F431783

General Info

Members Datasets Scaffolds Average Seq Length
390 194 780 212

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0150520|Ga0395898_0150520_777_1502
Length 241
Sequence MRSTLGGVGYAGYADGNRLPKIAITTGGGGQTMAGKQRISYVPLADMTAEMRAEMDRCAREGTPRPESSAVRAHVPAAFWFFANSWNDLFRNGVCDHAIKELCRVYISRSVKCEYCGNQRSEKGKALGLVEGQYDELLNFESSPNFSDRQKAALAYAEAIAWHLDTDDAFWERLHGHFSEPELVELGCAIGLTLGQQSWIRLLNIEHHEVMAGDSASMAPGFETADALRDSKASDKYWARA

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 16.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0150520 3300037466 Bacteria 2227
2 JGI25407J50210_10000785 3300003373 Bacteria 6714
3 JGI25407J50210_10006433 3300003373 Bacteria 2925
4 JGI25407J50210_10009912 3300003373 Bacteria 2419
5 JGI25407J50210_10051968 3300003373 Bacteria 1037
6 JGI25407J50210_10062212 3300003373 Bacteria 937
7 Ga0065704_10033852 3300005289 Bacteria 1094
8 Ga0065704_10307789 3300005289 Bacteria 874
9 Ga0065707_10007633 3300005295 Bacteria 2625
10 Ga0070683_100256226 3300005329 Unclassified 1664
11 Ga0070670_100136417 3300005331 Bacteria 2120
12 Ga0070677_10002834 3300005333 Bacteria 5557
13 Ga0070677_10159255 3300005333 Bacteria 1058
14 Ga0068869_100169772 3300005334 Bacteria 1703
15 Ga0070666_10271978 3300005335 Unclassified 1203
16 Ga0068868_100228891 3300005338 Bacteria 1559
17 Ga0070687_100070096 3300005343 Bacteria 1879
18 Ga0070661_100026344 3300005344 Unclassified 4181
19 Ga0070675_100115713 3300005354 Bacteria 2273
20 Ga0070675_100615657 3300005354 Unclassified 985
21 Ga0070671_100085899 3300005355 Bacteria 2632
22 Ga0070674_100131703 3300005356 Unclassified 1865
23 Ga0070673_100108726 3300005364 Bacteria 2296
24 Ga0070673_100134296 3300005364 Unclassified 2081
25 Ga0070688_100280141 3300005365 Bacteria 1197
26 Ga0070688_100575278 3300005365 Bacteria 859
27 Ga0070659_100288676 3300005366 Bacteria 1366
28 Ga0070667_100290320 3300005367 Unclassified 1470
29 Ga0070714_100028164 3300005435 Bacteria 4658
30 Ga0070714_100221123 3300005435 Unclassified 1740
31 Ga0070714_100276672 3300005435 Bacteria 1558
32 Ga0070713_100274551 3300005436 Bacteria 1545
33 Ga0070713_100372778 3300005436 Bacteria 1328
34 Ga0070713_101162027 3300005436 Unclassified 747
35 Ga0070701_10005553 3300005438 Bacteria 5219
36 Ga0070694_100133040 3300005444 Bacteria 1799
37 Ga0070663_100426525 3300005455 Unclassified 1089
38 Ga0070678_100107105 3300005456 Bacteria 2179
39 Ga0070662_100043892 3300005457 Unclassified 3201
40 Ga0068867_100092298 3300005459 Bacteria 2299
41 Ga0070706_100265607 3300005467 Bacteria 1602
42 Ga0070699_100009947 3300005518 Bacteria 8240
43 Ga0070684_100574947 3300005535 Bacteria 1047
44 Ga0070697_100015148 3300005536 Bacteria 6054
45 Ga0070697_100155819 3300005536 Bacteria 1928
46 Ga0068853_100069065 3300005539 Unclassified 3073
47 Ga0070672_100038978 3300005543 Unclassified 3635
48 Ga0070686_100097774 3300005544 Bacteria 1977
49 Ga0070695_100057066 3300005545 Bacteria 2522
50 Ga0070665_100625475 3300005548 Bacteria 1090
51 Ga0070664_100121841 3300005564 Unclassified 2284
52 Ga0070702_100024028 3300005615 Unclassified 3246
53 Ga0068852_100068849 3300005616 Unclassified 3099
54 Ga0068859_100928000 3300005617 Bacteria 954
55 Ga0068864_100074949 3300005618 Unclassified 2953
56 Ga0068861_100297443 3300005719 Bacteria 1396
57 Ga0068851_10080992 3300005834 Unclassified 1695
58 Ga0068870_10014007 3300005840 Bacteria 3779
59 Ga0068863_100195861 3300005841 Bacteria 1942
60 Ga0068858_100374157 3300005842 Unclassified 1366
61 Ga0081455_10000176 3300005937 Bacteria 80007
62 Ga0081455_10009202 3300005937 Bacteria 10177
63 Ga0081455_10280119 3300005937 Bacteria 1205
64 Ga0081538_10000009 3300005981 Bacteria 172017
65 Ga0081538_10000124 3300005981 Bacteria 78084
66 Ga0081538_10000443 3300005981 Bacteria 46582
67 Ga0081538_10000787 3300005981 Bacteria 34632
68 Ga0081538_10001377 3300005981 Bacteria 24951
69 Ga0081538_10001542 3300005981 Bacteria 23627
70 Ga0081538_10002098 3300005981 Bacteria 19865
71 Ga0081538_10003350 3300005981 Bacteria 15173
72 Ga0081538_10004302 3300005981 Bacteria 13164
73 Ga0081538_10005134 3300005981 Bacteria 11873
74 Ga0081538_10008777 3300005981 Bacteria 8520
75 Ga0081538_10013575 3300005981 Bacteria 6441
76 Ga0081538_10022453 3300005981 Bacteria 4570
77 Ga0081538_10026027 3300005981 Bacteria 4105
78 Ga0081538_10030758 3300005981 Bacteria 3637
79 Ga0081538_10038162 3300005981 Bacteria 3105
80 Ga0081540_1022446 3300005983 Bacteria 3727
81 Ga0070717_10011713 3300006028 Bacteria 6671
82 Ga0070717_10315508 3300006028 Bacteria 1392
83 Ga0097621_100037922 3300006237 Bacteria 3866
84 Ga0097621_100543739 3300006237 Unclassified 1056
85 Ga0068871_100136110 3300006358 Unclassified 2086
86 Ga0068871_100246304 3300006358 Bacteria 1555
87 Ga0075428_100342613 3300006844 Bacteria 1605
88 Ga0075428_100376594 3300006844 Bacteria 1522
89 Ga0075428_100387027 3300006844 Bacteria 1499
90 Ga0075430_100060395 3300006846 Bacteria 3186
91 Ga0075431_100014331 3300006847 Bacteria 8018
92 Ga0075431_100074260 3300006847 Bacteria 3509
93 Ga0075431_100082767 3300006847 Bacteria 3313
94 Ga0075429_100094154 3300006880 Bacteria 2613
95 Ga0075429_100406801 3300006880 Bacteria 1192
96 Ga0068865_100090524 3300006881 Bacteria 2218
97 Ga0075436_100129872 3300006914 Bacteria 1766
98 Ga0075436_100141026 3300006914 Bacteria 1694
99 Ga0097620_100928002 3300006931 Bacteria 954
100 Ga0099794_10020334 3300007265 Bacteria 3003
101 Ga0111539_10319839 3300009094 Unclassified 1806
102 Ga0111539_10792857 3300009094 Bacteria 1103
103 Ga0105247_10509745 3300009101 Bacteria 878
104 Ga0114129_10015528 3300009147 Bacteria 10827
105 Ga0114129_10100612 3300009147 Bacteria 4000
106 Ga0105243_10034960 3300009148 Bacteria 3895
107 Ga0105242_10077495 3300009176 Bacteria 2773
108 Ga0105242_10582647 3300009176 Bacteria 1078
109 Ga0105249_10208605 3300009553 Bacteria 1916
110 Ga0105246_10333318 3300011119 Bacteria 1237
111 Ga0157369_10621354 3300013105 Unclassified 1115
112 Ga0157374_10055149 3300013296 Bacteria 3708
113 Ga0157374_10060965 3300013296 Bacteria 3532
114 Ga0157378_10189929 3300013297 Bacteria 1937
115 Ga0157372_11019139 3300013307 Bacteria 959
116 Ga0157375_10100593 3300013308 Bacteria 2972
117 Ga0157375_10125520 3300013308 Unclassified 2681
118 Ga0157375_10916836 3300013308 Bacteria 1019
119 Ga0157380_10440518 3300014326 Unclassified 1248
120 Ga0157379_10544314 3300014968 Unclassified 1080
121 Ga0157376_10285213 3300014969 Bacteria 1557
122 Ga0163161_10342557 3300017792 Bacteria 1186
123 Ga0197907_10568972 3300020069 Bacteria 751
124 Ga0207697_10005071 3300025315 Bacteria 6169
125 Ga0207682_10001762 3300025893 Bacteria 9938
126 Ga0207688_10005820 3300025901 Bacteria 6710
127 Ga0207680_10091961 3300025903 Unclassified 1932
128 Ga0207699_10290538 3300025906 Bacteria 1139
129 Ga0207645_10180233 3300025907 Bacteria 1386
130 Ga0207643_10146175 3300025908 Bacteria 1414
131 Ga0207684_10045074 3300025910 Bacteria 3741
132 Ga0207663_10080180 3300025916 Bacteria 2133
133 Ga0207649_10050755 3300025920 Bacteria 2567
134 Ga0207646_10040696 3300025922 Bacteria 4179
135 Ga0207650_10243592 3300025925 Bacteria 1454
136 Ga0207659_10059384 3300025926 Unclassified 2749
137 Ga0207700_10267035 3300025928 Bacteria 1467
138 Ga0207700_10607907 3300025928 Bacteria 973
139 Ga0207664_10008644 3300025929 Bacteria 7118
140 Ga0207664_10055421 3300025929 Bacteria 3146
141 Ga0207644_10264159 3300025931 Bacteria 1377
142 Ga0207706_10133280 3300025933 Unclassified 2185
143 Ga0207709_10607715 3300025935 Bacteria 866
144 Ga0207669_10478027 3300025937 Unclassified 992
145 Ga0207691_10005400 3300025940 Bacteria 12340
146 Ga0207711_10391459 3300025941 Unclassified 1290
147 Ga0207689_10030353 3300025942 Bacteria 4505
148 Ga0207661_10201406 3300025944 Bacteria 1750
149 Ga0207679_10075754 3300025945 Bacteria 2554
150 Ga0207679_10191006 3300025945 Unclassified 1703
151 Ga0207651_10048664 3300025960 Bacteria 2867
152 Ga0207651_10184696 3300025960 Bacteria 1657
153 Ga0207639_10243382 3300026041 Bacteria 1565
154 Ga0207678_10422567 3300026067 Unclassified 1156
155 Ga0207708_10040906 3300026075 Bacteria 3535
156 Ga0207641_10051976 3300026088 Bacteria 3469
157 Ga0207641_10081177 3300026088 Unclassified 2816
158 Ga0207648_10024567 3300026089 Bacteria 5377
159 Ga0207648_10137041 3300026089 Bacteria 2156
160 Ga0207676_10007676 3300026095 Bacteria 7660
161 Ga0207676_10035402 3300026095 Unclassified 3789
162 Ga0207676_10047018 3300026095 Bacteria 3342
163 Ga0207675_100040346 3300026118 Bacteria 4359
164 Ga0207683_10035319 3300026121 Bacteria 4346
165 Ga0207698_10141601 3300026142 Bacteria 2073
166 Ga0207428_10089941 3300027907 Bacteria 2385
167 Ga0207428_10190113 3300027907 Bacteria 1548
168 Ga0268266_10078564 3300028379 Unclassified 2872
169 Ga0268265_10521351 3300028380 Bacteria 1123
170 Ga0268264_10450127 3300028381 Unclassified 1247
171 Ga0265318_10018520 3300028577 Bacteria 2839
172 Ga0265330_10009360 3300031235 Bacteria 4658
173 Ga0265328_10002045 3300031239 Bacteria 9119
174 Ga0265320_10025641 3300031240 Bacteria 3097
175 Ga0265329_10003912 3300031242 Bacteria 6373
176 Ga0265331_10008471 3300031250 Bacteria 5845
177 Ga0265314_10002102 3300031711 Bacteria 20958
178 Ga0265342_10047862 3300031712 Bacteria 2565
179 Ga0307405_10608039 3300031731 Bacteria 893
180 Ga0307413_10139295 3300031824 Bacteria 1674
181 Ga0307410_10054233 3300031852 Bacteria 2717
182 Ga0307410_10234134 3300031852 Bacteria 1420
183 Ga0307406_10045833 3300031901 Bacteria 2748
184 Ga0307407_10255540 3300031903 Bacteria 1203
185 Ga0307409_100262026 3300031995 Bacteria 1587
186 Ga0307409_100360863 3300031995 Bacteria 1374
187 Ga0307409_100587087 3300031995 Bacteria 1099
188 Ga0307409_100976472 3300031995 Bacteria 864
189 Ga0307409_101070580 3300031995 Bacteria 827
190 Ga0307416_100013382 3300032002 Bacteria 5573
191 Ga0307416_100027990 3300032002 Bacteria 4184
192 Ga0307416_100087944 3300032002 Bacteria 2655
193 Ga0307414_10389277 3300032004 Bacteria 1208
194 Ga0307414_10885431 3300032004 Bacteria 818
195 Ga0307415_100002219 3300032126 Bacteria 9618
196 Ga0307415_100633241 3300032126 Bacteria 956
197 Ga0373934_0059272 3300035086 Unclassified 1524
198 Ga0373943_0042436 3300035170 Bacteria 2205
199 Ga0373943_0313729 3300035170 Unclassified 893
200 Ga0373925_0122904 3300037068 Bacteria 2016
201 Ga0395899_0119519 3300037312 Bacteria 1889
202 Ga0395900_0005013 3300037418 Bacteria 13891
203 Ga0395900_0253721 3300037418 Bacteria 1759
204 Ga0395900_0303795 3300037418 Bacteria 1581
205 Ga0395898_0011083 3300037466 Bacteria 9387
206 Ga0395898_0233120 3300037466 Bacteria 1756
207 Ga0395898_0265401 3300037466 Bacteria 1637
208 Ga0395898_1032947 3300037466 Bacteria 757
209 Ga0395905_0015080 3300037471 Bacteria 7359
210 Ga0395901_0076028 3300038443 Bacteria 3503
211 Ga0395901_0086421 3300038443 Bacteria 3279
212 Ga0395901_0105545 3300038443 Bacteria 2957
213 Ga0395901_0126830 3300038443 Bacteria 2682
214 Ga0395901_0205469 3300038443 Bacteria 2064
215 Ga0395901_0406424 3300038443 Bacteria 1398
216 Ga0395901_0549991 3300038443 Bacteria 1170
217 Ga0395901_0594158 3300038443 Bacteria 1117
218 Ga0439463_077883 3300042016 Bacteria 851
219 Ga0466966_0435960 3300044684 Unclassified 788
220 Ga0466963_0059779 3300044694 Bacteria 2544
221 Ga0466959_0123332 3300045049 Bacteria 1840
222 Ga0466958_0040305 3300045836 Bacteria 2807
223 Ga0466967_0002085 3300045976 Bacteria 12244
224 Ga0495605_0066904 3300046474 Bacteria 1706
225 Ga0495639_0267642 3300046475 Unclassified 848
226 Ga0495584_0131697 3300046491 Bacteria 1269
227 Ga0495596_0153490 3300046500 Bacteria 894
228 Ga0495642_0065664 3300046528 Bacteria 1511
229 Ga0495621_0026352 3300046539 Bacteria 1961
230 Ga0495589_0308282 3300046794 Bacteria 733
231 Ga0496108_0198672 3300048911 Unclassified 1740
232 Ga0496109_0325048 3300048912 Unclassified 1452
233 Ga0496110_0262031 3300048913 Bacteria 1573
234 Ga0501031_0005327 3300049568 Bacteria 8376
235 Ga0501031_0007214 3300049568 Bacteria 7252
236 Ga0501031_0058185 3300049568 Bacteria 2519
237 Ga0501031_0353837 3300049568 Unclassified 951
238 Ga0501032_0038594 3300049569 Bacteria 3252
239 Ga0501032_0462424 3300049569 Unclassified 812
240 Ga0501033_0109861 3300049570 Unclassified 2008
241 Ga0501036_0006026 3300049572 Bacteria 9829
242 Ga0501036_0042181 3300049572 Bacteria 3863
243 Ga0501036_0101337 3300049572 Bacteria 2436
244 Ga0501037_0018981 3300049573 Bacteria 5068
245 Ga0501037_0174729 3300049573 Unclassified 1525
246 Ga0501037_0326437 3300049573 Bacteria 1062
247 Ga0501038_0003590 3300049574 Bacteria 14441
248 Ga0501038_0008897 3300049574 Bacteria 9214
249 Ga0501038_0222526 3300049574 Bacteria 1505
250 Ga0501038_0416447 3300049574 Bacteria 1037
251 Ga0501039_0001577 3300049575 Bacteria 16774
252 Ga0501039_0003134 3300049575 Bacteria 12367
253 Ga0501039_0007410 3300049575 Bacteria 8369
254 Ga0501039_0018344 3300049575 Bacteria 5370
255 Ga0501039_0041923 3300049575 Bacteria 3537
256 Ga0501039_0649440 3300049575 Bacteria 826
257 Ga0501039_0759751 3300049575 Bacteria 757
258 Ga0501040_0045979 3300049576 Bacteria 2979
259 Ga0501040_0056988 3300049576 Bacteria 2682
260 Ga0501040_0059501 3300049576 Bacteria 2625
261 Ga0501040_0170743 3300049576 Bacteria 1539
262 Ga0501040_0254590 3300049576 Bacteria 1253
263 Ga0501040_0565051 3300049576 Bacteria 821
264 Ga0501041_0002312 3300049577 Bacteria 10780
265 Ga0501041_0030344 3300049577 Unclassified 3262
266 Ga0501041_0031290 3300049577 Bacteria 3215
267 Ga0501041_0138538 3300049577 Bacteria 1517
268 Ga0501042_0006345 3300049578 Bacteria 7671
269 Ga0501042_0011812 3300049578 Bacteria 5900
270 Ga0501042_0043910 3300049578 Bacteria 3184
271 Ga0501042_0051170 3300049578 Bacteria 2947
272 Ga0501042_0125840 3300049578 Bacteria 1845
273 Ga0501042_0448950 3300049578 Bacteria 935
274 Ga0501046_0024164 3300049580 Bacteria 4989
275 Ga0501046_0064813 3300049580 Bacteria 2851
276 Ga0501048_0025729 3300049582 Bacteria 4287
277 Ga0501048_0031443 3300049582 Bacteria 3839
278 Ga0501048_0045278 3300049582 Bacteria 3143
279 Ga0501048_0128388 3300049582 Bacteria 1793
280 Ga0501068_0057316 3300049584 Unclassified 2362
281 Ga0501068_0103097 3300049584 Bacteria 1769
282 Ga0501068_0129531 3300049584 Bacteria 1577
283 Ga0501068_0329238 3300049584 Unclassified 980
284 Ga0501069_0034792 3300049585 Unclassified 2774
285 Ga0501069_0087725 3300049585 Bacteria 1758
286 Ga0501069_0181688 3300049585 Unclassified 1216
287 Ga0501070_0030825 3300049586 Bacteria 4492
288 Ga0501070_0075461 3300049586 Bacteria 2792
289 Ga0501071_0010693 3300049587 Bacteria 6156
290 Ga0501071_0032025 3300049587 Bacteria 3731
291 Ga0501071_0061243 3300049587 Bacteria 2725
292 Ga0501071_0080242 3300049587 Bacteria 2385
293 Ga0501071_0222713 3300049587 Bacteria 1420
294 Ga0501071_0422799 3300049587 Unclassified 1018
295 Ga0501072_0002166 3300049588 Bacteria 14668
296 Ga0501072_0014667 3300049588 Bacteria 6008
297 Ga0501072_0016362 3300049588 Bacteria 5692
298 Ga0501072_0030556 3300049588 Bacteria 4214
299 Ga0501072_0064618 3300049588 Bacteria 2886
300 Ga0501072_0102703 3300049588 Unclassified 2272
301 Ga0501072_0122475 3300049588 Bacteria 2072
302 Ga0501072_0224047 3300049588 Bacteria 1498
303 Ga0501072_0345813 3300049588 Unclassified 1181
304 Ga0501072_0417916 3300049588 Bacteria 1063
305 Ga0501073_0295473 3300049589 Bacteria 1118
306 Ga0501074_0000796 3300049590 Bacteria 19936
307 Ga0501074_0069335 3300049590 Bacteria 2535
308 Ga0501074_0128434 3300049590 Bacteria 1814
309 Ga0501074_0435070 3300049590 Bacteria 930
310 Ga0501075_0006162 3300049591 Bacteria 8241
311 Ga0501075_0008378 3300049591 Bacteria 7211
312 Ga0501075_0011158 3300049591 Bacteria 6349
313 Ga0501075_0025716 3300049591 Bacteria 4326
314 Ga0501075_0041868 3300049591 Bacteria 3433
315 Ga0501075_0054959 3300049591 Bacteria 2996
316 Ga0501075_0066023 3300049591 Bacteria 2730
317 Ga0501075_0200233 3300049591 Bacteria 1523
318 Ga0501075_0335332 3300049591 Bacteria 1152
319 Ga0501075_0614932 3300049591 Unclassified 829
320 Ga0501075_0840540 3300049591 Unclassified 698
321 Ga0501076_0003212 3300049592 Bacteria 11413
322 Ga0501076_0004792 3300049592 Bacteria 9653
323 Ga0501076_0046384 3300049592 Bacteria 3434
324 Ga0501076_0049252 3300049592 Bacteria 3331
325 Ga0501076_0064646 3300049592 Bacteria 2916
326 Ga0501076_0090167 3300049592 Bacteria 2465
327 Ga0501076_0406671 3300049592 Bacteria 1119
328 Ga0501077_0027293 3300049593 Unclassified 3626
329 Ga0501077_0035830 3300049593 Bacteria 3159
330 Ga0501077_0308824 3300049593 Unclassified 1008
331 Ga0501077_0361249 3300049593 Bacteria 927
332 Ga0501079_0003002 3300049741 Bacteria 12334
333 Ga0501079_0017676 3300049741 Bacteria 5446
334 Ga0501079_0030593 3300049741 Bacteria 4137
335 Ga0501079_0032915 3300049741 Bacteria 3987
336 Ga0501079_0101508 3300049741 Bacteria 2231
337 Ga0501079_0145193 3300049741 Bacteria 1849
338 Ga0501079_0164909 3300049741 Bacteria 1728
339 Ga0501079_0243163 3300049741 Bacteria 1406
340 Ga0501080_0008227 3300049742 Bacteria 9443
341 Ga0501080_0059537 3300049742 Bacteria 3554
342 Ga0501080_0590375 3300049742 Unclassified 987
343 Ga0501081_0005436 3300049743 Bacteria 8221
344 Ga0501081_0007915 3300049743 Bacteria 6894
345 Ga0501081_0039091 3300049743 Bacteria 3245
346 Ga0501081_0080959 3300049743 Bacteria 2274
347 Ga0501081_0104423 3300049743 Bacteria 2006
348 Ga0501081_0327212 3300049743 Bacteria 1127
349 Ga0501081_0590559 3300049743 Bacteria 831
350 Ga0501083_0047032 3300049744 Unclassified 2917
351 Ga0501083_0246452 3300049744 Bacteria 1163
352 Ga0501035_0017163 3300049822 Bacteria 6671
353 Ga0501035_0288753 3300049822 Bacteria 1385
354 Ga0501044_0476144 3300049823 Bacteria 1152
355 Ga0501045_0023163 3300049824 Bacteria 4450
356 Ga0501045_0083415 3300049824 Bacteria 2358
357 Ga0501045_0144757 3300049824 Bacteria 1767
358 Ga0501045_0147407 3300049824 Bacteria 1751
359 Ga0501045_0218204 3300049824 Bacteria 1420
360 nmdc:mga05p37_224264_c1 3300050507 Bacteria 2267
361 nmdc:mga05p37_345206_c1 3300050507 Bacteria 1754
362 nmdc:mga05p37_9467_c1 3300050507 Bacteria 11533
363 nmdc:mga09592_521754_c1 3300050508 Bacteria 1022
364 nmdc:mga0qj67_10196_c1 3300050509 Bacteria 7015
365 nmdc:mga0qj67_25958_c1 3300050509 Bacteria 4532
366 nmdc:mga06r32_158630_c1 3300050510 Bacteria 2244
367 nmdc:mga06r32_57056_c1 3300050510 Bacteria 3751
368 nmdc:mga06r32_580248_c1 3300050510 Bacteria 1093
369 nmdc:mga08y16_664480_c1 3300050511 Bacteria 1045
370 nmdc:mga08x19_223963_c1 3300050514 Unclassified 1293
371 Ga0501084_0002856 3300054114 Bacteria 13964
372 Ga0501084_0009545 3300054114 Bacteria 8029
373 Ga0501084_0107127 3300054114 Bacteria 2348
374 Ga0501084_0111715 3300054114 Bacteria 2296
375 Ga0501084_0134447 3300054114 Bacteria 2082
376 Ga0501084_0333586 3300054114 Bacteria 1281
377 Ga0501084_0367715 3300054114 Bacteria 1215
378 Ga0501084_0479970 3300054114 Unclassified 1051
379 Ga0501082_0090303 3300060353 Bacteria 2645
380 Ga0501082_0098595 3300060353 Bacteria 2527
381 Ga0501082_0153381 3300060353 Bacteria 2001
382 Ga0501082_0375297 3300060353 Bacteria 1241
383 Ga0466962_0040067 3300061719 Bacteria 2243
384 Ga0530510_0000485 3300061734 Bacteria 25551
385 Ga0530510_0028097 3300061734 Bacteria 4034
386 Ga0530510_0068626 3300061734 Unclassified 2572
387 Ga0530510_0080658 3300061734 Bacteria 2368
388 Ga0530510_0139897 3300061734 Bacteria 1783
389 Ga0530510_0271172 3300061734 Bacteria 1266
390 Ga0530510_0517152 3300061734 Bacteria 905
391 Ga0395898_0150520
392 JGI25407J50210_10000785
393 JGI25407J50210_10006433
394 JGI25407J50210_10009912
395 JGI25407J50210_10051968
396 JGI25407J50210_10062212
397 Ga0065704_10033852
398 Ga0065704_10307789
399 Ga0065707_10007633
400 Ga0070683_100256226
401 Ga0070670_100136417
402 Ga0070677_10002834
403 Ga0070677_10159255
404 Ga0068869_100169772
405 Ga0070666_10271978
406 Ga0068868_100228891
407 Ga0070687_100070096
408 Ga0070661_100026344
409 Ga0070675_100115713
410 Ga0070675_100615657
411 Ga0070671_100085899
412 Ga0070674_100131703
413 Ga0070673_100108726
414 Ga0070673_100134296
415 Ga0070688_100280141
416 Ga0070688_100575278
417 Ga0070659_100288676
418 Ga0070667_100290320
419 Ga0070714_100028164
420 Ga0070714_100221123
421 Ga0070714_100276672
422 Ga0070713_100274551
423 Ga0070713_100372778
424 Ga0070713_101162027
425 Ga0070701_10005553
426 Ga0070694_100133040
427 Ga0070663_100426525
428 Ga0070678_100107105
429 Ga0070662_100043892
430 Ga0068867_100092298
431 Ga0070706_100265607
432 Ga0070699_100009947
433 Ga0070684_100574947
434 Ga0070697_100015148
435 Ga0070697_100155819
436 Ga0068853_100069065
437 Ga0070672_100038978
438 Ga0070686_100097774
439 Ga0070695_100057066
440 Ga0070665_100625475
441 Ga0070664_100121841
442 Ga0070702_100024028
443 Ga0068852_100068849
444 Ga0068859_100928000
445 Ga0068864_100074949
446 Ga0068861_100297443
447 Ga0068851_10080992
448 Ga0068870_10014007
449 Ga0068863_100195861
450 Ga0068858_100374157
451 Ga0081455_10000176
452 Ga0081455_10009202
453 Ga0081455_10280119
454 Ga0081538_10000009
455 Ga0081538_10000124
456 Ga0081538_10000443
457 Ga0081538_10000787
458 Ga0081538_10001377
459 Ga0081538_10001542
460 Ga0081538_10002098
461 Ga0081538_10003350
462 Ga0081538_10004302
463 Ga0081538_10005134
464 Ga0081538_10008777
465 Ga0081538_10013575
466 Ga0081538_10022453
467 Ga0081538_10026027
468 Ga0081538_10030758
469 Ga0081538_10038162
470 Ga0081540_1022446
471 Ga0070717_10011713
472 Ga0070717_10315508
473 Ga0097621_100037922
474 Ga0097621_100543739
475 Ga0068871_100136110
476 Ga0068871_100246304
477 Ga0075428_100342613
478 Ga0075428_100376594
479 Ga0075428_100387027
480 Ga0075430_100060395
481 Ga0075431_100014331
482 Ga0075431_100074260
483 Ga0075431_100082767
484 Ga0075429_100094154
485 Ga0075429_100406801
486 Ga0068865_100090524
487 Ga0075436_100129872
488 Ga0075436_100141026
489 Ga0097620_100928002
490 Ga0099794_10020334
491 Ga0111539_10319839
492 Ga0111539_10792857
493 Ga0105247_10509745
494 Ga0114129_10015528
495 Ga0114129_10100612
496 Ga0105243_10034960
497 Ga0105242_10077495
498 Ga0105242_10582647
499 Ga0105249_10208605
500 Ga0105246_10333318
501 Ga0157369_10621354
502 Ga0157374_10055149
503 Ga0157374_10060965
504 Ga0157378_10189929
505 Ga0157372_11019139
506 Ga0157375_10100593
507 Ga0157375_10125520
508 Ga0157375_10916836
509 Ga0157380_10440518
510 Ga0157379_10544314
511 Ga0157376_10285213
512 Ga0163161_10342557
513 Ga0197907_10568972
514 Ga0207697_10005071
515 Ga0207682_10001762
516 Ga0207688_10005820
517 Ga0207680_10091961
518 Ga0207699_10290538
519 Ga0207645_10180233
520 Ga0207643_10146175
521 Ga0207684_10045074
522 Ga0207663_10080180
523 Ga0207649_10050755
524 Ga0207646_10040696
525 Ga0207650_10243592
526 Ga0207659_10059384
527 Ga0207700_10267035
528 Ga0207700_10607907
529 Ga0207664_10008644
530 Ga0207664_10055421
531 Ga0207644_10264159
532 Ga0207706_10133280
533 Ga0207709_10607715
534 Ga0207669_10478027
535 Ga0207691_10005400
536 Ga0207711_10391459
537 Ga0207689_10030353
538 Ga0207661_10201406
539 Ga0207679_10075754
540 Ga0207679_10191006
541 Ga0207651_10048664
542 Ga0207651_10184696
543 Ga0207639_10243382
544 Ga0207678_10422567
545 Ga0207708_10040906
546 Ga0207641_10051976
547 Ga0207641_10081177
548 Ga0207648_10024567
549 Ga0207648_10137041
550 Ga0207676_10007676
551 Ga0207676_10035402
552 Ga0207676_10047018
553 Ga0207675_100040346
554 Ga0207683_10035319
555 Ga0207698_10141601
556 Ga0207428_10089941
557 Ga0207428_10190113
558 Ga0268266_10078564
559 Ga0268265_10521351
560 Ga0268264_10450127
561 Ga0265318_10018520
562 Ga0265330_10009360
563 Ga0265328_10002045
564 Ga0265320_10025641
565 Ga0265329_10003912
566 Ga0265331_10008471
567 Ga0265314_10002102
568 Ga0265342_10047862
569 Ga0307405_10608039
570 Ga0307413_10139295
571 Ga0307410_10054233
572 Ga0307410_10234134
573 Ga0307406_10045833
574 Ga0307407_10255540
575 Ga0307409_100262026
576 Ga0307409_100360863
577 Ga0307409_100587087
578 Ga0307409_100976472
579 Ga0307409_101070580
580 Ga0307416_100013382
581 Ga0307416_100027990
582 Ga0307416_100087944
583 Ga0307414_10389277
584 Ga0307414_10885431
585 Ga0307415_100002219
586 Ga0307415_100633241
587 Ga0373934_0059272
588 Ga0373943_0042436
589 Ga0373943_0313729
590 Ga0373925_0122904
591 Ga0395899_0119519
592 Ga0395900_0005013
593 Ga0395900_0253721
594 Ga0395900_0303795
595 Ga0395898_0011083
596 Ga0395898_0233120
597 Ga0395898_0265401
598 Ga0395898_1032947
599 Ga0395905_0015080
600 Ga0395901_0076028
601 Ga0395901_0086421
602 Ga0395901_0105545
603 Ga0395901_0126830
604 Ga0395901_0205469
605 Ga0395901_0406424
606 Ga0395901_0549991
607 Ga0395901_0594158
608 Ga0439463_077883
609 Ga0466966_0435960
610 Ga0466963_0059779
611 Ga0466959_0123332
612 Ga0466958_0040305
613 Ga0466967_0002085
614 Ga0495605_0066904
615 Ga0495639_0267642
616 Ga0495584_0131697
617 Ga0495596_0153490
618 Ga0495642_0065664
619 Ga0495621_0026352
620 Ga0495589_0308282
621 Ga0496108_0198672
622 Ga0496109_0325048
623 Ga0496110_0262031
624 Ga0501031_0005327
625 Ga0501031_0007214
626 Ga0501031_0058185
627 Ga0501031_0353837
628 Ga0501032_0038594
629 Ga0501032_0462424
630 Ga0501033_0109861
631 Ga0501036_0006026
632 Ga0501036_0042181
633 Ga0501036_0101337
634 Ga0501037_0018981
635 Ga0501037_0174729
636 Ga0501037_0326437
637 Ga0501038_0003590
638 Ga0501038_0008897
639 Ga0501038_0222526
640 Ga0501038_0416447
641 Ga0501039_0001577
642 Ga0501039_0003134
643 Ga0501039_0007410
644 Ga0501039_0018344
645 Ga0501039_0041923
646 Ga0501039_0649440
647 Ga0501039_0759751
648 Ga0501040_0045979
649 Ga0501040_0056988
650 Ga0501040_0059501
651 Ga0501040_0170743
652 Ga0501040_0254590
653 Ga0501040_0565051
654 Ga0501041_0002312
655 Ga0501041_0030344
656 Ga0501041_0031290
657 Ga0501041_0138538
658 Ga0501042_0006345
659 Ga0501042_0011812
660 Ga0501042_0043910
661 Ga0501042_0051170
662 Ga0501042_0125840
663 Ga0501042_0448950
664 Ga0501046_0024164
665 Ga0501046_0064813
666 Ga0501048_0025729
667 Ga0501048_0031443
668 Ga0501048_0045278
669 Ga0501048_0128388
670 Ga0501068_0057316
671 Ga0501068_0103097
672 Ga0501068_0129531
673 Ga0501068_0329238
674 Ga0501069_0034792
675 Ga0501069_0087725
676 Ga0501069_0181688
677 Ga0501070_0030825
678 Ga0501070_0075461
679 Ga0501071_0010693
680 Ga0501071_0032025
681 Ga0501071_0061243
682 Ga0501071_0080242
683 Ga0501071_0222713
684 Ga0501071_0422799
685 Ga0501072_0002166
686 Ga0501072_0014667
687 Ga0501072_0016362
688 Ga0501072_0030556
689 Ga0501072_0064618
690 Ga0501072_0102703
691 Ga0501072_0122475
692 Ga0501072_0224047
693 Ga0501072_0345813
694 Ga0501072_0417916
695 Ga0501073_0295473
696 Ga0501074_0000796
697 Ga0501074_0069335
698 Ga0501074_0128434
699 Ga0501074_0435070
700 Ga0501075_0006162
701 Ga0501075_0008378
702 Ga0501075_0011158
703 Ga0501075_0025716
704 Ga0501075_0041868
705 Ga0501075_0054959
706 Ga0501075_0066023
707 Ga0501075_0200233
708 Ga0501075_0335332
709 Ga0501075_0614932
710 Ga0501075_0840540
711 Ga0501076_0003212
712 Ga0501076_0004792
713 Ga0501076_0046384
714 Ga0501076_0049252
715 Ga0501076_0064646
716 Ga0501076_0090167
717 Ga0501076_0406671
718 Ga0501077_0027293
719 Ga0501077_0035830
720 Ga0501077_0308824
721 Ga0501077_0361249
722 Ga0501079_0003002
723 Ga0501079_0017676
724 Ga0501079_0030593
725 Ga0501079_0032915
726 Ga0501079_0101508
727 Ga0501079_0145193
728 Ga0501079_0164909
729 Ga0501079_0243163
730 Ga0501080_0008227
731 Ga0501080_0059537
732 Ga0501080_0590375
733 Ga0501081_0005436
734 Ga0501081_0007915
735 Ga0501081_0039091
736 Ga0501081_0080959
737 Ga0501081_0104423
738 Ga0501081_0327212
739 Ga0501081_0590559
740 Ga0501083_0047032
741 Ga0501083_0246452
742 Ga0501035_0017163
743 Ga0501035_0288753
744 Ga0501044_0476144
745 Ga0501045_0023163
746 Ga0501045_0083415
747 Ga0501045_0144757
748 Ga0501045_0147407
749 Ga0501045_0218204
750 nmdc:mga05p37_224264_c1
751 nmdc:mga05p37_345206_c1
752 nmdc:mga05p37_9467_c1
753 nmdc:mga09592_521754_c1
754 nmdc:mga0qj67_10196_c1
755 nmdc:mga0qj67_25958_c1
756 nmdc:mga06r32_158630_c1
757 nmdc:mga06r32_57056_c1
758 nmdc:mga06r32_580248_c1
759 nmdc:mga08y16_664480_c1
760 nmdc:mga08x19_223963_c1
761 Ga0501084_0002856
762 Ga0501084_0009545
763 Ga0501084_0107127
764 Ga0501084_0111715
765 Ga0501084_0134447
766 Ga0501084_0333586
767 Ga0501084_0367715
768 Ga0501084_0479970
769 Ga0501082_0090303
770 Ga0501082_0098595
771 Ga0501082_0153381
772 Ga0501082_0375297
773 Ga0466962_0040067
774 Ga0530510_0000485
775 Ga0530510_0028097
776 Ga0530510_0068626
777 Ga0530510_0080658
778 Ga0530510_0139897
779 Ga0530510_0271172
780 Ga0530510_0517152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

76

159

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.6972 41 172
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.6864 44 179
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.6859 34 173
6ohj-assembly1.cif.gz_B crystal structure of the debrominase bmp8 c82a in complex with 2,3,4-tribromopyrrole 0.6818 45 174
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.6703 41 172
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7332 51 170 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7201 45 174 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6933 46 173 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6887 44 179 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.688 38 181 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A3G2I0B5-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.7632 44 174 GO:0051920
AF-A0A7V8NFV2-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.7577 45 174 GO:0051920
AF-A0A0J7IXH3-F1-model_v4 Alkylhydroperoxidase 0.7529 44 175 GO:0051920
AF-A0A2N3TBP8-F1-model_v4 AhpD family alkylhydroperoxidase 0.7518 44 174 GO:0051920
AF-A0A7W7ZHJ0-F1-model_v4 AhpD family alkylhydroperoxidase 0.7472 43 179 GO:0051920

Map