ga0451789_1010449
699 Ga0466969_0078595
700 Ga0466966_0003381
701 Ga0466961_0029241
702 Ga0453684_0158789
703 Ga0466968_0013592
704 Ga0466959_0157371
705 Ga0495629_0047248
706 Ga0495639_0337141
707 Ga0495628_0294214
708 Ga0495628_0528661
709 Ga0495630_0753686
710 Ga0495652_0045448
711 Ga0495586_0211410
712 Ga0495645_0084958
713 Ga0495645_0221523
714 Ga0495634_0452191
715 Ga0495647_0010028
716 Ga0495658_0143433
717 Ga0495658_0278859
718 Ga0495613_0104979
719 Ga0495674_0053855
720 Ga0495674_0324730
721 Ga0495672_0384279
722 Ga0495684_0120946
723 Ga0496100_0332599
724 Ga0496101_0607499
725 Ga0496104_0423617
726 Ga0496105_0058679
727 Ga0496105_0277610
728 Ga0496108_0956543
729 Ga0496110_0195100
730 Ga0496114_0052541
731 Ga0496114_0352418
732 Ga0496115_0477219
733 Ga0496126_1223435
734 Ga0495682_0004183
735 Ga0495682_0169818
736 Ga0501031_0043142
737 Ga0501032_0000012
738 Ga0501032_0037013
739 Ga0501032_0403889
740 Ga0501034_0000001
741 Ga0501034_0010687
742 Ga0501034_0115941
743 Ga0501036_0031732
744 Ga0501036_1074100
745 Ga0501037_0263569
746 Ga0501038_0601957
747 Ga0501039_0000020
748 Ga0501040_0566847
749 Ga0501046_0241377
750 Ga0501047_0021145
751 Ga0501048_0004226
752 Ga0501069_0006676
753 Ga0501070_0075299
754 Ga0501072_0617811
755 Ga0501073_0049385
756 Ga0501073_0174086
757 Ga0501074_0069003
758 Ga0501079_0034653
759 Ga0501080_0083838
760 Ga0501080_0757158
761 Ga0501083_0493422
762 Ga0501035_0019767
763 Ga0501035_0046724
764 Ga0501035_0362667
765 Ga0501044_0022320
766 Ga0501044_0091648
767 nmdc:mga03683_111451_c1
768 nmdc:mga0yw44_170718_c1
769 nmdc:mga0k408_20227_c1
770 Ga0495601_0026809
771 Ga0495601_0417683
772 Ga0495619_0057471
773 Ga0500595_044585
774 Ga0500655_020878
775 Ga0500655_047493
776 Ga0500616_0007404
777 Ga0501084_0007984
778 Ga0466962_0188655
779 2585392812
780 2644338916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

16

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kz1-assembly1.cif.gz_C mutant enzyme w27g lumazine synthase from s.pombe 0.9686 12 147
1c41-assembly1.cif.gz_A crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly 0.9657 11 147
1kz9-assembly1.cif.gz_E mutant enzyme l119f lumazine synthase from s.pombe 0.965 11 147
4v7g-assembly1.cif.gz_AA crystal structure of lumazine synthase from bacillus anthracis 0.9648 12 147
1kz6-assembly1.cif.gz_E mutant enzyme w63y/l119f lumazine synthase from s.pombe 0.9636 11 147
ID Description Score Start End Superfamily
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9582 12 147 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.957 11 152 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.957 11 154 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9429 17 153 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9413 11 147 3.40.50.960
ID Description Score Start End GO Terms
AF-M1MD69-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9878 12 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-M1LU62-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9867 12 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A7C9GTY9-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9859 12 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A519F3S4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9854 14 154 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A494Y927-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9853 12 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Map