F431658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 390 | 237 | 390 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100089144|Ga0070714_1000891442 |
| Length | 150 |
| Sequence | MPPSTLRAMSVLEQVQDDVKTAMKARDRERASALRLIVDVLQQDAKLGKGDEIAVLQRERKKRVEAAEAYEGAGRSEQAASERFEAELIEGYLPQQLSDEELAALVQEAVEETGASEQRQMGQVMSALMPKVGGRADGKRVSAAVRQKLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 121 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 122 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 124 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 125 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 126 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 188 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 189 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 190 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 191 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 192 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 234 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 9.23 |
| Rhizosphere | 82.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001399 | 3300001977 | Bacteria | 3847 |
| 2 | JGI24740J21852_10003738 | 3300001979 | Bacteria | 6624 |
| 3 | JGI24748J21848_1000432 | 3300002074 | Bacteria | 4664 |
| 4 | JGI24034J26672_10000172 | 3300002239 | Bacteria | 8945 |
| 5 | JGI24742J22300_10001057 | 3300002244 | Bacteria | 4244 |
| 6 | Ga0070658_10104529 | 3300005327 | Bacteria | 2343 |
| 7 | Ga0070683_100079831 | 3300005329 | Bacteria | 3062 |
| 8 | Ga0070683_100198214 | 3300005329 | Unclassified | 1906 |
| 9 | Ga0070683_100495832 | 3300005329 | Bacteria | 1167 |
| 10 | Ga0070670_100057496 | 3300005331 | Bacteria | 3339 |
| 11 | Ga0070666_10017763 | 3300005335 | Bacteria | 4564 |
| 12 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 13 | Ga0068868_100000033 | 3300005338 | Bacteria | 75402 |
| 14 | Ga0068868_100004423 | 3300005338 | Bacteria | 9856 |
| 15 | Ga0070689_100067986 | 3300005340 | Bacteria | 2778 |
| 16 | Ga0070691_10000036 | 3300005341 | Bacteria | 38327 |
| 17 | Ga0070661_100000121 | 3300005344 | Bacteria | 65344 |
| 18 | Ga0070675_100000028 | 3300005354 | Bacteria | 103914 |
| 19 | Ga0070675_100664182 | 3300005354 | Bacteria | 948 |
| 20 | Ga0070671_100251255 | 3300005355 | Bacteria | 1502 |
| 21 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 22 | Ga0070688_100000016 | 3300005365 | Bacteria | 73740 |
| 23 | Ga0070688_100000277 | 3300005365 | Bacteria | 26584 |
| 24 | Ga0070688_100045772 | 3300005365 | Bacteria | 2705 |
| 25 | Ga0070659_100005693 | 3300005366 | Bacteria | 8968 |
| 26 | Ga0070667_100015886 | 3300005367 | Bacteria | 6228 |
| 27 | Ga0070714_100089144 | 3300005435 | Bacteria | 2700 |
| 28 | Ga0070713_100000058 | 3300005436 | Bacteria | 70009 |
| 29 | Ga0070663_100000645 | 3300005455 | Bacteria | 18730 |
| 30 | Ga0070663_101960614 | 3300005455 | Bacteria | 527 |
| 31 | Ga0070678_101090193 | 3300005456 | Bacteria | 737 |
| 32 | Ga0070685_10000013 | 3300005466 | Bacteria | 120875 |
| 33 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 34 | Ga0070679_100002983 | 3300005530 | Bacteria | 15447 |
| 35 | Ga0070684_100149707 | 3300005535 | Bacteria | 2114 |
| 36 | Ga0070684_100267972 | 3300005535 | Bacteria | 1563 |
| 37 | Ga0070684_100484337 | 3300005535 | Bacteria | 1145 |
| 38 | Ga0068853_100013254 | 3300005539 | Bacteria | 6730 |
| 39 | Ga0068853_100754381 | 3300005539 | Bacteria | 930 |
| 40 | Ga0068853_100948933 | 3300005539 | Bacteria | 827 |
| 41 | Ga0070672_100000885 | 3300005543 | Bacteria | 17980 |
| 42 | Ga0070686_100364714 | 3300005544 | Bacteria | 1089 |
| 43 | Ga0070695_101473962 | 3300005545 | Bacteria | 566 |
| 44 | Ga0070665_100003676 | 3300005548 | Bacteria | 16257 |
| 45 | Ga0070665_100066750 | 3300005548 | Bacteria | 3609 |
| 46 | Ga0070665_100125086 | 3300005548 | Bacteria | 2573 |
| 47 | Ga0070665_100164043 | 3300005548 | Bacteria | 2224 |
| 48 | Ga0070704_100116796 | 3300005549 | Bacteria | 2041 |
| 49 | Ga0068854_100000333 | 3300005578 | Bacteria | 30901 |
| 50 | Ga0068856_100000237 | 3300005614 | Bacteria | 59854 |
| 51 | Ga0068856_100138522 | 3300005614 | Bacteria | 2440 |
| 52 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 53 | Ga0068852_100029435 | 3300005616 | Bacteria | 4512 |
| 54 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 55 | Ga0068866_10005380 | 3300005718 | Bacteria | 5282 |
| 56 | Ga0068861_101621160 | 3300005719 | Bacteria | 638 |
| 57 | Ga0068851_10000126 | 3300005834 | Bacteria | 41437 |
| 58 | Ga0068851_10052354 | 3300005834 | Bacteria | 2076 |
| 59 | Ga0068863_100583242 | 3300005841 | Bacteria | 1106 |
| 60 | Ga0068858_100064838 | 3300005842 | Bacteria | 3381 |
| 61 | Ga0081455_10031059 | 3300005937 | Bacteria | 4839 |
| 62 | Ga0081539_10003959 | 3300005985 | Bacteria | 17145 |
| 63 | Ga0075434_100879726 | 3300006871 | Bacteria | 911 |
| 64 | Ga0068865_100000042 | 3300006881 | Bacteria | 71057 |
| 65 | Ga0105245_10000104 | 3300009098 | Bacteria | 80951 |
| 66 | Ga0105245_10297949 | 3300009098 | Bacteria | 1581 |
| 67 | Ga0105245_11503027 | 3300009098 | Bacteria | 724 |
| 68 | Ga0105247_10000206 | 3300009101 | Bacteria | 57601 |
| 69 | Ga0105247_10117130 | 3300009101 | Bacteria | 1721 |
| 70 | Ga0105247_10256046 | 3300009101 | Bacteria | 1198 |
| 71 | Ga0105243_10003464 | 3300009148 | Bacteria | 12741 |
| 72 | Ga0105243_10042454 | 3300009148 | Bacteria | 3560 |
| 73 | Ga0105241_10139603 | 3300009174 | Bacteria | 1971 |
| 74 | Ga0105241_10620312 | 3300009174 | Bacteria | 979 |
| 75 | Ga0105241_11037036 | 3300009174 | Bacteria | 769 |
| 76 | Ga0105242_10000595 | 3300009176 | Bacteria | 28423 |
| 77 | Ga0105242_10020610 | 3300009176 | Bacteria | 5172 |
| 78 | Ga0105248_10000175 | 3300009177 | Bacteria | 74795 |
| 79 | Ga0105237_10271668 | 3300009545 | Bacteria | 1698 |
| 80 | Ga0105238_12761605 | 3300009551 | Bacteria | 527 |
| 81 | Ga0105249_11965101 | 3300009553 | Bacteria | 658 |
| 82 | Ga0105239_10035264 | 3300010375 | Bacteria | 5494 |
| 83 | Ga0105239_10097042 | 3300010375 | Bacteria | 3257 |
| 84 | Ga0105239_10449229 | 3300010375 | Bacteria | 1462 |
| 85 | Ga0105239_13059681 | 3300010375 | Bacteria | 545 |
| 86 | Ga0157342_1004560 | 3300012507 | Bacteria | 1235 |
| 87 | Ga0157371_10137126 | 3300013102 | Bacteria | 1742 |
| 88 | Ga0157371_10879472 | 3300013102 | Unclassified | 678 |
| 89 | Ga0157370_10018997 | 3300013104 | Bacteria | 6910 |
| 90 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 91 | Ga0157369_11109932 | 3300013105 | Bacteria | 808 |
| 92 | Ga0157374_11959513 | 3300013296 | Bacteria | 612 |
| 93 | Ga0157378_10014163 | 3300013297 | Bacteria | 6978 |
| 94 | Ga0157378_10034276 | 3300013297 | Bacteria | 4489 |
| 95 | Ga0163162_10498625 | 3300013306 | Bacteria | 1348 |
| 96 | Ga0163162_12295490 | 3300013306 | Unclassified | 620 |
| 97 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 98 | Ga0157372_11101156 | 3300013307 | Bacteria | 919 |
| 99 | Ga0157375_10204320 | 3300013308 | Bacteria | 2132 |
| 100 | Ga0163163_11140536 | 3300014325 | Bacteria | 842 |
| 101 | Ga0157380_10000376 | 3300014326 | Bacteria | 26882 |
| 102 | Ga0157376_10196446 | 3300014969 | Bacteria | 1853 |
| 103 | Ga0157376_10491833 | 3300014969 | Bacteria | 1204 |
| 104 | Ga0197907_10391901 | 3300020069 | Unclassified | 612 |
| 105 | Ga0206356_10533102 | 3300020070 | Bacteria | 1726 |
| 106 | Ga0206356_11239011 | 3300020070 | Unclassified | 714 |
| 107 | Ga0154015_1703871 | 3300020610 | Bacteria | 1271 |
| 108 | Ga0207672_1001727 | 3300025223 | Bacteria | 1516 |
| 109 | Ga0207656_10000241 | 3300025321 | Bacteria | 19100 |
| 110 | Ga0207656_10032190 | 3300025321 | Bacteria | 2177 |
| 111 | Ga0207642_10009013 | 3300025899 | Bacteria | 3453 |
| 112 | Ga0207710_10000995 | 3300025900 | Bacteria | 14820 |
| 113 | Ga0207710_10066302 | 3300025900 | Bacteria | 1647 |
| 114 | Ga0207710_10141677 | 3300025900 | Bacteria | 1161 |
| 115 | Ga0207680_10008370 | 3300025903 | Bacteria | 5073 |
| 116 | Ga0207680_10016234 | 3300025903 | Bacteria | 3904 |
| 117 | Ga0207705_10069162 | 3300025909 | Bacteria | 2557 |
| 118 | Ga0207654_10068827 | 3300025911 | Bacteria | 2095 |
| 119 | Ga0207654_10597111 | 3300025911 | Bacteria | 787 |
| 120 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 121 | Ga0207649_10291798 | 3300025920 | Bacteria | 1189 |
| 122 | Ga0207652_10001339 | 3300025921 | Bacteria | 21906 |
| 123 | Ga0207659_10000022 | 3300025926 | Bacteria | 143432 |
| 124 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 125 | Ga0207687_10014656 | 3300025927 | Bacteria | 5132 |
| 126 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 127 | Ga0207664_10386595 | 3300025929 | Bacteria | 1243 |
| 128 | Ga0207690_10007564 | 3300025932 | Bacteria | 6449 |
| 129 | Ga0207686_10016434 | 3300025934 | Bacteria | 4155 |
| 130 | Ga0207709_10003457 | 3300025935 | Bacteria | 9374 |
| 131 | Ga0207709_10140518 | 3300025935 | Bacteria | 1659 |
| 132 | Ga0207670_10043523 | 3300025936 | Bacteria | 2966 |
| 133 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 134 | Ga0207704_10000181 | 3300025938 | Bacteria | 33316 |
| 135 | Ga0207704_10119858 | 3300025938 | Bacteria | 1798 |
| 136 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 137 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 138 | Ga0207661_10000771 | 3300025944 | Bacteria | 20792 |
| 139 | Ga0207661_10175628 | 3300025944 | Unclassified | 1867 |
| 140 | Ga0207661_10436176 | 3300025944 | Bacteria | 1191 |
| 141 | Ga0207668_10441333 | 3300025972 | Bacteria | 1109 |
| 142 | Ga0207668_10529298 | 3300025972 | Bacteria | 1018 |
| 143 | Ga0207640_10000110 | 3300025981 | Bacteria | 61907 |
| 144 | Ga0207658_10004855 | 3300025986 | Bacteria | 9291 |
| 145 | Ga0207658_10404956 | 3300025986 | Bacteria | 1200 |
| 146 | Ga0207677_10000343 | 3300026023 | Bacteria | 33031 |
| 147 | Ga0207677_10002270 | 3300026023 | Bacteria | 10097 |
| 148 | Ga0207703_10286362 | 3300026035 | Bacteria | 1498 |
| 149 | Ga0207639_10669825 | 3300026041 | Bacteria | 961 |
| 150 | Ga0207639_10851482 | 3300026041 | Bacteria | 851 |
| 151 | Ga0207678_10001707 | 3300026067 | Bacteria | 20125 |
| 152 | Ga0207678_10186023 | 3300026067 | Bacteria | 1774 |
| 153 | Ga0207702_10000251 | 3300026078 | Bacteria | 62222 |
| 154 | Ga0207702_10121205 | 3300026078 | Bacteria | 2341 |
| 155 | Ga0207702_10177191 | 3300026078 | Bacteria | 1960 |
| 156 | Ga0207641_10126914 | 3300026088 | Bacteria | 2285 |
| 157 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 158 | Ga0207674_11709790 | 3300026116 | Bacteria | 597 |
| 159 | Ga0207683_10148249 | 3300026121 | Bacteria | 2117 |
| 160 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 161 | Ga0207698_10588177 | 3300026142 | Bacteria | 1096 |
| 162 | Ga0268266_10000491 | 3300028379 | Bacteria | 56615 |
| 163 | Ga0268266_10001210 | 3300028379 | Bacteria | 31835 |
| 164 | Ga0268266_10027403 | 3300028379 | Bacteria | 4845 |
| 165 | Ga0268266_10042449 | 3300028379 | Bacteria | 3885 |
| 166 | Ga0268264_10967389 | 3300028381 | Bacteria | 857 |
| 167 | Ga0268264_11473202 | 3300028381 | Bacteria | 691 |
| 168 | Ga0265326_10060471 | 3300028558 | Bacteria | 1072 |
| 169 | Ga0265326_10063517 | 3300028558 | Bacteria | 1044 |
| 170 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 171 | Ga0265322_10095271 | 3300028654 | Bacteria | 846 |
| 172 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 173 | Ga0265325_10004067 | 3300031241 | Bacteria | 9322 |
| 174 | Ga0307408_101348278 | 3300031548 | Bacteria | 670 |
| 175 | Ga0265313_10168608 | 3300031595 | Bacteria | 926 |
| 176 | Ga0265342_10198773 | 3300031712 | Bacteria | 1090 |
| 177 | Ga0316593_10042696 | 3300032168 | Bacteria | 1513 |
| 178 | Ga0373956_0042362 | 3300035119 | Bacteria | 2024 |
| 179 | Ga0373937_0358374 | 3300036401 | Bacteria | 1382 |
| 180 | Ga0400485_08097 | 3300038735 | Bacteria | 1543 |
| 181 | Ga0400488_53693 | 3300038741 | Bacteria | 3997 |
| 182 | Ga0400488_63097 | 3300038741 | Bacteria | 2481 |
| 183 | Ga0451807_2571841 | 3300041486 | Bacteria | 952 |
| 184 | Ga0451835_0419093 | 3300041492 | Bacteria | 675 |
| 185 | Ga0451839_0328831 | 3300041496 | Bacteria | 797 |
| 186 | Ga0451843_1030299 | 3300041509 | Bacteria | 561 |
| 187 | Ga0451853_1847147 | 3300041512 | Bacteria | 1615 |
| 188 | Ga0451853_2426879 | 3300041512 | Bacteria | 1429 |
| 189 | Ga0466963_0019447 | 3300044694 | Bacteria | 4261 |
| 190 | Ga0466963_0294730 | 3300044694 | Bacteria | 1140 |
| 191 | Ga0466964_0077100 | 3300044706 | Bacteria | 1422 |
| 192 | Ga0466957_0037142 | 3300044842 | Bacteria | 2932 |
| 193 | Ga0466957_0223450 | 3300044842 | Bacteria | 1244 |
| 194 | Ga0466957_0372680 | 3300044842 | Bacteria | 972 |
| 195 | Ga0451576_0685052 | 3300045051 | Bacteria | 1077 |
| 196 | Ga0466967_0693088 | 3300045976 | Bacteria | 1009 |
| 197 | Ga0495592_0043726 | 3300046454 | Bacteria | 3350 |
| 198 | Ga0495629_0000610 | 3300046459 | Bacteria | 29089 |
| 199 | Ga0495629_0003072 | 3300046459 | Bacteria | 12684 |
| 200 | Ga0495638_0042002 | 3300046460 | Bacteria | 2890 |
| 201 | Ga0495651_0548372 | 3300046462 | Bacteria | 735 |
| 202 | Ga0495662_0005247 | 3300046476 | Bacteria | 6495 |
| 203 | Ga0495585_0172835 | 3300046492 | Bacteria | 1115 |
| 204 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 205 | Ga0495596_0067789 | 3300046500 | Bacteria | 1387 |
| 206 | Ga0495606_0000463 | 3300046507 | Bacteria | 66752 |
| 207 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 208 | Ga0495618_0339175 | 3300046514 | Bacteria | 928 |
| 209 | Ga0495618_0819544 | 3300046514 | Bacteria | 541 |
| 210 | Ga0495620_0004866 | 3300046515 | Bacteria | 7536 |
| 211 | Ga0495620_0239894 | 3300046515 | Bacteria | 692 |
| 212 | Ga0495628_0322569 | 3300046516 | Bacteria | 1139 |
| 213 | Ga0495630_0000060 | 3300046517 | Bacteria | 90021 |
| 214 | Ga0495630_0484321 | 3300046517 | Bacteria | 948 |
| 215 | Ga0495637_0095762 | 3300046520 | Bacteria | 1165 |
| 216 | Ga0495587_0001789 | 3300046536 | Bacteria | 14353 |
| 217 | Ga0495587_0062439 | 3300046536 | Bacteria | 2181 |
| 218 | Ga0495622_0000132 | 3300046557 | Bacteria | 63863 |
| 219 | Ga0495667_0000258 | 3300046559 | Bacteria | 34340 |
| 220 | Ga0495656_0000800 | 3300046615 | Bacteria | 10185 |
| 221 | Ga0495668_0450047 | 3300046616 | Bacteria | 709 |
| 222 | Ga0495634_0000059 | 3300046642 | Bacteria | 88314 |
| 223 | Ga0495634_0268206 | 3300046642 | Bacteria | 1039 |
| 224 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 225 | Ga0495635_0081574 | 3300046663 | Bacteria | 2213 |
| 226 | Ga0495635_0666234 | 3300046663 | Bacteria | 676 |
| 227 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 228 | Ga0495599_0248935 | 3300046678 | Bacteria | 1082 |
| 229 | Ga0495647_0000744 | 3300046681 | Bacteria | 9671 |
| 230 | Ga0495658_0001858 | 3300046683 | Bacteria | 10783 |
| 231 | Ga0495613_0001530 | 3300046689 | Bacteria | 17607 |
| 232 | Ga0495613_0383917 | 3300046689 | Bacteria | 960 |
| 233 | Ga0495624_0001926 | 3300046690 | Bacteria | 15801 |
| 234 | Ga0495624_0222929 | 3300046690 | Bacteria | 1143 |
| 235 | Ga0495600_0023859 | 3300046809 | Bacteria | 3935 |
| 236 | Ga0495660_0111803 | 3300046810 | Bacteria | 1393 |
| 237 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 238 | Ga0495604_0000305 | 3300047317 | Bacteria | 44020 |
| 239 | Ga0495604_0155355 | 3300047317 | Bacteria | 1621 |
| 240 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 241 | Ga0495672_0026553 | 3300047320 | Bacteria | 3693 |
| 242 | Ga0495672_0228282 | 3300047320 | Bacteria | 915 |
| 243 | Ga0495672_0335232 | 3300047320 | Unclassified | 706 |
| 244 | Ga0495676_0000346 | 3300047321 | Bacteria | 37821 |
| 245 | Ga0495676_0070367 | 3300047321 | Bacteria | 2695 |
| 246 | Ga0495676_0081713 | 3300047321 | Bacteria | 2448 |
| 247 | Ga0495676_0885687 | 3300047321 | Unclassified | 572 |
| 248 | Ga0495676_1099875 | 3300047321 | Bacteria | 505 |
| 249 | Ga0495680_0011360 | 3300047322 | Bacteria | 7886 |
| 250 | Ga0495680_0194274 | 3300047322 | Bacteria | 1459 |
| 251 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 252 | Ga0495686_0110396 | 3300047472 | Bacteria | 1650 |
| 253 | Ga0495593_0041691 | 3300047673 | Bacteria | 2467 |
| 254 | Ga0495593_0055844 | 3300047673 | Bacteria | 2077 |
| 255 | Ga0495602_0000227 | 3300048088 | Bacteria | 52680 |
| 256 | Ga0495602_0001969 | 3300048088 | Bacteria | 20606 |
| 257 | Ga0495602_0274728 | 3300048088 | Bacteria | 1244 |
| 258 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 259 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 260 | Ga0496102_0002490 | 3300048905 | Bacteria | 15727 |
| 261 | Ga0496102_0730182 | 3300048905 | Unclassified | 913 |
| 262 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 263 | Ga0496103_0009815 | 3300048906 | Bacteria | 5669 |
| 264 | Ga0496103_0032772 | 3300048906 | Bacteria | 3172 |
| 265 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 266 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 267 | Ga0496104_0044843 | 3300048907 | Bacteria | 4156 |
| 268 | Ga0496104_0045264 | 3300048907 | Bacteria | 4138 |
| 269 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 270 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 271 | Ga0496105_0350898 | 3300048908 | Bacteria | 1178 |
| 272 | Ga0496106_0008407 | 3300048909 | Bacteria | 7634 |
| 273 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 274 | Ga0496107_0664547 | 3300048910 | Unclassified | 768 |
| 275 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 276 | Ga0496108_1700842 | 3300048911 | Unclassified | 519 |
| 277 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 278 | Ga0496109_0970467 | 3300048912 | Bacteria | 788 |
| 279 | Ga0496109_1017374 | 3300048912 | Unclassified | 766 |
| 280 | Ga0496110_0000357 | 3300048913 | Bacteria | 30636 |
| 281 | Ga0496110_0037362 | 3300048913 | Bacteria | 4221 |
| 282 | Ga0496110_0102472 | 3300048913 | Bacteria | 2567 |
| 283 | Ga0496111_0000735 | 3300048914 | Bacteria | 17456 |
| 284 | Ga0496111_0085745 | 3300048914 | Bacteria | 2303 |
| 285 | Ga0496111_0376267 | 3300048914 | Bacteria | 1050 |
| 286 | Ga0496111_0512734 | 3300048914 | Bacteria | 882 |
| 287 | Ga0496113_0196377 | 3300048916 | Bacteria | 1603 |
| 288 | Ga0496114_0000056 | 3300048917 | Bacteria | 95692 |
| 289 | Ga0496114_0161094 | 3300048917 | Bacteria | 1951 |
| 290 | Ga0496114_0264392 | 3300048917 | Bacteria | 1515 |
| 291 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 292 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 293 | Ga0496116_0000257 | 3300048919 | Bacteria | 93214 |
| 294 | Ga0496117_0006062 | 3300048920 | Bacteria | 12411 |
| 295 | Ga0496118_0005497 | 3300048921 | Bacteria | 14381 |
| 296 | Ga0496118_0172587 | 3300048921 | Bacteria | 1318 |
| 297 | Ga0496119_0003792 | 3300048922 | Bacteria | 15458 |
| 298 | Ga0496119_0011399 | 3300048922 | Bacteria | 7366 |
| 299 | Ga0496119_0037506 | 3300048922 | Bacteria | 3147 |
| 300 | Ga0496120_0006686 | 3300048923 | Bacteria | 8782 |
| 301 | Ga0496120_0016516 | 3300048923 | Bacteria | 4825 |
| 302 | Ga0496120_0204359 | 3300048923 | Unclassified | 954 |
| 303 | Ga0496121_0010139 | 3300048924 | Bacteria | 10675 |
| 304 | Ga0496121_0027375 | 3300048924 | Bacteria | 5336 |
| 305 | Ga0496121_0166734 | 3300048924 | Bacteria | 1604 |
| 306 | Ga0496121_0176305 | 3300048924 | Unclassified | 1547 |
| 307 | Ga0496121_0189249 | 3300048924 | Bacteria | 1477 |
| 308 | Ga0496124_0166379 | 3300048927 | Bacteria | 1713 |
| 309 | Ga0496125_0096766 | 3300048928 | Bacteria | 2190 |
| 310 | Ga0496125_0111780 | 3300048928 | Bacteria | 1976 |
| 311 | Ga0496126_0011501 | 3300048929 | Bacteria | 9151 |
| 312 | Ga0496126_0124932 | 3300048929 | Bacteria | 2228 |
| 313 | Ga0496126_0364387 | 3300048929 | Bacteria | 1180 |
| 314 | Ga0501031_0003339 | 3300049568 | Bacteria | 10300 |
| 315 | Ga0501032_0004713 | 3300049569 | Bacteria | 10232 |
| 316 | Ga0501032_0228799 | 3300049569 | Bacteria | 1209 |
| 317 | Ga0501033_0000534 | 3300049570 | Bacteria | 35503 |
| 318 | Ga0501034_0027350 | 3300049571 | Bacteria | 5800 |
| 319 | Ga0501034_0085554 | 3300049571 | Bacteria | 3154 |
| 320 | Ga0501036_0005643 | 3300049572 | Bacteria | 10150 |
| 321 | Ga0501036_0896430 | 3300049572 | Unclassified | 728 |
| 322 | Ga0501037_0004502 | 3300049573 | Bacteria | 10130 |
| 323 | Ga0501038_0007396 | 3300049574 | Bacteria | 10128 |
| 324 | Ga0501039_0035782 | 3300049575 | Bacteria | 3832 |
| 325 | Ga0501040_0117557 | 3300049576 | Bacteria | 1864 |
| 326 | Ga0501040_0261826 | 3300049576 | Bacteria | 1234 |
| 327 | Ga0501042_0011871 | 3300049578 | Bacteria | 5885 |
| 328 | Ga0501042_0074187 | 3300049578 | Bacteria | 2434 |
| 329 | Ga0501042_0210249 | 3300049578 | Bacteria | 1403 |
| 330 | Ga0501043_0000291 | 3300049579 | Bacteria | 45276 |
| 331 | Ga0501043_0288281 | 3300049579 | Bacteria | 1257 |
| 332 | Ga0501046_0010973 | 3300049580 | Bacteria | 7768 |
| 333 | Ga0501047_0000313 | 3300049581 | Bacteria | 55964 |
| 334 | Ga0501047_0004429 | 3300049581 | Bacteria | 13226 |
| 335 | Ga0501047_0094421 | 3300049581 | Bacteria | 2870 |
| 336 | Ga0501047_0267968 | 3300049581 | Bacteria | 1554 |
| 337 | Ga0501047_0347789 | 3300049581 | Bacteria | 1319 |
| 338 | Ga0501048_0004802 | 3300049582 | Bacteria | 10298 |
| 339 | Ga0501048_0883165 | 3300049582 | Bacteria | 643 |
| 340 | Ga0501068_0009843 | 3300049584 | Bacteria | 5354 |
| 341 | Ga0501068_0185815 | 3300049584 | Bacteria | 1315 |
| 342 | Ga0501068_0254953 | 3300049584 | Bacteria | 1119 |
| 343 | Ga0501069_0009708 | 3300049585 | Bacteria | 5084 |
| 344 | Ga0501070_0006008 | 3300049586 | Bacteria | 10340 |
| 345 | Ga0501070_0049701 | 3300049586 | Bacteria | 3482 |
| 346 | Ga0501070_0169038 | 3300049586 | Bacteria | 1801 |
| 347 | Ga0501070_0791277 | 3300049586 | Archaea | 745 |
| 348 | Ga0501071_0074171 | 3300049587 | Bacteria | 2483 |
| 349 | Ga0501071_0534036 | 3300049587 | Bacteria | 900 |
| 350 | Ga0501072_0069509 | 3300049588 | Bacteria | 2781 |
| 351 | Ga0501072_0130734 | 3300049588 | Bacteria | 2001 |
| 352 | Ga0501073_0004165 | 3300049589 | Bacteria | 10847 |
| 353 | Ga0501074_0027191 | 3300049590 | Bacteria | 4147 |
| 354 | Ga0501074_1301709 | 3300049590 | Bacteria | 509 |
| 355 | Ga0501075_0213185 | 3300049591 | Bacteria | 1473 |
| 356 | Ga0501076_0061827 | 3300049592 | Bacteria | 2981 |
| 357 | Ga0501079_0337464 | 3300049741 | Bacteria | 1180 |
| 358 | Ga0501080_0224185 | 3300049742 | Bacteria | 1719 |
| 359 | Ga0501080_0749111 | 3300049742 | Bacteria | 859 |
| 360 | Ga0501083_0004241 | 3300049744 | Bacteria | 10091 |
| 361 | Ga0501083_0010191 | 3300049744 | Bacteria | 6622 |
| 362 | Ga0501035_0000736 | 3300049822 | Bacteria | 35413 |
| 363 | Ga0501035_0623700 | 3300049822 | Unclassified | 876 |
| 364 | Ga0501044_0001624 | 3300049823 | Bacteria | 26339 |
| 365 | Ga0501044_0018065 | 3300049823 | Bacteria | 7563 |
| 366 | Ga0501044_0075446 | 3300049823 | Bacteria | 3423 |
| 367 | Ga0501044_0187850 | 3300049823 | Bacteria | 2030 |
| 368 | Ga0501044_0667516 | 3300049823 | Unclassified | 927 |
| 369 | Ga0501045_0133258 | 3300049824 | Bacteria | 1847 |
| 370 | nmdc:mga0qj67_357594_c1 | 3300050509 | Bacteria | 1180 |
| 371 | nmdc:mga0rr50_586239_c1 | 3300050513 | Bacteria | 950 |
| 372 | nmdc:mga0a205_94_c1 | 3300050515 | Bacteria | 50261 |
| 373 | Ga0495601_0000057 | 3300053077 | Bacteria | 61510 |
| 374 | Ga0495601_0111526 | 3300053077 | Bacteria | 1772 |
| 375 | Ga0495601_0116870 | 3300053077 | Bacteria | 1730 |
| 376 | Ga0495612_0012018 | 3300053078 | Bacteria | 3488 |
| 377 | Ga0495655_0040436 | 3300053083 | Bacteria | 1187 |
| 378 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 379 | Ga0495619_0000144 | 3300053085 | Bacteria | 52554 |
| 380 | Ga0495619_0000146 | 3300053085 | Bacteria | 52136 |
| 381 | Ga0495619_0000765 | 3300053085 | Bacteria | 20982 |
| 382 | Ga0495619_0001050 | 3300053085 | Bacteria | 18097 |
| 383 | Ga0495619_0002751 | 3300053085 | Bacteria | 11480 |
| 384 | Ga0495619_0702728 | 3300053085 | Bacteria | 687 |
| 385 | Ga0500595_012921 | 3300053119 | Bacteria | 3212 |
| 386 | Ga0500568_0276332 | 3300053139 | Bacteria | 610 |
| 387 | Ga0501082_0043231 | 3300060353 | Bacteria | 3884 |
| 388 | Ga0501082_0892201 | 3300060353 | Bacteria | 778 |
| 389 | Ga0466962_0430319 | 3300061719 | Bacteria | 663 |
| 390 | Ga0530510_0563804 | 3300061734 | Bacteria | 865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10449229 | Ga0105239_104492292 | 111 |
| 2 | 3300044706 | Ga0466964_0077100 | Ga0466964_0077100_959_1408 | 115 |
| 3 | 3300005549 | Ga0070704_100116796 | Ga0070704_1001167964 | 120 |
| 4 | 3300035119 | Ga0373956_0042362 | Ga0373956_0042362_486_920 | 120 |
| 5 | 3300036401 | Ga0373937_0358374 | Ga0373937_0358374_256_690 | 120 |
| 6 | 3300046514 | Ga0495618_0819544 | Ga0495618_0819544_92_526 | 120 |
| 7 | 3300046663 | Ga0495635_0666234 | Ga0495635_0666234_26_460 | 120 |
| 8 | 3300047322 | Ga0495680_0194274 | Ga0495680_0194274_191_625 | 120 |
| 9 | 3300053077 | Ga0495601_0111526 | Ga0495601_0111526_179_547 | 120 |
| 10 | 3300053085 | Ga0495619_0002751 | Ga0495619_0002751_6247_6681 | 120 |
| 11 | 3300005614 | Ga0068856_100000237 | Ga0068856_10000023711 | 121 |
| 12 | 3300005616 | Ga0068852_100000002 | Ga0068852_10000000221 | 121 |
| 13 | 3300009177 | Ga0105248_10000175 | Ga0105248_1000017536 | 121 |
| 14 | 3300013102 | Ga0157371_10137126 | Ga0157371_101371262 | 121 |
| 15 | 3300013104 | Ga0157370_10018997 | Ga0157370_100189976 | 121 |
| 16 | 3300025941 | Ga0207711_10000006 | Ga0207711_1000000647 | 121 |
| 17 | 3300026078 | Ga0207702_10000251 | Ga0207702_1000025159 | 121 |
| 18 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004264 | 121 |
| 19 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011197 | 122 |
| 20 | 3300005539 | Ga0068853_100754381 | Ga0068853_1007543811 | 122 |
| 21 | 3300009174 | Ga0105241_10139603 | Ga0105241_101396033 | 122 |
| 22 | 3300025911 | Ga0207654_10068827 | Ga0207654_100688272 | 122 |
| 23 | 3300038741 | Ga0400488_63097 | Ga0400488_63097_2002_2445 | 122 |
| 24 | 3300048913 | Ga0496110_0000357 | Ga0496110_0000357_10059_10490 | 122 |
| 25 | 3300048914 | Ga0496111_0000735 | Ga0496111_0000735_6952_7383 | 122 |
| 26 | 3300049581 | Ga0501047_0094421 | Ga0501047_0094421_1050_1481 | 122 |
| 27 | 3300049744 | Ga0501083_0010191 | Ga0501083_0010191_3631_4062 | 122 |
| 28 | 3300053085 | Ga0495619_0000144 | Ga0495619_0000144_44382_44813 | 122 |
| 29 | 3300045051 | Ga0451576_0685052 | Ga0451576_0685052_508_957 | 125 |
| 30 | 3300038741 | Ga0400488_53693 | Ga0400488_53693_226_669 | 126 |
| 31 | 3300048924 | Ga0496121_0176305 | Ga0496121_0176305_337_717 | 126 |
| 32 | 3300002074 | JGI24748J21848_1000432 | JGI24748J21848_10004324 | 127 |
| 33 | 3300002239 | JGI24034J26672_10000172 | JGI24034J26672_100001729 | 127 |
| 34 | 3300002244 | JGI24742J22300_10001057 | JGI24742J22300_100010574 | 127 |
| 35 | 3300005354 | Ga0070675_100000028 | Ga0070675_10000002850 | 127 |
| 36 | 3300025223 | Ga0207672_1001727 | Ga0207672_10017272 | 127 |
| 37 | 3300025926 | Ga0207659_10000022 | Ga0207659_100000228 | 127 |
| 38 | 3300038735 | Ga0400485_08097 | Ga0400485_08097_866_1309 | 127 |
| 39 | 3300046459 | Ga0495629_0003072 | Ga0495629_0003072_2113_2544 | 127 |
| 40 | 3300048906 | Ga0496103_0032772 | Ga0496103_0032772_548_979 | 127 |
| 41 | 3300005436 | Ga0070713_100000058 | Ga0070713_10000005818 | 128 |
| 42 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003474 | 128 |
| 43 | 3300046559 | Ga0495667_0000258 | Ga0495667_0000258_26794_27231 | 128 |
| 44 | 3300047317 | Ga0495604_0000100 | Ga0495604_0000100_13564_13995 | 128 |
| 45 | 3300047322 | Ga0495680_0011360 | Ga0495680_0011360_1552_1989 | 128 |
| 46 | 3300048929 | Ga0496126_0364387 | Ga0496126_0364387_630_1016 | 128 |
| 47 | 3300005329 | Ga0070683_100079831 | Ga0070683_1000798315 | 129 |
| 48 | 3300005331 | Ga0070670_100057496 | Ga0070670_1000574962 | 129 |
| 49 | 3300005335 | Ga0070666_10017763 | Ga0070666_100177632 | 129 |
| 50 | 3300005338 | Ga0068868_100004423 | Ga0068868_1000044236 | 129 |
| 51 | 3300005354 | Ga0070675_100664182 | Ga0070675_1006641822 | 129 |
| 52 | 3300005455 | Ga0070663_101960614 | Ga0070663_1019606141 | 129 |
| 53 | 3300005535 | Ga0070684_100484337 | Ga0070684_1004843371 | 129 |
| 54 | 3300005539 | Ga0068853_100948933 | Ga0068853_1009489332 | 129 |
| 55 | 3300005548 | Ga0070665_100003676 | Ga0070665_10000367611 | 129 |
| 56 | 3300005718 | Ga0068866_10005380 | Ga0068866_100053808 | 129 |
| 57 | 3300005719 | Ga0068861_101621160 | Ga0068861_1016211602 | 129 |
| 58 | 3300005834 | Ga0068851_10000126 | Ga0068851_1000012628 | 129 |
| 59 | 3300005841 | Ga0068863_100583242 | Ga0068863_1005832422 | 129 |
| 60 | 3300005937 | Ga0081455_10031059 | Ga0081455_100310592 | 129 |
| 61 | 3300005985 | Ga0081539_10003959 | Ga0081539_1000395913 | 129 |
| 62 | 3300009101 | Ga0105247_10117130 | Ga0105247_101171302 | 129 |
| 63 | 3300020069 | Ga0197907_10391901 | Ga0197907_103919012 | 129 |
| 64 | 3300025321 | Ga0207656_10000241 | Ga0207656_1000024111 | 129 |
| 65 | 3300025899 | Ga0207642_10009013 | Ga0207642_100090133 | 129 |
| 66 | 3300025900 | Ga0207710_10141677 | Ga0207710_101416772 | 129 |
| 67 | 3300025903 | Ga0207680_10016234 | Ga0207680_100162342 | 129 |
| 68 | 3300025927 | Ga0207687_10014656 | Ga0207687_100146567 | 129 |
| 69 | 3300025944 | Ga0207661_10000771 | Ga0207661_1000077113 | 129 |
| 70 | 3300026041 | Ga0207639_10851482 | Ga0207639_108514822 | 129 |
| 71 | 3300026088 | Ga0207641_10126914 | Ga0207641_101269142 | 129 |
| 72 | 3300026121 | Ga0207683_10148249 | Ga0207683_101482494 | 129 |
| 73 | 3300028379 | Ga0268266_10001210 | Ga0268266_100012102 | 129 |
| 74 | 3300028381 | Ga0268264_11473202 | Ga0268264_114732022 | 129 |
| 75 | 3300028558 | Ga0265326_10060471 | Ga0265326_100604711 | 129 |
| 76 | 3300032168 | Ga0316593_10042696 | Ga0316593_100426962 | 129 |
| 77 | 3300041492 | Ga0451835_0419093 | Ga0451835_0419093_11_400 | 129 |
| 78 | 3300041496 | Ga0451839_0328831 | Ga0451839_0328831_76_507 | 129 |
| 79 | 3300044694 | Ga0466963_0294730 | Ga0466963_0294730_20_409 | 129 |
| 80 | 3300046515 | Ga0495620_0239894 | Ga0495620_0239894_282_671 | 129 |
| 81 | 3300046520 | Ga0495637_0095762 | Ga0495637_0095762_32_421 | 129 |
| 82 | 3300047320 | Ga0495672_0228282 | Ga0495672_0228282_496_885 | 129 |
| 83 | 3300047321 | Ga0495676_1099875 | Ga0495676_1099875_20_409 | 129 |
| 84 | 3300048913 | Ga0496110_0037362 | Ga0496110_0037362_716_1147 | 129 |
| 85 | 3300048914 | Ga0496111_0376267 | Ga0496111_0376267_239_670 | 129 |
| 86 | 3300049572 | Ga0501036_0896430 | Ga0501036_0896430_205_645 | 129 |
| 87 | 3300049582 | Ga0501048_0883165 | Ga0501048_0883165_225_614 | 129 |
| 88 | 3300049588 | Ga0501072_0069509 | Ga0501072_0069509_1902_2342 | 129 |
| 89 | 3300049591 | Ga0501075_0213185 | Ga0501075_0213185_142_582 | 129 |
| 90 | 3300049592 | Ga0501076_0061827 | Ga0501076_0061827_2139_2579 | 129 |
| 91 | 3300049742 | Ga0501080_0749111 | Ga0501080_0749111_443_832 | 129 |
| 92 | 3300061734 | Ga0530510_0563804 | Ga0530510_0563804_352_792 | 129 |
| 93 | 3300048917 | Ga0496114_0161094 | Ga0496114_0161094_798_1229 | 130 |
| 94 | 3300005356 | Ga0070674_100000002 | Ga0070674_100000002148 | 131 |
| 95 | 3300005842 | Ga0068858_100064838 | Ga0068858_1000648384 | 131 |
| 96 | 3300009148 | Ga0105243_10042454 | Ga0105243_100424544 | 131 |
| 97 | 3300009176 | Ga0105242_10020610 | Ga0105242_100206105 | 131 |
| 98 | 3300025934 | Ga0207686_10016434 | Ga0207686_100164345 | 131 |
| 99 | 3300025935 | Ga0207709_10140518 | Ga0207709_101405184 | 131 |
| 100 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003146 | 131 |
| 101 | 3300026035 | Ga0207703_10286362 | Ga0207703_102863622 | 131 |
| 102 | 3300046507 | Ga0495606_0000463 | Ga0495606_0000463_2252_2683 | 131 |
| 103 | 3300047673 | Ga0495593_0055844 | Ga0495593_0055844_432_860 | 131 |
| 104 | 3300053078 | Ga0495612_0012018 | Ga0495612_0012018_1454_1885 | 131 |
| 105 | 3300026041 | Ga0207639_10669825 | Ga0207639_106698252 | 132 |
| 106 | 3300047320 | Ga0495672_0026553 | Ga0495672_0026553_1422_1853 | 132 |
| 107 | 3300005365 | Ga0070688_100000277 | Ga0070688_10000027720 | 133 |
| 108 | 3300005466 | Ga0070685_10000013 | Ga0070685_10000013127 | 133 |
| 109 | 3300005539 | Ga0068853_100013254 | Ga0068853_1000132546 | 133 |
| 110 | 3300014326 | Ga0157380_10000376 | Ga0157380_1000037612 | 133 |
| 111 | 3300044694 | Ga0466963_0019447 | Ga0466963_0019447_2047_2478 | 133 |
| 112 | 3300060353 | Ga0501082_0892201 | Ga0501082_0892201_71_502 | 133 |
| 113 | 3300005616 | Ga0068852_100029435 | Ga0068852_1000294357 | 134 |
| 114 | 3300046492 | Ga0495585_0172835 | Ga0495585_0172835_524_952 | 136 |
| 115 | 3300049584 | Ga0501068_0254953 | Ga0501068_0254953_457_888 | 138 |
| 116 | 3300005367 | Ga0070667_100015886 | Ga0070667_1000158864 | 142 |
| 117 | 3300005435 | Ga0070714_100089144 | Ga0070714_1000891442 | 142 |
| 118 | 3300005544 | Ga0070686_100364714 | Ga0070686_1003647141 | 142 |
| 119 | 3300005548 | Ga0070665_100125086 | Ga0070665_1001250862 | 142 |
| 120 | 3300005548 | Ga0070665_100164043 | Ga0070665_1001640432 | 142 |
| 121 | 3300005578 | Ga0068854_100000333 | Ga0068854_1000003335 | 142 |
| 122 | 3300006871 | Ga0075434_100879726 | Ga0075434_1008797262 | 142 |
| 123 | 3300009098 | Ga0105245_11503027 | Ga0105245_115030272 | 142 |
| 124 | 3300009101 | Ga0105247_10256046 | Ga0105247_102560462 | 142 |
| 125 | 3300012507 | Ga0157342_1004560 | Ga0157342_10045602 | 142 |
| 126 | 3300013307 | Ga0157372_10000210 | Ga0157372_1000021031 | 142 |
| 127 | 3300013308 | Ga0157375_10204320 | Ga0157375_102043204 | 142 |
| 128 | 3300020610 | Ga0154015_1703871 | Ga0154015_17038713 | 142 |
| 129 | 3300025900 | Ga0207710_10066302 | Ga0207710_100663022 | 142 |
| 130 | 3300025903 | Ga0207680_10008370 | Ga0207680_100083702 | 142 |
| 131 | 3300025929 | Ga0207664_10386595 | Ga0207664_103865952 | 142 |
| 132 | 3300025972 | Ga0207668_10529298 | Ga0207668_105292982 | 142 |
| 133 | 3300025981 | Ga0207640_10000110 | Ga0207640_100001104 | 142 |
| 134 | 3300025986 | Ga0207658_10004855 | Ga0207658_1000485510 | 142 |
| 135 | 3300028379 | Ga0268266_10000491 | Ga0268266_1000049143 | 142 |
| 136 | 3300028379 | Ga0268266_10027403 | Ga0268266_100274037 | 142 |
| 137 | 3300028381 | Ga0268264_10967389 | Ga0268264_109673892 | 142 |
| 138 | 3300031548 | Ga0307408_101348278 | Ga0307408_1013482781 | 142 |
| 139 | 3300044842 | Ga0466957_0223450 | Ga0466957_0223450_553_981 | 142 |
| 140 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_9094_9522 | 142 |
| 141 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_123490_123918 | 142 |
| 142 | 3300046683 | Ga0495658_0001858 | Ga0495658_0001858_5120_5548 | 142 |
| 143 | 3300046689 | Ga0495613_0001530 | Ga0495613_0001530_7158_7586 | 142 |
| 144 | 3300046809 | Ga0495600_0023859 | Ga0495600_0023859_2697_3125 | 142 |
| 145 | 3300047317 | Ga0495604_0000305 | Ga0495604_0000305_17402_17830 | 142 |
| 146 | 3300047317 | Ga0495604_0155355 | Ga0495604_0155355_627_1055 | 142 |
| 147 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_123483_123911 | 142 |
| 148 | 3300047472 | Ga0495686_0110396 | Ga0495686_0110396_842_1270 | 142 |
| 149 | 3300048088 | Ga0495602_0000227 | Ga0495602_0000227_42520_42948 | 142 |
| 150 | 3300048907 | Ga0496104_0045264 | Ga0496104_0045264_2895_3323 | 142 |
| 151 | 3300048927 | Ga0496124_0166379 | Ga0496124_0166379_861_1289 | 142 |
| 152 | 3300048929 | Ga0496126_0124932 | Ga0496126_0124932_662_1090 | 142 |
| 153 | 3300049568 | Ga0501031_0003339 | Ga0501031_0003339_1149_1577 | 142 |
| 154 | 3300049569 | Ga0501032_0004713 | Ga0501032_0004713_8771_9199 | 142 |
| 155 | 3300049570 | Ga0501033_0000534 | Ga0501033_0000534_8877_9305 | 142 |
| 156 | 3300049571 | Ga0501034_0027350 | Ga0501034_0027350_4877_5305 | 142 |
| 157 | 3300049571 | Ga0501034_0085554 | Ga0501034_0085554_496_924 | 142 |
| 158 | 3300049572 | Ga0501036_0005643 | Ga0501036_0005643_8766_9194 | 142 |
| 159 | 3300049573 | Ga0501037_0004502 | Ga0501037_0004502_948_1376 | 142 |
| 160 | 3300049574 | Ga0501038_0007396 | Ga0501038_0007396_8783_9211 | 142 |
| 161 | 3300049575 | Ga0501039_0035782 | Ga0501039_0035782_2510_2938 | 142 |
| 162 | 3300049576 | Ga0501040_0261826 | Ga0501040_0261826_653_1081 | 142 |
| 163 | 3300049578 | Ga0501042_0011871 | Ga0501042_0011871_912_1340 | 142 |
| 164 | 3300049579 | Ga0501043_0000291 | Ga0501043_0000291_36089_36517 | 142 |
| 165 | 3300049580 | Ga0501046_0010973 | Ga0501046_0010973_6157_6585 | 142 |
| 166 | 3300049581 | Ga0501047_0000313 | Ga0501047_0000313_8789_9217 | 142 |
| 167 | 3300049582 | Ga0501048_0004802 | Ga0501048_0004802_8704_9132 | 142 |
| 168 | 3300049584 | Ga0501068_0009843 | Ga0501068_0009843_3999_4427 | 142 |
| 169 | 3300049585 | Ga0501069_0009708 | Ga0501069_0009708_773_1201 | 142 |
| 170 | 3300049586 | Ga0501070_0006008 | Ga0501070_0006008_1147_1575 | 142 |
| 171 | 3300049587 | Ga0501071_0534036 | Ga0501071_0534036_223_651 | 142 |
| 172 | 3300049588 | Ga0501072_0130734 | Ga0501072_0130734_910_1338 | 142 |
| 173 | 3300049589 | Ga0501073_0004165 | Ga0501073_0004165_8699_9127 | 142 |
| 174 | 3300049590 | Ga0501074_0027191 | Ga0501074_0027191_3478_3906 | 142 |
| 175 | 3300049742 | Ga0501080_0224185 | Ga0501080_0224185_1190_1618 | 142 |
| 176 | 3300049744 | Ga0501083_0004241 | Ga0501083_0004241_8752_9180 | 142 |
| 177 | 3300049822 | Ga0501035_0000736 | Ga0501035_0000736_8767_9195 | 142 |
| 178 | 3300049822 | Ga0501035_0623700 | Ga0501035_0623700_217_645 | 142 |
| 179 | 3300049823 | Ga0501044_0001624 | Ga0501044_0001624_24752_25180 | 142 |
| 180 | 3300049823 | Ga0501044_0667516 | Ga0501044_0667516_482_910 | 142 |
| 181 | 3300049824 | Ga0501045_0133258 | Ga0501045_0133258_613_1041 | 142 |
| 182 | 3300053077 | Ga0495601_0000057 | Ga0495601_0000057_10004_10432 | 142 |
| 183 | 3300053083 | Ga0495655_0040436 | Ga0495655_0040436_442_870 | 142 |
| 184 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_123490_123918 | 142 |
| 185 | 3300053085 | Ga0495619_0001050 | Ga0495619_0001050_8576_9004 | 142 |
| 186 | 3300060353 | Ga0501082_0043231 | Ga0501082_0043231_856_1284 | 142 |
| 187 | 3300001977 | JGI24746J21847_1001399 | JGI24746J21847_10013994 | 143 |
| 188 | 3300001979 | JGI24740J21852_10003738 | JGI24740J21852_100037388 | 143 |
| 189 | 3300005327 | Ga0070658_10104529 | Ga0070658_101045295 | 143 |
| 190 | 3300005329 | Ga0070683_100198214 | Ga0070683_1001982142 | 143 |
| 191 | 3300005329 | Ga0070683_100495832 | Ga0070683_1004958322 | 143 |
| 192 | 3300005338 | Ga0068868_100000033 | Ga0068868_10000003342 | 143 |
| 193 | 3300005340 | Ga0070689_100067986 | Ga0070689_1000679863 | 143 |
| 194 | 3300005341 | Ga0070691_10000036 | Ga0070691_1000003620 | 143 |
| 195 | 3300005344 | Ga0070661_100000121 | Ga0070661_10000012121 | 143 |
| 196 | 3300005355 | Ga0070671_100251255 | Ga0070671_1002512552 | 143 |
| 197 | 3300005365 | Ga0070688_100000016 | Ga0070688_10000001613 | 143 |
| 198 | 3300005365 | Ga0070688_100045772 | Ga0070688_1000457724 | 143 |
| 199 | 3300005366 | Ga0070659_100005693 | Ga0070659_10000569311 | 143 |
| 200 | 3300005455 | Ga0070663_100000645 | Ga0070663_10000064519 | 143 |
| 201 | 3300005456 | Ga0070678_101090193 | Ga0070678_1010901931 | 143 |
| 202 | 3300005466 | Ga0070685_10000053 | Ga0070685_1000005325 | 143 |
| 203 | 3300005530 | Ga0070679_100002983 | Ga0070679_1000029834 | 143 |
| 204 | 3300005535 | Ga0070684_100149707 | Ga0070684_1001497074 | 143 |
| 205 | 3300005535 | Ga0070684_100267972 | Ga0070684_1002679722 | 143 |
| 206 | 3300005543 | Ga0070672_100000885 | Ga0070672_10000088512 | 143 |
| 207 | 3300005545 | Ga0070695_101473962 | Ga0070695_1014739621 | 143 |
| 208 | 3300005548 | Ga0070665_100066750 | Ga0070665_1000667502 | 143 |
| 209 | 3300005614 | Ga0068856_100138522 | Ga0068856_1001385222 | 143 |
| 210 | 3300005618 | Ga0068864_100000015 | Ga0068864_10000001521 | 143 |
| 211 | 3300005834 | Ga0068851_10052354 | Ga0068851_100523543 | 143 |
| 212 | 3300006881 | Ga0068865_100000042 | Ga0068865_10000004245 | 143 |
| 213 | 3300009098 | Ga0105245_10000104 | Ga0105245_1000010441 | 143 |
| 214 | 3300009098 | Ga0105245_10297949 | Ga0105245_102979491 | 143 |
| 215 | 3300009101 | Ga0105247_10000206 | Ga0105247_1000020624 | 143 |
| 216 | 3300009148 | Ga0105243_10003464 | Ga0105243_1000346413 | 143 |
| 217 | 3300009174 | Ga0105241_10620312 | Ga0105241_106203122 | 143 |
| 218 | 3300009174 | Ga0105241_11037036 | Ga0105241_110370362 | 143 |
| 219 | 3300009176 | Ga0105242_10000595 | Ga0105242_1000059519 | 143 |
| 220 | 3300009545 | Ga0105237_10271668 | Ga0105237_102716682 | 143 |
| 221 | 3300009551 | Ga0105238_12761605 | Ga0105238_127616051 | 143 |
| 222 | 3300009553 | Ga0105249_11965101 | Ga0105249_119651011 | 143 |
| 223 | 3300010375 | Ga0105239_10035264 | Ga0105239_100352647 | 143 |
| 224 | 3300010375 | Ga0105239_10097042 | Ga0105239_100970425 | 143 |
| 225 | 3300010375 | Ga0105239_13059681 | Ga0105239_130596811 | 143 |
| 226 | 3300013102 | Ga0157371_10879472 | Ga0157371_108794722 | 143 |
| 227 | 3300013105 | Ga0157369_10000014 | Ga0157369_10000014130 | 143 |
| 228 | 3300013105 | Ga0157369_11109932 | Ga0157369_111099322 | 143 |
| 229 | 3300013296 | Ga0157374_11959513 | Ga0157374_119595131 | 143 |
| 230 | 3300013297 | Ga0157378_10014163 | Ga0157378_100141636 | 143 |
| 231 | 3300013297 | Ga0157378_10034276 | Ga0157378_100342762 | 143 |
| 232 | 3300013306 | Ga0163162_10498625 | Ga0163162_104986252 | 143 |
| 233 | 3300013306 | Ga0163162_12295490 | Ga0163162_122954902 | 143 |
| 234 | 3300013307 | Ga0157372_11101156 | Ga0157372_111011562 | 143 |
| 235 | 3300014325 | Ga0163163_11140536 | Ga0163163_111405362 | 143 |
| 236 | 3300014969 | Ga0157376_10196446 | Ga0157376_101964462 | 143 |
| 237 | 3300014969 | Ga0157376_10491833 | Ga0157376_104918332 | 143 |
| 238 | 3300020070 | Ga0206356_10533102 | Ga0206356_105331022 | 143 |
| 239 | 3300020070 | Ga0206356_11239011 | Ga0206356_112390112 | 143 |
| 240 | 3300025321 | Ga0207656_10032190 | Ga0207656_100321904 | 143 |
| 241 | 3300025900 | Ga0207710_10000995 | Ga0207710_1000099516 | 143 |
| 242 | 3300025909 | Ga0207705_10069162 | Ga0207705_100691625 | 143 |
| 243 | 3300025911 | Ga0207654_10597111 | Ga0207654_105971112 | 143 |
| 244 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003278 | 143 |
| 245 | 3300025920 | Ga0207649_10291798 | Ga0207649_102917983 | 143 |
| 246 | 3300025921 | Ga0207652_10001339 | Ga0207652_1000133922 | 143 |
| 247 | 3300025927 | Ga0207687_10000015 | Ga0207687_10000015223 | 143 |
| 248 | 3300025932 | Ga0207690_10007564 | Ga0207690_100075648 | 143 |
| 249 | 3300025935 | Ga0207709_10003457 | Ga0207709_100034578 | 143 |
| 250 | 3300025936 | Ga0207670_10043523 | Ga0207670_100435233 | 143 |
| 251 | 3300025938 | Ga0207704_10000181 | Ga0207704_1000018122 | 143 |
| 252 | 3300025938 | Ga0207704_10119858 | Ga0207704_101198584 | 143 |
| 253 | 3300025940 | Ga0207691_10000002 | Ga0207691_10000002152 | 143 |
| 254 | 3300025944 | Ga0207661_10175628 | Ga0207661_101756284 | 143 |
| 255 | 3300025944 | Ga0207661_10436176 | Ga0207661_104361762 | 143 |
| 256 | 3300025972 | Ga0207668_10441333 | Ga0207668_104413332 | 143 |
| 257 | 3300025986 | Ga0207658_10404956 | Ga0207658_104049562 | 143 |
| 258 | 3300026023 | Ga0207677_10000343 | Ga0207677_1000034331 | 143 |
| 259 | 3300026023 | Ga0207677_10002270 | Ga0207677_100022706 | 143 |
| 260 | 3300026067 | Ga0207678_10001707 | Ga0207678_100017073 | 143 |
| 261 | 3300026067 | Ga0207678_10186023 | Ga0207678_101860232 | 143 |
| 262 | 3300026078 | Ga0207702_10121205 | Ga0207702_101212052 | 143 |
| 263 | 3300026078 | Ga0207702_10177191 | Ga0207702_101771911 | 143 |
| 264 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018279 | 143 |
| 265 | 3300026116 | Ga0207674_11709790 | Ga0207674_117097902 | 143 |
| 266 | 3300026142 | Ga0207698_10588177 | Ga0207698_105881773 | 143 |
| 267 | 3300028379 | Ga0268266_10042449 | Ga0268266_100424492 | 143 |
| 268 | 3300028558 | Ga0265326_10063517 | Ga0265326_100635173 | 143 |
| 269 | 3300028563 | Ga0265319_1000014 | Ga0265319_10000148 | 143 |
| 270 | 3300028654 | Ga0265322_10095271 | Ga0265322_100952712 | 143 |
| 271 | 3300028800 | Ga0265338_10000185 | Ga0265338_100001856 | 143 |
| 272 | 3300031241 | Ga0265325_10004067 | Ga0265325_100040676 | 143 |
| 273 | 3300031595 | Ga0265313_10168608 | Ga0265313_101686082 | 143 |
| 274 | 3300031712 | Ga0265342_10198773 | Ga0265342_101987732 | 143 |
| 275 | 3300041486 | Ga0451807_2571841 | Ga0451807_2571841_496_927 | 143 |
| 276 | 3300041509 | Ga0451843_1030299 | Ga0451843_1030299_97_528 | 143 |
| 277 | 3300041512 | Ga0451853_1847147 | Ga0451853_1847147_370_801 | 143 |
| 278 | 3300041512 | Ga0451853_2426879 | Ga0451853_2426879_116_547 | 143 |
| 279 | 3300044842 | Ga0466957_0037142 | Ga0466957_0037142_373_804 | 143 |
| 280 | 3300044842 | Ga0466957_0372680 | Ga0466957_0372680_95_526 | 143 |
| 281 | 3300045976 | Ga0466967_0693088 | Ga0466967_0693088_72_503 | 143 |
| 282 | 3300046454 | Ga0495592_0043726 | Ga0495592_0043726_2261_2692 | 143 |
| 283 | 3300046459 | Ga0495629_0000610 | Ga0495629_0000610_1804_2235 | 143 |
| 284 | 3300046460 | Ga0495638_0042002 | Ga0495638_0042002_484_915 | 143 |
| 285 | 3300046462 | Ga0495651_0548372 | Ga0495651_0548372_118_549 | 143 |
| 286 | 3300046476 | Ga0495662_0005247 | Ga0495662_0005247_3982_4413 | 143 |
| 287 | 3300046499 | Ga0495594_0000006 | Ga0495594_0000006_72284_72715 | 143 |
| 288 | 3300046500 | Ga0495596_0067789 | Ga0495596_0067789_511_948 | 143 |
| 289 | 3300046514 | Ga0495618_0339175 | Ga0495618_0339175_100_531 | 143 |
| 290 | 3300046515 | Ga0495620_0004866 | Ga0495620_0004866_6897_7328 | 143 |
| 291 | 3300046516 | Ga0495628_0322569 | Ga0495628_0322569_613_1044 | 143 |
| 292 | 3300046517 | Ga0495630_0000060 | Ga0495630_0000060_81600_82031 | 143 |
| 293 | 3300046517 | Ga0495630_0484321 | Ga0495630_0484321_215_646 | 143 |
| 294 | 3300046536 | Ga0495587_0001789 | Ga0495587_0001789_10828_11259 | 143 |
| 295 | 3300046536 | Ga0495587_0062439 | Ga0495587_0062439_390_821 | 143 |
| 296 | 3300046557 | Ga0495622_0000132 | Ga0495622_0000132_44993_45424 | 143 |
| 297 | 3300046615 | Ga0495656_0000800 | Ga0495656_0000800_5653_6084 | 143 |
| 298 | 3300046616 | Ga0495668_0450047 | Ga0495668_0450047_162_599 | 143 |
| 299 | 3300046642 | Ga0495634_0000059 | Ga0495634_0000059_78016_78447 | 143 |
| 300 | 3300046642 | Ga0495634_0268206 | Ga0495634_0268206_319_753 | 143 |
| 301 | 3300046660 | Ga0495625_0000032 | Ga0495625_0000032_92557_92988 | 143 |
| 302 | 3300046663 | Ga0495635_0081574 | Ga0495635_0081574_150_584 | 143 |
| 303 | 3300046678 | Ga0495599_0248935 | Ga0495599_0248935_227_658 | 143 |
| 304 | 3300046681 | Ga0495647_0000744 | Ga0495647_0000744_407_838 | 143 |
| 305 | 3300046689 | Ga0495613_0383917 | Ga0495613_0383917_52_483 | 143 |
| 306 | 3300046690 | Ga0495624_0001926 | Ga0495624_0001926_5218_5649 | 143 |
| 307 | 3300046690 | Ga0495624_0222929 | Ga0495624_0222929_186_620 | 143 |
| 308 | 3300046810 | Ga0495660_0111803 | Ga0495660_0111803_57_488 | 143 |
| 309 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_165572_166003 | 143 |
| 310 | 3300047320 | Ga0495672_0335232 | Ga0495672_0335232_249_680 | 143 |
| 311 | 3300047321 | Ga0495676_0000346 | Ga0495676_0000346_33940_34371 | 143 |
| 312 | 3300047321 | Ga0495676_0070367 | Ga0495676_0070367_447_878 | 143 |
| 313 | 3300047321 | Ga0495676_0081713 | Ga0495676_0081713_13_444 | 143 |
| 314 | 3300047321 | Ga0495676_0885687 | Ga0495676_0885687_45_476 | 143 |
| 315 | 3300047673 | Ga0495593_0041691 | Ga0495593_0041691_489_920 | 143 |
| 316 | 3300048088 | Ga0495602_0001969 | Ga0495602_0001969_10114_10545 | 143 |
| 317 | 3300048088 | Ga0495602_0274728 | Ga0495602_0274728_237_668 | 143 |
| 318 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_205829_206260 | 143 |
| 319 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_7181_7612 | 143 |
| 320 | 3300048905 | Ga0496102_0002490 | Ga0496102_0002490_10065_10496 | 143 |
| 321 | 3300048905 | Ga0496102_0730182 | Ga0496102_0730182_309_746 | 143 |
| 322 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_100816_101247 | 143 |
| 323 | 3300048906 | Ga0496103_0009815 | Ga0496103_0009815_3970_4401 | 143 |
| 324 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_21226_21657 | 143 |
| 325 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_183780_184211 | 143 |
| 326 | 3300048907 | Ga0496104_0044843 | Ga0496104_0044843_3422_3853 | 143 |
| 327 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_454142_454573 | 143 |
| 328 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_45703_46134 | 143 |
| 329 | 3300048908 | Ga0496105_0350898 | Ga0496105_0350898_87_518 | 143 |
| 330 | 3300048909 | Ga0496106_0008407 | Ga0496106_0008407_130_561 | 143 |
| 331 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_42228_42659 | 143 |
| 332 | 3300048910 | Ga0496107_0664547 | Ga0496107_0664547_160_591 | 143 |
| 333 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_123792_124223 | 143 |
| 334 | 3300048911 | Ga0496108_1700842 | Ga0496108_1700842_30_467 | 143 |
| 335 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_410869_411300 | 143 |
| 336 | 3300048912 | Ga0496109_0970467 | Ga0496109_0970467_16_447 | 143 |
| 337 | 3300048912 | Ga0496109_1017374 | Ga0496109_1017374_325_756 | 143 |
| 338 | 3300048913 | Ga0496110_0102472 | Ga0496110_0102472_584_1021 | 143 |
| 339 | 3300048914 | Ga0496111_0085745 | Ga0496111_0085745_117_554 | 143 |
| 340 | 3300048914 | Ga0496111_0512734 | Ga0496111_0512734_68_499 | 143 |
| 341 | 3300048916 | Ga0496113_0196377 | Ga0496113_0196377_152_583 | 143 |
| 342 | 3300048917 | Ga0496114_0000056 | Ga0496114_0000056_9956_10387 | 143 |
| 343 | 3300048917 | Ga0496114_0264392 | Ga0496114_0264392_568_999 | 143 |
| 344 | 3300048918 | Ga0496115_0000016 | Ga0496115_0000016_162632_163063 | 143 |
| 345 | 3300048918 | Ga0496115_0000031 | Ga0496115_0000031_10147_10578 | 143 |
| 346 | 3300048919 | Ga0496116_0000257 | Ga0496116_0000257_36478_36909 | 143 |
| 347 | 3300048920 | Ga0496117_0006062 | Ga0496117_0006062_7918_8349 | 143 |
| 348 | 3300048921 | Ga0496118_0005497 | Ga0496118_0005497_6392_6823 | 143 |
| 349 | 3300048921 | Ga0496118_0172587 | Ga0496118_0172587_230_661 | 143 |
| 350 | 3300048922 | Ga0496119_0003792 | Ga0496119_0003792_8075_8506 | 143 |
| 351 | 3300048922 | Ga0496119_0011399 | Ga0496119_0011399_6877_7308 | 143 |
| 352 | 3300048922 | Ga0496119_0037506 | Ga0496119_0037506_676_1107 | 143 |
| 353 | 3300048923 | Ga0496120_0006686 | Ga0496120_0006686_6009_6440 | 143 |
| 354 | 3300048923 | Ga0496120_0016516 | Ga0496120_0016516_4314_4745 | 143 |
| 355 | 3300048923 | Ga0496120_0204359 | Ga0496120_0204359_389_820 | 143 |
| 356 | 3300048924 | Ga0496121_0010139 | Ga0496121_0010139_6439_6870 | 143 |
| 357 | 3300048924 | Ga0496121_0027375 | Ga0496121_0027375_3251_3682 | 143 |
| 358 | 3300048924 | Ga0496121_0166734 | Ga0496121_0166734_666_1097 | 143 |
| 359 | 3300048924 | Ga0496121_0189249 | Ga0496121_0189249_925_1356 | 143 |
| 360 | 3300048928 | Ga0496125_0096766 | Ga0496125_0096766_255_686 | 143 |
| 361 | 3300048928 | Ga0496125_0111780 | Ga0496125_0111780_836_1267 | 143 |
| 362 | 3300048929 | Ga0496126_0011501 | Ga0496126_0011501_2241_2672 | 143 |
| 363 | 3300049569 | Ga0501032_0228799 | Ga0501032_0228799_532_963 | 143 |
| 364 | 3300049576 | Ga0501040_0117557 | Ga0501040_0117557_795_1226 | 143 |
| 365 | 3300049578 | Ga0501042_0074187 | Ga0501042_0074187_1936_2367 | 143 |
| 366 | 3300049578 | Ga0501042_0210249 | Ga0501042_0210249_896_1336 | 143 |
| 367 | 3300049579 | Ga0501043_0288281 | Ga0501043_0288281_724_1155 | 143 |
| 368 | 3300049581 | Ga0501047_0004429 | Ga0501047_0004429_7534_7965 | 143 |
| 369 | 3300049581 | Ga0501047_0267968 | Ga0501047_0267968_312_743 | 143 |
| 370 | 3300049581 | Ga0501047_0347789 | Ga0501047_0347789_479_910 | 143 |
| 371 | 3300049584 | Ga0501068_0185815 | Ga0501068_0185815_473_904 | 143 |
| 372 | 3300049586 | Ga0501070_0049701 | Ga0501070_0049701_2584_3015 | 143 |
| 373 | 3300049586 | Ga0501070_0169038 | Ga0501070_0169038_861_1292 | 143 |
| 374 | 3300049586 | Ga0501070_0791277 | Ga0501070_0791277_274_708 | 143 |
| 375 | 3300049587 | Ga0501071_0074171 | Ga0501071_0074171_1275_1706 | 143 |
| 376 | 3300049590 | Ga0501074_1301709 | Ga0501074_1301709_47_478 | 143 |
| 377 | 3300049741 | Ga0501079_0337464 | Ga0501079_0337464_13_444 | 143 |
| 378 | 3300049823 | Ga0501044_0018065 | Ga0501044_0018065_5900_6331 | 143 |
| 379 | 3300049823 | Ga0501044_0075446 | Ga0501044_0075446_2922_3353 | 143 |
| 380 | 3300049823 | Ga0501044_0187850 | Ga0501044_0187850_726_1157 | 143 |
| 381 | 3300050509 | nmdc:mga0qj67_357594_c1 | nmdc:mga0qj67_357594_c1_474_905 | 143 |
| 382 | 3300050513 | nmdc:mga0rr50_586239_c1 | nmdc:mga0rr50_586239_c1_264_695 | 143 |
| 383 | 3300050515 | nmdc:mga0a205_94_c1 | nmdc:mga0a205_94_c1_40486_40917 | 143 |
| 384 | 3300053077 | Ga0495601_0116870 | Ga0495601_0116870_170_601 | 143 |
| 385 | 3300053085 | Ga0495619_0000146 | Ga0495619_0000146_13561_13992 | 143 |
| 386 | 3300053085 | Ga0495619_0000765 | Ga0495619_0000765_13044_13478 | 143 |
| 387 | 3300053085 | Ga0495619_0702728 | Ga0495619_0702728_78_509 | 143 |
| 388 | 3300053119 | Ga0500595_012921 | Ga0500595_012921_1367_1798 | 143 |
| 389 | 3300053139 | Ga0500568_0276332 | Ga0500568_0276332_104_535 | 143 |
| 390 | 3300061719 | Ga0466962_0430319 | Ga0466962_0430319_164_595 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.8462 | 1 | 142 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.8358 | 1 | 142 |
| 3ip4-assembly1.cif.gz_B | the high resolution structure of gatcab | 0.7338 | 78 | 141 |
| 4di0-assembly1.cif.gz_A | the structure of rubrerythrin from burkholderia pseudomallei | 0.4323 | 3 | 84 |
| 2xcb-assembly1.cif.gz_A | crystal structure of pcrh in complex with the chaperone binding region of popd | 0.4209 | 4 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ng6A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9473 | 86 | 142 | 1.10.10.410 |
| af_I6X831_2_93_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9367 | 3 | 85 | 1.10.1510.10 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9331 | 2 | 85 | 1.10.1510.10 |
| 1ng6A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9318 | 86 | 142 | 1.10.10.410 |
| af_Q12032_29_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9222 | 5 | 85 | 1.10.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1PXT1-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9756 | 1 | 141 |
GO:0016884
|
| AF-A0A3L7WZJ0-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9565 | 1 | 141 |
GO:0016884
|
| AF-A0A7C1PXT1-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9555 | 1 | 141 |
GO:0016884
|
| AF-A0A538A1G1-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9533 | 1 | 143 |
GO:0016884
|
| AF-A0A2M6P1Y5-F1-model_v4 | Glutamyl-tRNA amidotransferase | 0.9528 | 1 | 142 |
GO:0016884
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar