F431658

General Info

Members Datasets Scaffolds Average Seq Length
390 237 390 139

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100089144|Ga0070714_1000891442
Length 150
Sequence MPPSTLRAMSVLEQVQDDVKTAMKARDRERASALRLIVDVLQQDAKLGKGDEIAVLQRERKKRVEAAEAYEGAGRSEQAASERFEAELIEGYLPQQLSDEELAALVQEAVEETGASEQRQMGQVMSALMPKVGGRADGKRVSAAVRQKLG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
121 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 9.23
Rhizosphere 82.82
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001399 3300001977 Bacteria 3847
2 JGI24740J21852_10003738 3300001979 Bacteria 6624
3 JGI24748J21848_1000432 3300002074 Bacteria 4664
4 JGI24034J26672_10000172 3300002239 Bacteria 8945
5 JGI24742J22300_10001057 3300002244 Bacteria 4244
6 Ga0070658_10104529 3300005327 Bacteria 2343
7 Ga0070683_100079831 3300005329 Bacteria 3062
8 Ga0070683_100198214 3300005329 Unclassified 1906
9 Ga0070683_100495832 3300005329 Bacteria 1167
10 Ga0070670_100057496 3300005331 Bacteria 3339
11 Ga0070666_10017763 3300005335 Bacteria 4564
12 Ga0070682_100000011 3300005337 Bacteria 266253
13 Ga0068868_100000033 3300005338 Bacteria 75402
14 Ga0068868_100004423 3300005338 Bacteria 9856
15 Ga0070689_100067986 3300005340 Bacteria 2778
16 Ga0070691_10000036 3300005341 Bacteria 38327
17 Ga0070661_100000121 3300005344 Bacteria 65344
18 Ga0070675_100000028 3300005354 Bacteria 103914
19 Ga0070675_100664182 3300005354 Bacteria 948
20 Ga0070671_100251255 3300005355 Bacteria 1502
21 Ga0070674_100000002 3300005356 Bacteria 271088
22 Ga0070688_100000016 3300005365 Bacteria 73740
23 Ga0070688_100000277 3300005365 Bacteria 26584
24 Ga0070688_100045772 3300005365 Bacteria 2705
25 Ga0070659_100005693 3300005366 Bacteria 8968
26 Ga0070667_100015886 3300005367 Bacteria 6228
27 Ga0070714_100089144 3300005435 Bacteria 2700
28 Ga0070713_100000058 3300005436 Bacteria 70009
29 Ga0070663_100000645 3300005455 Bacteria 18730
30 Ga0070663_101960614 3300005455 Bacteria 527
31 Ga0070678_101090193 3300005456 Bacteria 737
32 Ga0070685_10000013 3300005466 Bacteria 120875
33 Ga0070685_10000053 3300005466 Bacteria 70868
34 Ga0070679_100002983 3300005530 Bacteria 15447
35 Ga0070684_100149707 3300005535 Bacteria 2114
36 Ga0070684_100267972 3300005535 Bacteria 1563
37 Ga0070684_100484337 3300005535 Bacteria 1145
38 Ga0068853_100013254 3300005539 Bacteria 6730
39 Ga0068853_100754381 3300005539 Bacteria 930
40 Ga0068853_100948933 3300005539 Bacteria 827
41 Ga0070672_100000885 3300005543 Bacteria 17980
42 Ga0070686_100364714 3300005544 Bacteria 1089
43 Ga0070695_101473962 3300005545 Bacteria 566
44 Ga0070665_100003676 3300005548 Bacteria 16257
45 Ga0070665_100066750 3300005548 Bacteria 3609
46 Ga0070665_100125086 3300005548 Bacteria 2573
47 Ga0070665_100164043 3300005548 Bacteria 2224
48 Ga0070704_100116796 3300005549 Bacteria 2041
49 Ga0068854_100000333 3300005578 Bacteria 30901
50 Ga0068856_100000237 3300005614 Bacteria 59854
51 Ga0068856_100138522 3300005614 Bacteria 2440
52 Ga0068852_100000002 3300005616 Bacteria 268221
53 Ga0068852_100029435 3300005616 Bacteria 4512
54 Ga0068864_100000015 3300005618 Bacteria 303368
55 Ga0068866_10005380 3300005718 Bacteria 5282
56 Ga0068861_101621160 3300005719 Bacteria 638
57 Ga0068851_10000126 3300005834 Bacteria 41437
58 Ga0068851_10052354 3300005834 Bacteria 2076
59 Ga0068863_100583242 3300005841 Bacteria 1106
60 Ga0068858_100064838 3300005842 Bacteria 3381
61 Ga0081455_10031059 3300005937 Bacteria 4839
62 Ga0081539_10003959 3300005985 Bacteria 17145
63 Ga0075434_100879726 3300006871 Bacteria 911
64 Ga0068865_100000042 3300006881 Bacteria 71057
65 Ga0105245_10000104 3300009098 Bacteria 80951
66 Ga0105245_10297949 3300009098 Bacteria 1581
67 Ga0105245_11503027 3300009098 Bacteria 724
68 Ga0105247_10000206 3300009101 Bacteria 57601
69 Ga0105247_10117130 3300009101 Bacteria 1721
70 Ga0105247_10256046 3300009101 Bacteria 1198
71 Ga0105243_10003464 3300009148 Bacteria 12741
72 Ga0105243_10042454 3300009148 Bacteria 3560
73 Ga0105241_10139603 3300009174 Bacteria 1971
74 Ga0105241_10620312 3300009174 Bacteria 979
75 Ga0105241_11037036 3300009174 Bacteria 769
76 Ga0105242_10000595 3300009176 Bacteria 28423
77 Ga0105242_10020610 3300009176 Bacteria 5172
78 Ga0105248_10000175 3300009177 Bacteria 74795
79 Ga0105237_10271668 3300009545 Bacteria 1698
80 Ga0105238_12761605 3300009551 Bacteria 527
81 Ga0105249_11965101 3300009553 Bacteria 658
82 Ga0105239_10035264 3300010375 Bacteria 5494
83 Ga0105239_10097042 3300010375 Bacteria 3257
84 Ga0105239_10449229 3300010375 Bacteria 1462
85 Ga0105239_13059681 3300010375 Bacteria 545
86 Ga0157342_1004560 3300012507 Bacteria 1235
87 Ga0157371_10137126 3300013102 Bacteria 1742
88 Ga0157371_10879472 3300013102 Unclassified 678
89 Ga0157370_10018997 3300013104 Bacteria 6910
90 Ga0157369_10000014 3300013105 Bacteria 266411
91 Ga0157369_11109932 3300013105 Bacteria 808
92 Ga0157374_11959513 3300013296 Bacteria 612
93 Ga0157378_10014163 3300013297 Bacteria 6978
94 Ga0157378_10034276 3300013297 Bacteria 4489
95 Ga0163162_10498625 3300013306 Bacteria 1348
96 Ga0163162_12295490 3300013306 Unclassified 620
97 Ga0157372_10000210 3300013307 Bacteria 65290
98 Ga0157372_11101156 3300013307 Bacteria 919
99 Ga0157375_10204320 3300013308 Bacteria 2132
100 Ga0163163_11140536 3300014325 Bacteria 842
101 Ga0157380_10000376 3300014326 Bacteria 26882
102 Ga0157376_10196446 3300014969 Bacteria 1853
103 Ga0157376_10491833 3300014969 Bacteria 1204
104 Ga0197907_10391901 3300020069 Unclassified 612
105 Ga0206356_10533102 3300020070 Bacteria 1726
106 Ga0206356_11239011 3300020070 Unclassified 714
107 Ga0154015_1703871 3300020610 Bacteria 1271
108 Ga0207672_1001727 3300025223 Bacteria 1516
109 Ga0207656_10000241 3300025321 Bacteria 19100
110 Ga0207656_10032190 3300025321 Bacteria 2177
111 Ga0207642_10009013 3300025899 Bacteria 3453
112 Ga0207710_10000995 3300025900 Bacteria 14820
113 Ga0207710_10066302 3300025900 Bacteria 1647
114 Ga0207710_10141677 3300025900 Bacteria 1161
115 Ga0207680_10008370 3300025903 Bacteria 5073
116 Ga0207680_10016234 3300025903 Bacteria 3904
117 Ga0207705_10069162 3300025909 Bacteria 2557
118 Ga0207654_10068827 3300025911 Bacteria 2095
119 Ga0207654_10597111 3300025911 Bacteria 787
120 Ga0207649_10000003 3300025920 Bacteria 388908
121 Ga0207649_10291798 3300025920 Bacteria 1189
122 Ga0207652_10001339 3300025921 Bacteria 21906
123 Ga0207659_10000022 3300025926 Bacteria 143432
124 Ga0207687_10000015 3300025927 Bacteria 261701
125 Ga0207687_10014656 3300025927 Bacteria 5132
126 Ga0207700_10000003 3300025928 Bacteria 500797
127 Ga0207664_10386595 3300025929 Bacteria 1243
128 Ga0207690_10007564 3300025932 Bacteria 6449
129 Ga0207686_10016434 3300025934 Bacteria 4155
130 Ga0207709_10003457 3300025935 Bacteria 9374
131 Ga0207709_10140518 3300025935 Bacteria 1659
132 Ga0207670_10043523 3300025936 Bacteria 2966
133 Ga0207669_10000003 3300025937 Bacteria 252239
134 Ga0207704_10000181 3300025938 Bacteria 33316
135 Ga0207704_10119858 3300025938 Bacteria 1798
136 Ga0207691_10000002 3300025940 Bacteria 189785
137 Ga0207711_10000006 3300025941 Bacteria 792692
138 Ga0207661_10000771 3300025944 Bacteria 20792
139 Ga0207661_10175628 3300025944 Unclassified 1867
140 Ga0207661_10436176 3300025944 Bacteria 1191
141 Ga0207668_10441333 3300025972 Bacteria 1109
142 Ga0207668_10529298 3300025972 Bacteria 1018
143 Ga0207640_10000110 3300025981 Bacteria 61907
144 Ga0207658_10004855 3300025986 Bacteria 9291
145 Ga0207658_10404956 3300025986 Bacteria 1200
146 Ga0207677_10000343 3300026023 Bacteria 33031
147 Ga0207677_10002270 3300026023 Bacteria 10097
148 Ga0207703_10286362 3300026035 Bacteria 1498
149 Ga0207639_10669825 3300026041 Bacteria 961
150 Ga0207639_10851482 3300026041 Bacteria 851
151 Ga0207678_10001707 3300026067 Bacteria 20125
152 Ga0207678_10186023 3300026067 Bacteria 1774
153 Ga0207702_10000251 3300026078 Bacteria 62222
154 Ga0207702_10121205 3300026078 Bacteria 2341
155 Ga0207702_10177191 3300026078 Bacteria 1960
156 Ga0207641_10126914 3300026088 Bacteria 2285
157 Ga0207676_10000018 3300026095 Bacteria 306375
158 Ga0207674_11709790 3300026116 Bacteria 597
159 Ga0207683_10148249 3300026121 Bacteria 2117
160 Ga0207698_10000004 3300026142 Bacteria 313614
161 Ga0207698_10588177 3300026142 Bacteria 1096
162 Ga0268266_10000491 3300028379 Bacteria 56615
163 Ga0268266_10001210 3300028379 Bacteria 31835
164 Ga0268266_10027403 3300028379 Bacteria 4845
165 Ga0268266_10042449 3300028379 Bacteria 3885
166 Ga0268264_10967389 3300028381 Bacteria 857
167 Ga0268264_11473202 3300028381 Bacteria 691
168 Ga0265326_10060471 3300028558 Bacteria 1072
169 Ga0265326_10063517 3300028558 Bacteria 1044
170 Ga0265319_1000014 3300028563 Bacteria 177623
171 Ga0265322_10095271 3300028654 Bacteria 846
172 Ga0265338_10000185 3300028800 Bacteria 116333
173 Ga0265325_10004067 3300031241 Bacteria 9322
174 Ga0307408_101348278 3300031548 Bacteria 670
175 Ga0265313_10168608 3300031595 Bacteria 926
176 Ga0265342_10198773 3300031712 Bacteria 1090
177 Ga0316593_10042696 3300032168 Bacteria 1513
178 Ga0373956_0042362 3300035119 Bacteria 2024
179 Ga0373937_0358374 3300036401 Bacteria 1382
180 Ga0400485_08097 3300038735 Bacteria 1543
181 Ga0400488_53693 3300038741 Bacteria 3997
182 Ga0400488_63097 3300038741 Bacteria 2481
183 Ga0451807_2571841 3300041486 Bacteria 952
184 Ga0451835_0419093 3300041492 Bacteria 675
185 Ga0451839_0328831 3300041496 Bacteria 797
186 Ga0451843_1030299 3300041509 Bacteria 561
187 Ga0451853_1847147 3300041512 Bacteria 1615
188 Ga0451853_2426879 3300041512 Bacteria 1429
189 Ga0466963_0019447 3300044694 Bacteria 4261
190 Ga0466963_0294730 3300044694 Bacteria 1140
191 Ga0466964_0077100 3300044706 Bacteria 1422
192 Ga0466957_0037142 3300044842 Bacteria 2932
193 Ga0466957_0223450 3300044842 Bacteria 1244
194 Ga0466957_0372680 3300044842 Bacteria 972
195 Ga0451576_0685052 3300045051 Bacteria 1077
196 Ga0466967_0693088 3300045976 Bacteria 1009
197 Ga0495592_0043726 3300046454 Bacteria 3350
198 Ga0495629_0000610 3300046459 Bacteria 29089
199 Ga0495629_0003072 3300046459 Bacteria 12684
200 Ga0495638_0042002 3300046460 Bacteria 2890
201 Ga0495651_0548372 3300046462 Bacteria 735
202 Ga0495662_0005247 3300046476 Bacteria 6495
203 Ga0495585_0172835 3300046492 Bacteria 1115
204 Ga0495594_0000006 3300046499 Bacteria 167901
205 Ga0495596_0067789 3300046500 Bacteria 1387
206 Ga0495606_0000463 3300046507 Bacteria 66752
207 Ga0495608_0000035 3300046511 Bacteria 133011
208 Ga0495618_0339175 3300046514 Bacteria 928
209 Ga0495618_0819544 3300046514 Bacteria 541
210 Ga0495620_0004866 3300046515 Bacteria 7536
211 Ga0495620_0239894 3300046515 Bacteria 692
212 Ga0495628_0322569 3300046516 Bacteria 1139
213 Ga0495630_0000060 3300046517 Bacteria 90021
214 Ga0495630_0484321 3300046517 Bacteria 948
215 Ga0495637_0095762 3300046520 Bacteria 1165
216 Ga0495587_0001789 3300046536 Bacteria 14353
217 Ga0495587_0062439 3300046536 Bacteria 2181
218 Ga0495622_0000132 3300046557 Bacteria 63863
219 Ga0495667_0000258 3300046559 Bacteria 34340
220 Ga0495656_0000800 3300046615 Bacteria 10185
221 Ga0495668_0450047 3300046616 Bacteria 709
222 Ga0495634_0000059 3300046642 Bacteria 88314
223 Ga0495634_0268206 3300046642 Bacteria 1039
224 Ga0495625_0000032 3300046660 Bacteria 233135
225 Ga0495635_0081574 3300046663 Bacteria 2213
226 Ga0495635_0666234 3300046663 Bacteria 676
227 Ga0495657_0000026 3300046675 Bacteria 133011
228 Ga0495599_0248935 3300046678 Bacteria 1082
229 Ga0495647_0000744 3300046681 Bacteria 9671
230 Ga0495658_0001858 3300046683 Bacteria 10783
231 Ga0495613_0001530 3300046689 Bacteria 17607
232 Ga0495613_0383917 3300046689 Bacteria 960
233 Ga0495624_0001926 3300046690 Bacteria 15801
234 Ga0495624_0222929 3300046690 Bacteria 1143
235 Ga0495600_0023859 3300046809 Bacteria 3935
236 Ga0495660_0111803 3300046810 Bacteria 1393
237 Ga0495604_0000100 3300047317 Bacteria 72995
238 Ga0495604_0000305 3300047317 Bacteria 44020
239 Ga0495604_0155355 3300047317 Bacteria 1621
240 Ga0495674_0000010 3300047319 Bacteria 285794
241 Ga0495672_0026553 3300047320 Bacteria 3693
242 Ga0495672_0228282 3300047320 Bacteria 915
243 Ga0495672_0335232 3300047320 Unclassified 706
244 Ga0495676_0000346 3300047321 Bacteria 37821
245 Ga0495676_0070367 3300047321 Bacteria 2695
246 Ga0495676_0081713 3300047321 Bacteria 2448
247 Ga0495676_0885687 3300047321 Unclassified 572
248 Ga0495676_1099875 3300047321 Bacteria 505
249 Ga0495680_0011360 3300047322 Bacteria 7886
250 Ga0495680_0194274 3300047322 Bacteria 1459
251 Ga0495675_0000015 3300047444 Bacteria 133004
252 Ga0495686_0110396 3300047472 Bacteria 1650
253 Ga0495593_0041691 3300047673 Bacteria 2467
254 Ga0495593_0055844 3300047673 Bacteria 2077
255 Ga0495602_0000227 3300048088 Bacteria 52680
256 Ga0495602_0001969 3300048088 Bacteria 20606
257 Ga0495602_0274728 3300048088 Bacteria 1244
258 Ga0496100_0000001 3300048903 Bacteria 530179
259 Ga0496101_0000004 3300048904 Bacteria 331599
260 Ga0496102_0002490 3300048905 Bacteria 15727
261 Ga0496102_0730182 3300048905 Unclassified 913
262 Ga0496103_0000057 3300048906 Bacteria 142223
263 Ga0496103_0009815 3300048906 Bacteria 5669
264 Ga0496103_0032772 3300048906 Bacteria 3172
265 Ga0496104_0000015 3300048907 Bacteria 374530
266 Ga0496104_0000024 3300048907 Bacteria 229913
267 Ga0496104_0044843 3300048907 Bacteria 4156
268 Ga0496104_0045264 3300048907 Bacteria 4138
269 Ga0496105_0000004 3300048908 Bacteria 475798
270 Ga0496105_0000013 3300048908 Bacteria 229894
271 Ga0496105_0350898 3300048908 Bacteria 1178
272 Ga0496106_0008407 3300048909 Bacteria 7634
273 Ga0496107_0000002 3300048910 Bacteria 320871
274 Ga0496107_0664547 3300048910 Unclassified 768
275 Ga0496108_0000005 3300048911 Bacteria 535059
276 Ga0496108_1700842 3300048911 Unclassified 519
277 Ga0496109_0000002 3300048912 Bacteria 443393
278 Ga0496109_0970467 3300048912 Bacteria 788
279 Ga0496109_1017374 3300048912 Unclassified 766
280 Ga0496110_0000357 3300048913 Bacteria 30636
281 Ga0496110_0037362 3300048913 Bacteria 4221
282 Ga0496110_0102472 3300048913 Bacteria 2567
283 Ga0496111_0000735 3300048914 Bacteria 17456
284 Ga0496111_0085745 3300048914 Bacteria 2303
285 Ga0496111_0376267 3300048914 Bacteria 1050
286 Ga0496111_0512734 3300048914 Bacteria 882
287 Ga0496113_0196377 3300048916 Bacteria 1603
288 Ga0496114_0000056 3300048917 Bacteria 95692
289 Ga0496114_0161094 3300048917 Bacteria 1951
290 Ga0496114_0264392 3300048917 Bacteria 1515
291 Ga0496115_0000016 3300048918 Bacteria 187067
292 Ga0496115_0000031 3300048918 Bacteria 138258
293 Ga0496116_0000257 3300048919 Bacteria 93214
294 Ga0496117_0006062 3300048920 Bacteria 12411
295 Ga0496118_0005497 3300048921 Bacteria 14381
296 Ga0496118_0172587 3300048921 Bacteria 1318
297 Ga0496119_0003792 3300048922 Bacteria 15458
298 Ga0496119_0011399 3300048922 Bacteria 7366
299 Ga0496119_0037506 3300048922 Bacteria 3147
300 Ga0496120_0006686 3300048923 Bacteria 8782
301 Ga0496120_0016516 3300048923 Bacteria 4825
302 Ga0496120_0204359 3300048923 Unclassified 954
303 Ga0496121_0010139 3300048924 Bacteria 10675
304 Ga0496121_0027375 3300048924 Bacteria 5336
305 Ga0496121_0166734 3300048924 Bacteria 1604
306 Ga0496121_0176305 3300048924 Unclassified 1547
307 Ga0496121_0189249 3300048924 Bacteria 1477
308 Ga0496124_0166379 3300048927 Bacteria 1713
309 Ga0496125_0096766 3300048928 Bacteria 2190
310 Ga0496125_0111780 3300048928 Bacteria 1976
311 Ga0496126_0011501 3300048929 Bacteria 9151
312 Ga0496126_0124932 3300048929 Bacteria 2228
313 Ga0496126_0364387 3300048929 Bacteria 1180
314 Ga0501031_0003339 3300049568 Bacteria 10300
315 Ga0501032_0004713 3300049569 Bacteria 10232
316 Ga0501032_0228799 3300049569 Bacteria 1209
317 Ga0501033_0000534 3300049570 Bacteria 35503
318 Ga0501034_0027350 3300049571 Bacteria 5800
319 Ga0501034_0085554 3300049571 Bacteria 3154
320 Ga0501036_0005643 3300049572 Bacteria 10150
321 Ga0501036_0896430 3300049572 Unclassified 728
322 Ga0501037_0004502 3300049573 Bacteria 10130
323 Ga0501038_0007396 3300049574 Bacteria 10128
324 Ga0501039_0035782 3300049575 Bacteria 3832
325 Ga0501040_0117557 3300049576 Bacteria 1864
326 Ga0501040_0261826 3300049576 Bacteria 1234
327 Ga0501042_0011871 3300049578 Bacteria 5885
328 Ga0501042_0074187 3300049578 Bacteria 2434
329 Ga0501042_0210249 3300049578 Bacteria 1403
330 Ga0501043_0000291 3300049579 Bacteria 45276
331 Ga0501043_0288281 3300049579 Bacteria 1257
332 Ga0501046_0010973 3300049580 Bacteria 7768
333 Ga0501047_0000313 3300049581 Bacteria 55964
334 Ga0501047_0004429 3300049581 Bacteria 13226
335 Ga0501047_0094421 3300049581 Bacteria 2870
336 Ga0501047_0267968 3300049581 Bacteria 1554
337 Ga0501047_0347789 3300049581 Bacteria 1319
338 Ga0501048_0004802 3300049582 Bacteria 10298
339 Ga0501048_0883165 3300049582 Bacteria 643
340 Ga0501068_0009843 3300049584 Bacteria 5354
341 Ga0501068_0185815 3300049584 Bacteria 1315
342 Ga0501068_0254953 3300049584 Bacteria 1119
343 Ga0501069_0009708 3300049585 Bacteria 5084
344 Ga0501070_0006008 3300049586 Bacteria 10340
345 Ga0501070_0049701 3300049586 Bacteria 3482
346 Ga0501070_0169038 3300049586 Bacteria 1801
347 Ga0501070_0791277 3300049586 Archaea 745
348 Ga0501071_0074171 3300049587 Bacteria 2483
349 Ga0501071_0534036 3300049587 Bacteria 900
350 Ga0501072_0069509 3300049588 Bacteria 2781
351 Ga0501072_0130734 3300049588 Bacteria 2001
352 Ga0501073_0004165 3300049589 Bacteria 10847
353 Ga0501074_0027191 3300049590 Bacteria 4147
354 Ga0501074_1301709 3300049590 Bacteria 509
355 Ga0501075_0213185 3300049591 Bacteria 1473
356 Ga0501076_0061827 3300049592 Bacteria 2981
357 Ga0501079_0337464 3300049741 Bacteria 1180
358 Ga0501080_0224185 3300049742 Bacteria 1719
359 Ga0501080_0749111 3300049742 Bacteria 859
360 Ga0501083_0004241 3300049744 Bacteria 10091
361 Ga0501083_0010191 3300049744 Bacteria 6622
362 Ga0501035_0000736 3300049822 Bacteria 35413
363 Ga0501035_0623700 3300049822 Unclassified 876
364 Ga0501044_0001624 3300049823 Bacteria 26339
365 Ga0501044_0018065 3300049823 Bacteria 7563
366 Ga0501044_0075446 3300049823 Bacteria 3423
367 Ga0501044_0187850 3300049823 Bacteria 2030
368 Ga0501044_0667516 3300049823 Unclassified 927
369 Ga0501045_0133258 3300049824 Bacteria 1847
370 nmdc:mga0qj67_357594_c1 3300050509 Bacteria 1180
371 nmdc:mga0rr50_586239_c1 3300050513 Bacteria 950
372 nmdc:mga0a205_94_c1 3300050515 Bacteria 50261
373 Ga0495601_0000057 3300053077 Bacteria 61510
374 Ga0495601_0111526 3300053077 Bacteria 1772
375 Ga0495601_0116870 3300053077 Bacteria 1730
376 Ga0495612_0012018 3300053078 Bacteria 3488
377 Ga0495655_0040436 3300053083 Bacteria 1187
378 Ga0495595_0000017 3300053084 Bacteria 133011
379 Ga0495619_0000144 3300053085 Bacteria 52554
380 Ga0495619_0000146 3300053085 Bacteria 52136
381 Ga0495619_0000765 3300053085 Bacteria 20982
382 Ga0495619_0001050 3300053085 Bacteria 18097
383 Ga0495619_0002751 3300053085 Bacteria 11480
384 Ga0495619_0702728 3300053085 Bacteria 687
385 Ga0500595_012921 3300053119 Bacteria 3212
386 Ga0500568_0276332 3300053139 Bacteria 610
387 Ga0501082_0043231 3300060353 Bacteria 3884
388 Ga0501082_0892201 3300060353 Bacteria 778
389 Ga0466962_0430319 3300061719 Bacteria 663
390 Ga0530510_0563804 3300061734 Bacteria 865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10449229 Ga0105239_104492292 111
2 3300044706 Ga0466964_0077100 Ga0466964_0077100_959_1408 115
3 3300005549 Ga0070704_100116796 Ga0070704_1001167964 120
4 3300035119 Ga0373956_0042362 Ga0373956_0042362_486_920 120
5 3300036401 Ga0373937_0358374 Ga0373937_0358374_256_690 120
6 3300046514 Ga0495618_0819544 Ga0495618_0819544_92_526 120
7 3300046663 Ga0495635_0666234 Ga0495635_0666234_26_460 120
8 3300047322 Ga0495680_0194274 Ga0495680_0194274_191_625 120
9 3300053077 Ga0495601_0111526 Ga0495601_0111526_179_547 120
10 3300053085 Ga0495619_0002751 Ga0495619_0002751_6247_6681 120
11 3300005614 Ga0068856_100000237 Ga0068856_10000023711 121
12 3300005616 Ga0068852_100000002 Ga0068852_10000000221 121
13 3300009177 Ga0105248_10000175 Ga0105248_1000017536 121
14 3300013102 Ga0157371_10137126 Ga0157371_101371262 121
15 3300013104 Ga0157370_10018997 Ga0157370_100189976 121
16 3300025941 Ga0207711_10000006 Ga0207711_1000000647 121
17 3300026078 Ga0207702_10000251 Ga0207702_1000025159 121
18 3300026142 Ga0207698_10000004 Ga0207698_10000004264 121
19 3300005337 Ga0070682_100000011 Ga0070682_100000011197 122
20 3300005539 Ga0068853_100754381 Ga0068853_1007543811 122
21 3300009174 Ga0105241_10139603 Ga0105241_101396033 122
22 3300025911 Ga0207654_10068827 Ga0207654_100688272 122
23 3300038741 Ga0400488_63097 Ga0400488_63097_2002_2445 122
24 3300048913 Ga0496110_0000357 Ga0496110_0000357_10059_10490 122
25 3300048914 Ga0496111_0000735 Ga0496111_0000735_6952_7383 122
26 3300049581 Ga0501047_0094421 Ga0501047_0094421_1050_1481 122
27 3300049744 Ga0501083_0010191 Ga0501083_0010191_3631_4062 122
28 3300053085 Ga0495619_0000144 Ga0495619_0000144_44382_44813 122
29 3300045051 Ga0451576_0685052 Ga0451576_0685052_508_957 125
30 3300038741 Ga0400488_53693 Ga0400488_53693_226_669 126
31 3300048924 Ga0496121_0176305 Ga0496121_0176305_337_717 126
32 3300002074 JGI24748J21848_1000432 JGI24748J21848_10004324 127
33 3300002239 JGI24034J26672_10000172 JGI24034J26672_100001729 127
34 3300002244 JGI24742J22300_10001057 JGI24742J22300_100010574 127
35 3300005354 Ga0070675_100000028 Ga0070675_10000002850 127
36 3300025223 Ga0207672_1001727 Ga0207672_10017272 127
37 3300025926 Ga0207659_10000022 Ga0207659_100000228 127
38 3300038735 Ga0400485_08097 Ga0400485_08097_866_1309 127
39 3300046459 Ga0495629_0003072 Ga0495629_0003072_2113_2544 127
40 3300048906 Ga0496103_0032772 Ga0496103_0032772_548_979 127
41 3300005436 Ga0070713_100000058 Ga0070713_10000005818 128
42 3300025928 Ga0207700_10000003 Ga0207700_10000003474 128
43 3300046559 Ga0495667_0000258 Ga0495667_0000258_26794_27231 128
44 3300047317 Ga0495604_0000100 Ga0495604_0000100_13564_13995 128
45 3300047322 Ga0495680_0011360 Ga0495680_0011360_1552_1989 128
46 3300048929 Ga0496126_0364387 Ga0496126_0364387_630_1016 128
47 3300005329 Ga0070683_100079831 Ga0070683_1000798315 129
48 3300005331 Ga0070670_100057496 Ga0070670_1000574962 129
49 3300005335 Ga0070666_10017763 Ga0070666_100177632 129
50 3300005338 Ga0068868_100004423 Ga0068868_1000044236 129
51 3300005354 Ga0070675_100664182 Ga0070675_1006641822 129
52 3300005455 Ga0070663_101960614 Ga0070663_1019606141 129
53 3300005535 Ga0070684_100484337 Ga0070684_1004843371 129
54 3300005539 Ga0068853_100948933 Ga0068853_1009489332 129
55 3300005548 Ga0070665_100003676 Ga0070665_10000367611 129
56 3300005718 Ga0068866_10005380 Ga0068866_100053808 129
57 3300005719 Ga0068861_101621160 Ga0068861_1016211602 129
58 3300005834 Ga0068851_10000126 Ga0068851_1000012628 129
59 3300005841 Ga0068863_100583242 Ga0068863_1005832422 129
60 3300005937 Ga0081455_10031059 Ga0081455_100310592 129
61 3300005985 Ga0081539_10003959 Ga0081539_1000395913 129
62 3300009101 Ga0105247_10117130 Ga0105247_101171302 129
63 3300020069 Ga0197907_10391901 Ga0197907_103919012 129
64 3300025321 Ga0207656_10000241 Ga0207656_1000024111 129
65 3300025899 Ga0207642_10009013 Ga0207642_100090133 129
66 3300025900 Ga0207710_10141677 Ga0207710_101416772 129
67 3300025903 Ga0207680_10016234 Ga0207680_100162342 129
68 3300025927 Ga0207687_10014656 Ga0207687_100146567 129
69 3300025944 Ga0207661_10000771 Ga0207661_1000077113 129
70 3300026041 Ga0207639_10851482 Ga0207639_108514822 129
71 3300026088 Ga0207641_10126914 Ga0207641_101269142 129
72 3300026121 Ga0207683_10148249 Ga0207683_101482494 129
73 3300028379 Ga0268266_10001210 Ga0268266_100012102 129
74 3300028381 Ga0268264_11473202 Ga0268264_114732022 129
75 3300028558 Ga0265326_10060471 Ga0265326_100604711 129
76 3300032168 Ga0316593_10042696 Ga0316593_100426962 129
77 3300041492 Ga0451835_0419093 Ga0451835_0419093_11_400 129
78 3300041496 Ga0451839_0328831 Ga0451839_0328831_76_507 129
79 3300044694 Ga0466963_0294730 Ga0466963_0294730_20_409 129
80 3300046515 Ga0495620_0239894 Ga0495620_0239894_282_671 129
81 3300046520 Ga0495637_0095762 Ga0495637_0095762_32_421 129
82 3300047320 Ga0495672_0228282 Ga0495672_0228282_496_885 129
83 3300047321 Ga0495676_1099875 Ga0495676_1099875_20_409 129
84 3300048913 Ga0496110_0037362 Ga0496110_0037362_716_1147 129
85 3300048914 Ga0496111_0376267 Ga0496111_0376267_239_670 129
86 3300049572 Ga0501036_0896430 Ga0501036_0896430_205_645 129
87 3300049582 Ga0501048_0883165 Ga0501048_0883165_225_614 129
88 3300049588 Ga0501072_0069509 Ga0501072_0069509_1902_2342 129
89 3300049591 Ga0501075_0213185 Ga0501075_0213185_142_582 129
90 3300049592 Ga0501076_0061827 Ga0501076_0061827_2139_2579 129
91 3300049742 Ga0501080_0749111 Ga0501080_0749111_443_832 129
92 3300061734 Ga0530510_0563804 Ga0530510_0563804_352_792 129
93 3300048917 Ga0496114_0161094 Ga0496114_0161094_798_1229 130
94 3300005356 Ga0070674_100000002 Ga0070674_100000002148 131
95 3300005842 Ga0068858_100064838 Ga0068858_1000648384 131
96 3300009148 Ga0105243_10042454 Ga0105243_100424544 131
97 3300009176 Ga0105242_10020610 Ga0105242_100206105 131
98 3300025934 Ga0207686_10016434 Ga0207686_100164345 131
99 3300025935 Ga0207709_10140518 Ga0207709_101405184 131
100 3300025937 Ga0207669_10000003 Ga0207669_10000003146 131
101 3300026035 Ga0207703_10286362 Ga0207703_102863622 131
102 3300046507 Ga0495606_0000463 Ga0495606_0000463_2252_2683 131
103 3300047673 Ga0495593_0055844 Ga0495593_0055844_432_860 131
104 3300053078 Ga0495612_0012018 Ga0495612_0012018_1454_1885 131
105 3300026041 Ga0207639_10669825 Ga0207639_106698252 132
106 3300047320 Ga0495672_0026553 Ga0495672_0026553_1422_1853 132
107 3300005365 Ga0070688_100000277 Ga0070688_10000027720 133
108 3300005466 Ga0070685_10000013 Ga0070685_10000013127 133
109 3300005539 Ga0068853_100013254 Ga0068853_1000132546 133
110 3300014326 Ga0157380_10000376 Ga0157380_1000037612 133
111 3300044694 Ga0466963_0019447 Ga0466963_0019447_2047_2478 133
112 3300060353 Ga0501082_0892201 Ga0501082_0892201_71_502 133
113 3300005616 Ga0068852_100029435 Ga0068852_1000294357 134
114 3300046492 Ga0495585_0172835 Ga0495585_0172835_524_952 136
115 3300049584 Ga0501068_0254953 Ga0501068_0254953_457_888 138
116 3300005367 Ga0070667_100015886 Ga0070667_1000158864 142
117 3300005435 Ga0070714_100089144 Ga0070714_1000891442 142
118 3300005544 Ga0070686_100364714 Ga0070686_1003647141 142
119 3300005548 Ga0070665_100125086 Ga0070665_1001250862 142
120 3300005548 Ga0070665_100164043 Ga0070665_1001640432 142
121 3300005578 Ga0068854_100000333 Ga0068854_1000003335 142
122 3300006871 Ga0075434_100879726 Ga0075434_1008797262 142
123 3300009098 Ga0105245_11503027 Ga0105245_115030272 142
124 3300009101 Ga0105247_10256046 Ga0105247_102560462 142
125 3300012507 Ga0157342_1004560 Ga0157342_10045602 142
126 3300013307 Ga0157372_10000210 Ga0157372_1000021031 142
127 3300013308 Ga0157375_10204320 Ga0157375_102043204 142
128 3300020610 Ga0154015_1703871 Ga0154015_17038713 142
129 3300025900 Ga0207710_10066302 Ga0207710_100663022 142
130 3300025903 Ga0207680_10008370 Ga0207680_100083702 142
131 3300025929 Ga0207664_10386595 Ga0207664_103865952 142
132 3300025972 Ga0207668_10529298 Ga0207668_105292982 142
133 3300025981 Ga0207640_10000110 Ga0207640_100001104 142
134 3300025986 Ga0207658_10004855 Ga0207658_1000485510 142
135 3300028379 Ga0268266_10000491 Ga0268266_1000049143 142
136 3300028379 Ga0268266_10027403 Ga0268266_100274037 142
137 3300028381 Ga0268264_10967389 Ga0268264_109673892 142
138 3300031548 Ga0307408_101348278 Ga0307408_1013482781 142
139 3300044842 Ga0466957_0223450 Ga0466957_0223450_553_981 142
140 3300046511 Ga0495608_0000035 Ga0495608_0000035_9094_9522 142
141 3300046675 Ga0495657_0000026 Ga0495657_0000026_123490_123918 142
142 3300046683 Ga0495658_0001858 Ga0495658_0001858_5120_5548 142
143 3300046689 Ga0495613_0001530 Ga0495613_0001530_7158_7586 142
144 3300046809 Ga0495600_0023859 Ga0495600_0023859_2697_3125 142
145 3300047317 Ga0495604_0000305 Ga0495604_0000305_17402_17830 142
146 3300047317 Ga0495604_0155355 Ga0495604_0155355_627_1055 142
147 3300047444 Ga0495675_0000015 Ga0495675_0000015_123483_123911 142
148 3300047472 Ga0495686_0110396 Ga0495686_0110396_842_1270 142
149 3300048088 Ga0495602_0000227 Ga0495602_0000227_42520_42948 142
150 3300048907 Ga0496104_0045264 Ga0496104_0045264_2895_3323 142
151 3300048927 Ga0496124_0166379 Ga0496124_0166379_861_1289 142
152 3300048929 Ga0496126_0124932 Ga0496126_0124932_662_1090 142
153 3300049568 Ga0501031_0003339 Ga0501031_0003339_1149_1577 142
154 3300049569 Ga0501032_0004713 Ga0501032_0004713_8771_9199 142
155 3300049570 Ga0501033_0000534 Ga0501033_0000534_8877_9305 142
156 3300049571 Ga0501034_0027350 Ga0501034_0027350_4877_5305 142
157 3300049571 Ga0501034_0085554 Ga0501034_0085554_496_924 142
158 3300049572 Ga0501036_0005643 Ga0501036_0005643_8766_9194 142
159 3300049573 Ga0501037_0004502 Ga0501037_0004502_948_1376 142
160 3300049574 Ga0501038_0007396 Ga0501038_0007396_8783_9211 142
161 3300049575 Ga0501039_0035782 Ga0501039_0035782_2510_2938 142
162 3300049576 Ga0501040_0261826 Ga0501040_0261826_653_1081 142
163 3300049578 Ga0501042_0011871 Ga0501042_0011871_912_1340 142
164 3300049579 Ga0501043_0000291 Ga0501043_0000291_36089_36517 142
165 3300049580 Ga0501046_0010973 Ga0501046_0010973_6157_6585 142
166 3300049581 Ga0501047_0000313 Ga0501047_0000313_8789_9217 142
167 3300049582 Ga0501048_0004802 Ga0501048_0004802_8704_9132 142
168 3300049584 Ga0501068_0009843 Ga0501068_0009843_3999_4427 142
169 3300049585 Ga0501069_0009708 Ga0501069_0009708_773_1201 142
170 3300049586 Ga0501070_0006008 Ga0501070_0006008_1147_1575 142
171 3300049587 Ga0501071_0534036 Ga0501071_0534036_223_651 142
172 3300049588 Ga0501072_0130734 Ga0501072_0130734_910_1338 142
173 3300049589 Ga0501073_0004165 Ga0501073_0004165_8699_9127 142
174 3300049590 Ga0501074_0027191 Ga0501074_0027191_3478_3906 142
175 3300049742 Ga0501080_0224185 Ga0501080_0224185_1190_1618 142
176 3300049744 Ga0501083_0004241 Ga0501083_0004241_8752_9180 142
177 3300049822 Ga0501035_0000736 Ga0501035_0000736_8767_9195 142
178 3300049822 Ga0501035_0623700 Ga0501035_0623700_217_645 142
179 3300049823 Ga0501044_0001624 Ga0501044_0001624_24752_25180 142
180 3300049823 Ga0501044_0667516 Ga0501044_0667516_482_910 142
181 3300049824 Ga0501045_0133258 Ga0501045_0133258_613_1041 142
182 3300053077 Ga0495601_0000057 Ga0495601_0000057_10004_10432 142
183 3300053083 Ga0495655_0040436 Ga0495655_0040436_442_870 142
184 3300053084 Ga0495595_0000017 Ga0495595_0000017_123490_123918 142
185 3300053085 Ga0495619_0001050 Ga0495619_0001050_8576_9004 142
186 3300060353 Ga0501082_0043231 Ga0501082_0043231_856_1284 142
187 3300001977 JGI24746J21847_1001399 JGI24746J21847_10013994 143
188 3300001979 JGI24740J21852_10003738 JGI24740J21852_100037388 143
189 3300005327 Ga0070658_10104529 Ga0070658_101045295 143
190 3300005329 Ga0070683_100198214 Ga0070683_1001982142 143
191 3300005329 Ga0070683_100495832 Ga0070683_1004958322 143
192 3300005338 Ga0068868_100000033 Ga0068868_10000003342 143
193 3300005340 Ga0070689_100067986 Ga0070689_1000679863 143
194 3300005341 Ga0070691_10000036 Ga0070691_1000003620 143
195 3300005344 Ga0070661_100000121 Ga0070661_10000012121 143
196 3300005355 Ga0070671_100251255 Ga0070671_1002512552 143
197 3300005365 Ga0070688_100000016 Ga0070688_10000001613 143
198 3300005365 Ga0070688_100045772 Ga0070688_1000457724 143
199 3300005366 Ga0070659_100005693 Ga0070659_10000569311 143
200 3300005455 Ga0070663_100000645 Ga0070663_10000064519 143
201 3300005456 Ga0070678_101090193 Ga0070678_1010901931 143
202 3300005466 Ga0070685_10000053 Ga0070685_1000005325 143
203 3300005530 Ga0070679_100002983 Ga0070679_1000029834 143
204 3300005535 Ga0070684_100149707 Ga0070684_1001497074 143
205 3300005535 Ga0070684_100267972 Ga0070684_1002679722 143
206 3300005543 Ga0070672_100000885 Ga0070672_10000088512 143
207 3300005545 Ga0070695_101473962 Ga0070695_1014739621 143
208 3300005548 Ga0070665_100066750 Ga0070665_1000667502 143
209 3300005614 Ga0068856_100138522 Ga0068856_1001385222 143
210 3300005618 Ga0068864_100000015 Ga0068864_10000001521 143
211 3300005834 Ga0068851_10052354 Ga0068851_100523543 143
212 3300006881 Ga0068865_100000042 Ga0068865_10000004245 143
213 3300009098 Ga0105245_10000104 Ga0105245_1000010441 143
214 3300009098 Ga0105245_10297949 Ga0105245_102979491 143
215 3300009101 Ga0105247_10000206 Ga0105247_1000020624 143
216 3300009148 Ga0105243_10003464 Ga0105243_1000346413 143
217 3300009174 Ga0105241_10620312 Ga0105241_106203122 143
218 3300009174 Ga0105241_11037036 Ga0105241_110370362 143
219 3300009176 Ga0105242_10000595 Ga0105242_1000059519 143
220 3300009545 Ga0105237_10271668 Ga0105237_102716682 143
221 3300009551 Ga0105238_12761605 Ga0105238_127616051 143
222 3300009553 Ga0105249_11965101 Ga0105249_119651011 143
223 3300010375 Ga0105239_10035264 Ga0105239_100352647 143
224 3300010375 Ga0105239_10097042 Ga0105239_100970425 143
225 3300010375 Ga0105239_13059681 Ga0105239_130596811 143
226 3300013102 Ga0157371_10879472 Ga0157371_108794722 143
227 3300013105 Ga0157369_10000014 Ga0157369_10000014130 143
228 3300013105 Ga0157369_11109932 Ga0157369_111099322 143
229 3300013296 Ga0157374_11959513 Ga0157374_119595131 143
230 3300013297 Ga0157378_10014163 Ga0157378_100141636 143
231 3300013297 Ga0157378_10034276 Ga0157378_100342762 143
232 3300013306 Ga0163162_10498625 Ga0163162_104986252 143
233 3300013306 Ga0163162_12295490 Ga0163162_122954902 143
234 3300013307 Ga0157372_11101156 Ga0157372_111011562 143
235 3300014325 Ga0163163_11140536 Ga0163163_111405362 143
236 3300014969 Ga0157376_10196446 Ga0157376_101964462 143
237 3300014969 Ga0157376_10491833 Ga0157376_104918332 143
238 3300020070 Ga0206356_10533102 Ga0206356_105331022 143
239 3300020070 Ga0206356_11239011 Ga0206356_112390112 143
240 3300025321 Ga0207656_10032190 Ga0207656_100321904 143
241 3300025900 Ga0207710_10000995 Ga0207710_1000099516 143
242 3300025909 Ga0207705_10069162 Ga0207705_100691625 143
243 3300025911 Ga0207654_10597111 Ga0207654_105971112 143
244 3300025920 Ga0207649_10000003 Ga0207649_10000003278 143
245 3300025920 Ga0207649_10291798 Ga0207649_102917983 143
246 3300025921 Ga0207652_10001339 Ga0207652_1000133922 143
247 3300025927 Ga0207687_10000015 Ga0207687_10000015223 143
248 3300025932 Ga0207690_10007564 Ga0207690_100075648 143
249 3300025935 Ga0207709_10003457 Ga0207709_100034578 143
250 3300025936 Ga0207670_10043523 Ga0207670_100435233 143
251 3300025938 Ga0207704_10000181 Ga0207704_1000018122 143
252 3300025938 Ga0207704_10119858 Ga0207704_101198584 143
253 3300025940 Ga0207691_10000002 Ga0207691_10000002152 143
254 3300025944 Ga0207661_10175628 Ga0207661_101756284 143
255 3300025944 Ga0207661_10436176 Ga0207661_104361762 143
256 3300025972 Ga0207668_10441333 Ga0207668_104413332 143
257 3300025986 Ga0207658_10404956 Ga0207658_104049562 143
258 3300026023 Ga0207677_10000343 Ga0207677_1000034331 143
259 3300026023 Ga0207677_10002270 Ga0207677_100022706 143
260 3300026067 Ga0207678_10001707 Ga0207678_100017073 143
261 3300026067 Ga0207678_10186023 Ga0207678_101860232 143
262 3300026078 Ga0207702_10121205 Ga0207702_101212052 143
263 3300026078 Ga0207702_10177191 Ga0207702_101771911 143
264 3300026095 Ga0207676_10000018 Ga0207676_10000018279 143
265 3300026116 Ga0207674_11709790 Ga0207674_117097902 143
266 3300026142 Ga0207698_10588177 Ga0207698_105881773 143
267 3300028379 Ga0268266_10042449 Ga0268266_100424492 143
268 3300028558 Ga0265326_10063517 Ga0265326_100635173 143
269 3300028563 Ga0265319_1000014 Ga0265319_10000148 143
270 3300028654 Ga0265322_10095271 Ga0265322_100952712 143
271 3300028800 Ga0265338_10000185 Ga0265338_100001856 143
272 3300031241 Ga0265325_10004067 Ga0265325_100040676 143
273 3300031595 Ga0265313_10168608 Ga0265313_101686082 143
274 3300031712 Ga0265342_10198773 Ga0265342_101987732 143
275 3300041486 Ga0451807_2571841 Ga0451807_2571841_496_927 143
276 3300041509 Ga0451843_1030299 Ga0451843_1030299_97_528 143
277 3300041512 Ga0451853_1847147 Ga0451853_1847147_370_801 143
278 3300041512 Ga0451853_2426879 Ga0451853_2426879_116_547 143
279 3300044842 Ga0466957_0037142 Ga0466957_0037142_373_804 143
280 3300044842 Ga0466957_0372680 Ga0466957_0372680_95_526 143
281 3300045976 Ga0466967_0693088 Ga0466967_0693088_72_503 143
282 3300046454 Ga0495592_0043726 Ga0495592_0043726_2261_2692 143
283 3300046459 Ga0495629_0000610 Ga0495629_0000610_1804_2235 143
284 3300046460 Ga0495638_0042002 Ga0495638_0042002_484_915 143
285 3300046462 Ga0495651_0548372 Ga0495651_0548372_118_549 143
286 3300046476 Ga0495662_0005247 Ga0495662_0005247_3982_4413 143
287 3300046499 Ga0495594_0000006 Ga0495594_0000006_72284_72715 143
288 3300046500 Ga0495596_0067789 Ga0495596_0067789_511_948 143
289 3300046514 Ga0495618_0339175 Ga0495618_0339175_100_531 143
290 3300046515 Ga0495620_0004866 Ga0495620_0004866_6897_7328 143
291 3300046516 Ga0495628_0322569 Ga0495628_0322569_613_1044 143
292 3300046517 Ga0495630_0000060 Ga0495630_0000060_81600_82031 143
293 3300046517 Ga0495630_0484321 Ga0495630_0484321_215_646 143
294 3300046536 Ga0495587_0001789 Ga0495587_0001789_10828_11259 143
295 3300046536 Ga0495587_0062439 Ga0495587_0062439_390_821 143
296 3300046557 Ga0495622_0000132 Ga0495622_0000132_44993_45424 143
297 3300046615 Ga0495656_0000800 Ga0495656_0000800_5653_6084 143
298 3300046616 Ga0495668_0450047 Ga0495668_0450047_162_599 143
299 3300046642 Ga0495634_0000059 Ga0495634_0000059_78016_78447 143
300 3300046642 Ga0495634_0268206 Ga0495634_0268206_319_753 143
301 3300046660 Ga0495625_0000032 Ga0495625_0000032_92557_92988 143
302 3300046663 Ga0495635_0081574 Ga0495635_0081574_150_584 143
303 3300046678 Ga0495599_0248935 Ga0495599_0248935_227_658 143
304 3300046681 Ga0495647_0000744 Ga0495647_0000744_407_838 143
305 3300046689 Ga0495613_0383917 Ga0495613_0383917_52_483 143
306 3300046690 Ga0495624_0001926 Ga0495624_0001926_5218_5649 143
307 3300046690 Ga0495624_0222929 Ga0495624_0222929_186_620 143
308 3300046810 Ga0495660_0111803 Ga0495660_0111803_57_488 143
309 3300047319 Ga0495674_0000010 Ga0495674_0000010_165572_166003 143
310 3300047320 Ga0495672_0335232 Ga0495672_0335232_249_680 143
311 3300047321 Ga0495676_0000346 Ga0495676_0000346_33940_34371 143
312 3300047321 Ga0495676_0070367 Ga0495676_0070367_447_878 143
313 3300047321 Ga0495676_0081713 Ga0495676_0081713_13_444 143
314 3300047321 Ga0495676_0885687 Ga0495676_0885687_45_476 143
315 3300047673 Ga0495593_0041691 Ga0495593_0041691_489_920 143
316 3300048088 Ga0495602_0001969 Ga0495602_0001969_10114_10545 143
317 3300048088 Ga0495602_0274728 Ga0495602_0274728_237_668 143
318 3300048903 Ga0496100_0000001 Ga0496100_0000001_205829_206260 143
319 3300048904 Ga0496101_0000004 Ga0496101_0000004_7181_7612 143
320 3300048905 Ga0496102_0002490 Ga0496102_0002490_10065_10496 143
321 3300048905 Ga0496102_0730182 Ga0496102_0730182_309_746 143
322 3300048906 Ga0496103_0000057 Ga0496103_0000057_100816_101247 143
323 3300048906 Ga0496103_0009815 Ga0496103_0009815_3970_4401 143
324 3300048907 Ga0496104_0000015 Ga0496104_0000015_21226_21657 143
325 3300048907 Ga0496104_0000024 Ga0496104_0000024_183780_184211 143
326 3300048907 Ga0496104_0044843 Ga0496104_0044843_3422_3853 143
327 3300048908 Ga0496105_0000004 Ga0496105_0000004_454142_454573 143
328 3300048908 Ga0496105_0000013 Ga0496105_0000013_45703_46134 143
329 3300048908 Ga0496105_0350898 Ga0496105_0350898_87_518 143
330 3300048909 Ga0496106_0008407 Ga0496106_0008407_130_561 143
331 3300048910 Ga0496107_0000002 Ga0496107_0000002_42228_42659 143
332 3300048910 Ga0496107_0664547 Ga0496107_0664547_160_591 143
333 3300048911 Ga0496108_0000005 Ga0496108_0000005_123792_124223 143
334 3300048911 Ga0496108_1700842 Ga0496108_1700842_30_467 143
335 3300048912 Ga0496109_0000002 Ga0496109_0000002_410869_411300 143
336 3300048912 Ga0496109_0970467 Ga0496109_0970467_16_447 143
337 3300048912 Ga0496109_1017374 Ga0496109_1017374_325_756 143
338 3300048913 Ga0496110_0102472 Ga0496110_0102472_584_1021 143
339 3300048914 Ga0496111_0085745 Ga0496111_0085745_117_554 143
340 3300048914 Ga0496111_0512734 Ga0496111_0512734_68_499 143
341 3300048916 Ga0496113_0196377 Ga0496113_0196377_152_583 143
342 3300048917 Ga0496114_0000056 Ga0496114_0000056_9956_10387 143
343 3300048917 Ga0496114_0264392 Ga0496114_0264392_568_999 143
344 3300048918 Ga0496115_0000016 Ga0496115_0000016_162632_163063 143
345 3300048918 Ga0496115_0000031 Ga0496115_0000031_10147_10578 143
346 3300048919 Ga0496116_0000257 Ga0496116_0000257_36478_36909 143
347 3300048920 Ga0496117_0006062 Ga0496117_0006062_7918_8349 143
348 3300048921 Ga0496118_0005497 Ga0496118_0005497_6392_6823 143
349 3300048921 Ga0496118_0172587 Ga0496118_0172587_230_661 143
350 3300048922 Ga0496119_0003792 Ga0496119_0003792_8075_8506 143
351 3300048922 Ga0496119_0011399 Ga0496119_0011399_6877_7308 143
352 3300048922 Ga0496119_0037506 Ga0496119_0037506_676_1107 143
353 3300048923 Ga0496120_0006686 Ga0496120_0006686_6009_6440 143
354 3300048923 Ga0496120_0016516 Ga0496120_0016516_4314_4745 143
355 3300048923 Ga0496120_0204359 Ga0496120_0204359_389_820 143
356 3300048924 Ga0496121_0010139 Ga0496121_0010139_6439_6870 143
357 3300048924 Ga0496121_0027375 Ga0496121_0027375_3251_3682 143
358 3300048924 Ga0496121_0166734 Ga0496121_0166734_666_1097 143
359 3300048924 Ga0496121_0189249 Ga0496121_0189249_925_1356 143
360 3300048928 Ga0496125_0096766 Ga0496125_0096766_255_686 143
361 3300048928 Ga0496125_0111780 Ga0496125_0111780_836_1267 143
362 3300048929 Ga0496126_0011501 Ga0496126_0011501_2241_2672 143
363 3300049569 Ga0501032_0228799 Ga0501032_0228799_532_963 143
364 3300049576 Ga0501040_0117557 Ga0501040_0117557_795_1226 143
365 3300049578 Ga0501042_0074187 Ga0501042_0074187_1936_2367 143
366 3300049578 Ga0501042_0210249 Ga0501042_0210249_896_1336 143
367 3300049579 Ga0501043_0288281 Ga0501043_0288281_724_1155 143
368 3300049581 Ga0501047_0004429 Ga0501047_0004429_7534_7965 143
369 3300049581 Ga0501047_0267968 Ga0501047_0267968_312_743 143
370 3300049581 Ga0501047_0347789 Ga0501047_0347789_479_910 143
371 3300049584 Ga0501068_0185815 Ga0501068_0185815_473_904 143
372 3300049586 Ga0501070_0049701 Ga0501070_0049701_2584_3015 143
373 3300049586 Ga0501070_0169038 Ga0501070_0169038_861_1292 143
374 3300049586 Ga0501070_0791277 Ga0501070_0791277_274_708 143
375 3300049587 Ga0501071_0074171 Ga0501071_0074171_1275_1706 143
376 3300049590 Ga0501074_1301709 Ga0501074_1301709_47_478 143
377 3300049741 Ga0501079_0337464 Ga0501079_0337464_13_444 143
378 3300049823 Ga0501044_0018065 Ga0501044_0018065_5900_6331 143
379 3300049823 Ga0501044_0075446 Ga0501044_0075446_2922_3353 143
380 3300049823 Ga0501044_0187850 Ga0501044_0187850_726_1157 143
381 3300050509 nmdc:mga0qj67_357594_c1 nmdc:mga0qj67_357594_c1_474_905 143
382 3300050513 nmdc:mga0rr50_586239_c1 nmdc:mga0rr50_586239_c1_264_695 143
383 3300050515 nmdc:mga0a205_94_c1 nmdc:mga0a205_94_c1_40486_40917 143
384 3300053077 Ga0495601_0116870 Ga0495601_0116870_170_601 143
385 3300053085 Ga0495619_0000146 Ga0495619_0000146_13561_13992 143
386 3300053085 Ga0495619_0000765 Ga0495619_0000765_13044_13478 143
387 3300053085 Ga0495619_0702728 Ga0495619_0702728_78_509 143
388 3300053119 Ga0500595_012921 Ga0500595_012921_1367_1798 143
389 3300053139 Ga0500568_0276332 Ga0500568_0276332_104_535 143
390 3300061719 Ga0466962_0430319 Ga0466962_0430319_164_595 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

12

149

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8462 1 142
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8358 1 142
3ip4-assembly1.cif.gz_B the high resolution structure of gatcab 0.7338 78 141
4di0-assembly1.cif.gz_A the structure of rubrerythrin from burkholderia pseudomallei 0.4323 3 84
2xcb-assembly1.cif.gz_A crystal structure of pcrh in complex with the chaperone binding region of popd 0.4209 4 86
ID Description Score Start End Superfamily
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9473 86 142 1.10.10.410
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9367 3 85 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9331 2 85 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9318 86 142 1.10.10.410
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9222 5 85 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A7C1PXT1-F1-model_v4 GatB/YqeY domain-containing protein 0.9756 1 141 GO:0016884
AF-A0A3L7WZJ0-F1-model_v4 GatB/YqeY domain-containing protein 0.9565 1 141 GO:0016884
AF-A0A7C1PXT1-F1-model_v4 GatB/YqeY domain-containing protein 0.9555 1 141 GO:0016884
AF-A0A538A1G1-F1-model_v4 GatB/YqeY domain-containing protein 0.9533 1 143 GO:0016884
AF-A0A2M6P1Y5-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9528 1 142 GO:0016884

Feature Viewer

pLDDT pTM Quality
93.07 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map