F431650

General Info

Members Datasets Scaffolds Average Seq Length
390 218 378 115

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101470625|Ga0070669_1014706251
Length 136
Sequence VKTVCPVKFRAKLPLPELAWPAMPLDRLLPIFLLLGSNVFMTFAWYGHLRFKTVPLGLAILASWGIALFEYTLMVPANRWGSAVYSAPQLKGMQEVITLVVFAGFSAWYLGQPLKWNHWAGFALIAVAAWLIFLEP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
5 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
6 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
7 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
8 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
9 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
10 2919513703 Luteimonas sp. 3794 Isolate Unclassified
11 2919675420 Luteimonas terrae 4099 Isolate Unclassified
12 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
42 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
43 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
44 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
45 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
46 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
47 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
90 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
176 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
197 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
198 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
201 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
202 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
205 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
209 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
210 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
211 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
212 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
213 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
214 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.33
Nodule 0
Rhizoplane 7.44
Rhizosphere 70.26
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_123878 2162886007 Bacteria 2564
2 JGI25151J46595_10000361 3300003187 Bacteria 47909
3 JGI25151J46595_10053505 3300003187 Bacteria 1348
4 JGI25151J46595_10097324 3300003187 Bacteria 802
5 JGI26143J51219_1003605 3300003502 Bacteria 723
6 Ga0055526_1000072 3300003771 Bacteria 94464
7 Ga0055526_1008020 3300003771 Bacteria 5346
8 Ga0055537_1000412 3300003773 Bacteria 28027
9 Ga0055524_1000173 3300003775 Bacteria 73388
10 Ga0055524_1033572 3300003775 Bacteria 1434
11 Ga0055536_1017664 3300003781 Bacteria 2323
12 Ga0055534_1000077 3300003784 Bacteria 76400
13 Ga0055534_1013900 3300003784 Bacteria 1528
14 Ga0055528_1000085 3300003790 Bacteria 73426
15 Ga0055531_10041694 3300003794 Bacteria 1324
16 Ga0065714_10015082 3300005288 Bacteria 1927
17 Ga0065704_10000583 3300005289 Bacteria 18226
18 Ga0065704_10147326 3300005289 Bacteria 1459
19 Ga0065704_10148401 3300005289 Bacteria 1451
20 Ga0065704_10217373 3300005289 Bacteria 1086
21 Ga0065715_10036727 3300005293 Bacteria 1307
22 Ga0065715_10092549 3300005293 Bacteria 5063
23 Ga0065715_10142965 3300005293 Bacteria 1815
24 Ga0070670_100268606 3300005331 Bacteria 1488
25 Ga0070670_100545514 3300005331 Bacteria 1034
26 Ga0070668_100581899 3300005347 Bacteria 977
27 Ga0070669_100025134 3300005353 Bacteria 4276
28 Ga0070669_101470625 3300005353 Bacteria 592
29 Ga0070669_102052790 3300005353 Bacteria 500
30 Ga0070671_100035437 3300005355 Bacteria 4134
31 Ga0070671_100110464 3300005355 Bacteria 2309
32 Ga0070679_100518259 3300005530 Bacteria 1136
33 Ga0068854_100992195 3300005578 Bacteria 743
34 Ga0068851_10156525 3300005834 Bacteria 1249
35 Ga0068863_100158160 3300005841 Bacteria 2170
36 Ga0075364_10000070 3300006051 Bacteria 39526
37 Ga0075364_10125513 3300006051 Bacteria 1720
38 Ga0075364_10159149 3300006051 Bacteria 1524
39 Ga0075369_10462594 3300006186 Bacteria 601
40 Ga0105250_10224673 3300009092 Bacteria 797
41 Ga0105248_11074388 3300009177 Bacteria 909
42 Ga0105249_11175031 3300009553 Bacteria 838
43 Ga0105029_101901 3300009984 Bacteria 1331
44 Ga0105028_104087 3300009993 Bacteria 1522
45 Ga0105239_12478731 3300010375 Bacteria 604
46 Ga0157318_1000255 3300012482 Bacteria 2098
47 Ga0157322_1027949 3300012490 Bacteria 585
48 Ga0157314_1045772 3300012500 Bacteria 544
49 Ga0157316_1000222 3300012510 Bacteria 2780
50 Ga0157316_1031329 3300012510 Bacteria 646
51 Ga0157327_1034322 3300012512 Bacteria 650
52 Ga0157326_1019964 3300012513 Bacteria 820
53 Ga0157338_1018801 3300012515 Bacteria 786
54 Ga0157371_10044436 3300013102 Bacteria 3163
55 Ga0157370_10042408 3300013104 Bacteria 4386
56 Ga0157370_10765633 3300013104 Bacteria 879
57 Ga0157378_10168883 3300013297 Bacteria 2050
58 Ga0163162_11088738 3300013306 Bacteria 905
59 Ga0157372_10933264 3300013307 Bacteria 1006
60 Ga0157380_10237356 3300014326 Bacteria 1641
61 Ga0157380_12027322 3300014326 Bacteria 637
62 Ga0182008_10030320 3300014497 Bacteria 2726
63 Ga0182006_1008198 3300015261 Bacteria 4739
64 Ga0183360_10001 3300015689 Bacteria 3943671
65 Ga0163161_11938313 3300017792 Bacteria 524
66 Ga0207425_1016972 3300025245 Bacteria 1608
67 Ga0207425_1046416 3300025245 Bacteria 809
68 Ga0209565_1000001 3300025263 Bacteria 2950419
69 Ga0209565_1004969 3300025263 Bacteria 3950
70 Ga0209673_1000001 3300025273 Bacteria 3176258
71 Ga0209673_1042282 3300025273 Bacteria 1283
72 Ga0209675_1000001 3300025291 Bacteria 2950293
73 Ga0209675_1014049 3300025291 Bacteria 2461
74 Ga0209676_1000129 3300025292 Bacteria 187495
75 Ga0209676_1001943 3300025292 Bacteria 16653
76 Ga0209676_1001947 3300025292 Bacteria 16626
77 Ga0209676_1019065 3300025292 Bacteria 2371
78 Ga0209025_1000006 3300025294 Bacteria 1153444
79 Ga0209025_1002378 3300025294 Bacteria 20139
80 Ga0209025_1008259 3300025294 Bacteria 7522
81 Ga0209564_1000001 3300025295 Bacteria 3176258
82 Ga0209564_1010773 3300025295 Bacteria 4169
83 Ga0209758_1007486 3300025297 Bacteria 7408
84 Ga0209758_1088004 3300025297 Bacteria 918
85 Ga0209050_1005770 3300025298 Bacteria 7626
86 Ga0209050_1010132 3300025298 Bacteria 4691
87 Ga0209256_1000006 3300025299 Bacteria 1250310
88 Ga0209256_1008458 3300025299 Bacteria 4768
89 Ga0209256_1009683 3300025299 Bacteria 4172
90 Ga0209051_1017835 3300025303 Bacteria 3160
91 Ga0209257_1000219 3300025304 Bacteria 135666
92 Ga0209257_1000343 3300025304 Bacteria 96876
93 Ga0209257_1000802 3300025304 Bacteria 45783
94 Ga0209257_1001069 3300025304 Bacteria 36154
95 Ga0209257_1003696 3300025304 Bacteria 12729
96 Ga0209257_1015651 3300025304 Bacteria 3137
97 Ga0209257_1018022 3300025304 Bacteria 2742
98 Ga0207681_10020827 3300025923 Bacteria 4162
99 Ga0207650_10429895 3300025925 Bacteria 1096
100 Ga0207650_10702205 3300025925 Bacteria 854
101 Ga0207659_10368125 3300025926 Bacteria 1196
102 Ga0207644_10123034 3300025931 Bacteria 1977
103 Ga0207644_10612647 3300025931 Bacteria 905
104 Ga0207711_10332000 3300025941 Bacteria 1406
105 Ga0207668_10532167 3300025972 Bacteria 1015
106 Ga0207676_10033342 3300026095 Bacteria 3890
107 Ga0209967_1016259 3300027364 Bacteria 1068
108 Ga0209981_1010711 3300027378 Bacteria 1260
109 Ga0209984_1009196 3300027424 Bacteria 1252
110 Ga0209995_1002809 3300027471 Bacteria 2759
111 Ga0209999_1001354 3300027543 Bacteria 4200
112 Ga0209982_1001413 3300027552 Bacteria 3275
113 Ga0209982_1041690 3300027552 Bacteria 732
114 Ga0209970_1006603 3300027614 Bacteria 1905
115 Ga0209970_1036423 3300027614 Bacteria 866
116 Ga0210002_1015408 3300027617 Bacteria 1204
117 Ga0210002_1027206 3300027617 Bacteria 941
118 Ga0209983_1000063 3300027665 Bacteria 16366
119 Ga0209971_1001701 3300027682 Bacteria 5418
120 Ga0209974_10008200 3300027876 Bacteria 3577
121 Ga0209974_10016221 3300027876 Bacteria 2474
122 Ga0316176_1206035 3300030732 Bacteria 900
123 Ga0314311_1082420 3300030733 Bacteria 929
124 Ga0314311_1246246 3300030733 Bacteria 554
125 Ga0316181_1038593 3300030744 Bacteria 3100
126 Ga0316181_1067530 3300030744 Bacteria 563
127 Ga0307513_10154637 3300031456 Bacteria 2196
128 Ga0307513_10167781 3300031456 Bacteria 2077
129 Ga0307408_100501007 3300031548 Bacteria 1063
130 Ga0307405_10247542 3300031731 Bacteria 1324
131 Ga0307405_10302589 3300031731 Bacteria 1214
132 Ga0307413_10107376 3300031824 Bacteria 1860
133 Ga0307413_10281768 3300031824 Bacteria 1250
134 Ga0307413_10588899 3300031824 Bacteria 908
135 Ga0307413_11350231 3300031824 Bacteria 625
136 Ga0307410_10025616 3300031852 Bacteria 3703
137 Ga0307410_10182230 3300031852 Bacteria 1591
138 Ga0307410_10263501 3300031852 Bacteria 1345
139 Ga0307406_10001113 3300031901 Bacteria 14995
140 Ga0307406_10065088 3300031901 Bacteria 2368
141 Ga0307406_10594911 3300031901 Bacteria 911
142 Ga0307406_10633596 3300031901 Bacteria 885
143 Ga0307406_11399667 3300031901 Bacteria 613
144 Ga0307412_10041181 3300031911 Bacteria 2992
145 Ga0307412_10228806 3300031911 Bacteria 1430
146 Ga0307412_10328108 3300031911 Bacteria 1220
147 Ga0307412_10605113 3300031911 Bacteria 929
148 Ga0307412_11466558 3300031911 Bacteria 619
149 Ga0307412_11675957 3300031911 Bacteria 582
150 Ga0307409_100095227 3300031995 Bacteria 2452
151 Ga0307416_100020947 3300032002 Bacteria 4680
152 Ga0307416_100061859 3300032002 Bacteria 3058
153 Ga0307416_100258584 3300032002 Bacteria 1700
154 Ga0307416_100470804 3300032002 Bacteria 1314
155 Ga0307416_101649920 3300032002 Bacteria 746
156 Ga0307416_103131875 3300032002 Bacteria 553
157 Ga0307414_10019094 3300032004 Bacteria 4240
158 Ga0307414_10061120 3300032004 Bacteria 2667
159 Ga0307414_10085282 3300032004 Bacteria 2326
160 Ga0307414_10111897 3300032004 Bacteria 2080
161 Ga0307414_10128695 3300032004 Bacteria 1961
162 Ga0307414_10138933 3300032004 Bacteria 1899
163 Ga0307414_10163332 3300032004 Bacteria 1772
164 Ga0307414_10173737 3300032004 Bacteria 1725
165 Ga0307414_10465273 3300032004 Bacteria 1112
166 Ga0307414_10880741 3300032004 Bacteria 820
167 Ga0307414_11203368 3300032004 Bacteria 701
168 Ga0307411_10002372 3300032005 Bacteria 8289
169 Ga0307411_10076074 3300032005 Bacteria 2294
170 Ga0307411_10325046 3300032005 Bacteria 1244
171 Ga0307411_10464370 3300032005 Bacteria 1062
172 Ga0307411_10813686 3300032005 Bacteria 824
173 Ga0307411_11074590 3300032005 Bacteria 724
174 Ga0307411_11237048 3300032005 Bacteria 678
175 Ga0307415_100356623 3300032126 Bacteria 1233
176 Ga0307415_100660366 3300032126 Bacteria 938
177 Ga0373952_0201680 3300035092 Bacteria 583
178 Ga0395899_0040802 3300037312 Bacteria 3470
179 Ga0395900_0252279 3300037418 Bacteria 1765
180 Ga0395900_0451786 3300037418 Bacteria 1241
181 Ga0395898_0159746 3300037466 Bacteria 2156
182 Ga0395898_0244028 3300037466 Bacteria 1713
183 Ga0395905_0010224 3300037471 Bacteria 9144
184 Ga0395905_0012366 3300037471 Bacteria 8216
185 Ga0395905_0113968 3300037471 Bacteria 2540
186 Ga0395905_1513799 3300037471 Bacteria 575
187 Ga0395901_0005945 3300038443 Bacteria 12360
188 Ga0395901_0099975 3300038443 Bacteria 3042
189 Ga0237816_00207 3300039145 Bacteria 4820
190 Ga0436365_1132593 3300039437 Bacteria 525
191 Ga0439436_0009982 3300041404 Bacteria 2903
192 Ga0439436_0071369 3300041404 Bacteria 968
193 Ga0439436_0124659 3300041404 Bacteria 721
194 Ga0439439_0064190 3300041406 Bacteria 978
195 Ga0439439_0243427 3300041406 Bacteria 532
196 Ga0439447_000511 3300041407 Bacteria 14435
197 Ga0439461_0007839 3300041410 Bacteria 1902
198 Ga0439465_0002111 3300041413 Bacteria 6533
199 Ga0439465_0024866 3300041413 Bacteria 1888
200 Ga0439465_0056937 3300041413 Bacteria 1289
201 Ga0451787_346656 3300041441 Bacteria 715
202 Ga0451791_0226875 3300041451 Bacteria 1520
203 Ga0451791_1364133 3300041451 Bacteria 1280
204 Ga0451791_1781082 3300041451 Bacteria 3237
205 Ga0451793_0143457 3300041452 Bacteria 2301
206 Ga0451793_0227202 3300041452 Bacteria 1117
207 Ga0451793_1375422 3300041452 Bacteria 532
208 Ga0451797_0065786 3300041453 Bacteria 815
209 Ga0451797_1471673 3300041453 Bacteria 669
210 Ga0451798_1103794 3300041458 Bacteria 876
211 Ga0451800_0191401 3300041459 Bacteria 903
212 Ga0451802_0356266 3300041460 Bacteria 1209
213 Ga0451807_0796977 3300041486 Bacteria 2248
214 Ga0451807_2616195 3300041486 Bacteria 551
215 Ga0451833_0720149 3300041491 Bacteria 698
216 Ga0451837_0224084 3300041494 Bacteria 700
217 Ga0451843_0003990 3300041509 Bacteria 1109
218 Ga0451843_0312013 3300041509 Bacteria 651
219 Ga0451843_0479938 3300041509 Bacteria 669
220 Ga0451843_1684342 3300041509 Bacteria 970
221 Ga0451855_1286829 3300041511 Bacteria 632
222 Ga0451853_1035966 3300041512 Bacteria 843
223 Ga0439431_0004920 3300041997 Bacteria 2945
224 Ga0439433_0203385 3300041999 Bacteria 524
225 Ga0439445_0010356 3300042004 Bacteria 2205
226 Ga0439445_0061694 3300042004 Bacteria 1026
227 Ga0439432_118283 3300042006 Bacteria 785
228 Ga0439432_215605 3300042006 Bacteria 554
229 Ga0439449_0009728 3300042007 Bacteria 3638
230 Ga0439449_0016168 3300042007 Bacteria 2805
231 Ga0439449_0026666 3300042007 Bacteria 2156
232 Ga0439449_0042090 3300042007 Bacteria 1698
233 Ga0439449_0062619 3300042007 Bacteria 1372
234 Ga0439449_0063244 3300042007 Bacteria 1366
235 Ga0439449_0103593 3300042007 Bacteria 1052
236 Ga0439452_004705 3300042010 Bacteria 4522
237 Ga0439462_0046224 3300042015 Bacteria 1166
238 Ga0439462_0056280 3300042015 Bacteria 1061
239 Ga0450898_039104 3300042134 Bacteria 892
240 Ga0439434_0123706 3300042435 Bacteria 845
241 Ga0439435_0121492 3300042436 Bacteria 819
242 Ga0466967_1248056 3300045976 Bacteria 740
243 Ga0495607_0089111 3300046501 Bacteria 1675
244 Ga0495606_0012950 3300046507 Bacteria 6637
245 Ga0495610_0000773 3300046512 Bacteria 30178
246 Ga0495616_0010205 3300046513 Bacteria 5449
247 Ga0495631_0002796 3300046518 Bacteria 9681
248 Ga0495663_0001252 3300046525 Bacteria 8082
249 Ga0495663_0001840 3300046525 Bacteria 6539
250 Ga0495663_0023045 3300046525 Bacteria 1801
251 Ga0495663_0025116 3300046525 Bacteria 1736
252 Ga0495663_0113971 3300046525 Bacteria 900
253 Ga0495663_0338036 3300046525 Bacteria 547
254 Ga0495621_0000165 3300046539 Bacteria 14813
255 Ga0495621_0188061 3300046539 Bacteria 827
256 Ga0495633_0004648 3300046558 Bacteria 8649
257 Ga0495656_0003909 3300046615 Bacteria 5069
258 Ga0495656_0014996 3300046615 Bacteria 2916
259 Ga0495656_0016308 3300046615 Bacteria 2818
260 Ga0495656_0711592 3300046615 Bacteria 541
261 Ga0495656_0737423 3300046615 Bacteria 531
262 Ga0495668_0000741 3300046616 Bacteria 39039
263 Ga0495625_0247797 3300046660 Bacteria 1157
264 Ga0495670_0043367 3300046691 Bacteria 2245
265 Ga0495670_0237695 3300046691 Bacteria 970
266 Ga0495671_0021163 3300046692 Bacteria 3420
267 Ga0495660_0002739 3300046810 Bacteria 11114
268 Ga0495636_0024655 3300047318 Bacteria 2441
269 Ga0495636_0043716 3300047318 Bacteria 1864
270 Ga0495636_0044492 3300047318 Bacteria 1848
271 Ga0495636_0052423 3300047318 Bacteria 1711
272 Ga0495636_0053267 3300047318 Bacteria 1698
273 Ga0495636_0056061 3300047318 Bacteria 1659
274 Ga0495685_050799 3300047447 Bacteria 1407
275 Ga0495681_0242281 3300047470 Bacteria 715
276 Ga0495615_0041833 3300048090 Bacteria 1147
277 Ga0496100_0032395 3300048903 Bacteria 3260
278 Ga0496100_0256469 3300048903 Bacteria 1295
279 Ga0496101_0251071 3300048904 Bacteria 1378
280 Ga0496101_0661312 3300048904 Bacteria 825
281 Ga0496102_0906312 3300048905 Bacteria 803
282 Ga0496106_0241378 3300048909 Bacteria 1444
283 Ga0496108_0110856 3300048911 Bacteria 2346
284 Ga0496108_0954231 3300048911 Bacteria 734
285 Ga0496109_0205787 3300048912 Bacteria 1850
286 Ga0496109_1146626 3300048912 Bacteria 714
287 Ga0496110_0160063 3300048913 Bacteria 2040
288 Ga0496111_0324824 3300048914 Bacteria 1139
289 Ga0496111_0655717 3300048914 Bacteria 765
290 Ga0496114_0000944 3300048917 Bacteria 21736
291 Ga0496114_1005851 3300048917 Bacteria 717
292 Ga0496116_0067793 3300048919 Bacteria 2277
293 Ga0496119_0148935 3300048922 Bacteria 1256
294 Ga0496120_0312246 3300048923 Bacteria 717
295 Ga0496121_0000676 3300048924 Bacteria 63634
296 Ga0496121_0049243 3300048924 Bacteria 3575
297 Ga0496123_0015665 3300048926 Bacteria 6204
298 Ga0496123_0023574 3300048926 Bacteria 4707
299 Ga0496124_0000866 3300048927 Bacteria 49473
300 Ga0496124_0014750 3300048927 Bacteria 7540
301 Ga0496124_0078342 3300048927 Bacteria 2724
302 Ga0496125_0012341 3300048928 Bacteria 8488
303 Ga0496125_0016150 3300048928 Bacteria 7180
304 Ga0496125_0051958 3300048928 Bacteria 3375
305 Ga0496125_0136730 3300048928 Bacteria 1713
306 Ga0496126_0019968 3300048929 Bacteria 6584
307 Ga0496126_0322451 3300048929 Bacteria 1269
308 Ga0501290_010527 3300049513 Bacteria 1184
309 Ga0501290_026834 3300049513 Bacteria 810
310 Ga0501300_012014 3300049523 Bacteria 1261
311 Ga0501031_0029264 3300049568 Bacteria 3593
312 Ga0501031_0097010 3300049568 Bacteria 1924
313 Ga0501032_0015147 3300049569 Bacteria 5445
314 Ga0501032_0193218 3300049569 Bacteria 1330
315 Ga0501032_0363040 3300049569 Bacteria 932
316 Ga0501033_0000799 3300049570 Bacteria 28871
317 Ga0501034_0000513 3300049571 Bacteria 62217
318 Ga0501034_0008862 3300049571 Bacteria 10581
319 Ga0501034_0057961 3300049571 Bacteria 3893
320 Ga0501036_1296461 3300049572 Bacteria 592
321 Ga0501037_0012970 3300049573 Bacteria 6143
322 Ga0501037_0236627 3300049573 Bacteria 1281
323 Ga0501038_0001851 3300049574 Bacteria 19540
324 Ga0501038_0054328 3300049574 Bacteria 3445
325 Ga0501039_0023751 3300049575 Bacteria 4705
326 Ga0501043_0025339 3300049579 Bacteria 4653
327 Ga0501043_0029422 3300049579 Bacteria 4315
328 Ga0501043_0047276 3300049579 Bacteria 3383
329 Ga0501046_1060804 3300049580 Bacteria 561
330 Ga0501047_0206044 3300049581 Bacteria 1826
331 Ga0501047_1321248 3300049581 Bacteria 535
332 Ga0501070_0014436 3300049586 Bacteria 6647
333 Ga0501070_0262242 3300049586 Bacteria 1412
334 Ga0501071_0448358 3300049587 Bacteria 987
335 Ga0501073_0041648 3300049589 Bacteria 3245
336 Ga0501198_073919 3300049649 Bacteria 648
337 Ga0501202_039224 3300049652 Bacteria 1017
338 Ga0501202_063767 3300049652 Bacteria 838
339 Ga0501209_108178 3300049656 Bacteria 819
340 Ga0501223_010957 3300049663 Bacteria 1821
341 Ga0501235_136294 3300049669 Bacteria 625
342 Ga0501238_075437 3300049671 Bacteria 527
343 Ga0501240_030023 3300049673 Bacteria 865
344 Ga0501242_017454 3300049674 Bacteria 905
345 Ga0501242_074505 3300049674 Bacteria 536
346 Ga0501243_071677 3300049675 Bacteria 660
347 Ga0501250_008786 3300049680 Bacteria 1123
348 Ga0501250_009642 3300049680 Bacteria 1091
349 Ga0501250_015393 3300049680 Bacteria 939
350 Ga0501256_014482 3300049685 Bacteria 784
351 Ga0501257_059009 3300049686 Bacteria 967
352 Ga0501257_083516 3300049686 Bacteria 825
353 Ga0501225_0010015 3300049705 Bacteria 2691
354 Ga0501225_0242759 3300049705 Bacteria 589
355 Ga0501234_049567 3300049707 Bacteria 698
356 Ga0501245_019099 3300049708 Bacteria 1059
357 Ga0501079_0822893 3300049741 Bacteria 731
358 Ga0501080_0002101 3300049742 Bacteria 17301
359 Ga0501080_0612241 3300049742 Bacteria 966
360 Ga0501232_026921 3300049757 Bacteria 777
361 Ga0501263_012384 3300049760 Bacteria 1070
362 Ga0501263_049704 3300049760 Bacteria 635
363 Ga0501266_003278 3300049763 Bacteria 2013
364 Ga0501266_004889 3300049763 Bacteria 1668
365 Ga0501266_087988 3300049763 Bacteria 535
366 Ga0501267_012428 3300049764 Bacteria 878
367 Ga0501267_045304 3300049764 Bacteria 559
368 Ga0501272_011643 3300049769 Bacteria 993
369 Ga0501274_002763 3300049771 Bacteria 1383
370 Ga0501279_004877 3300049775 Bacteria 1761
371 Ga0501035_0029466 3300049822 Bacteria 5005
372 Ga0501035_0310240 3300049822 Bacteria 1327
373 Ga0501044_0019597 3300049823 Bacteria 7232
374 Ga0501044_0305530 3300049823 Bacteria 1518
375 Ga0501044_1139922 3300049823 Bacteria 648
376 nmdc:mga00v17_22300_c1 3300050491 Bacteria 3653
377 nmdc:mga00v17_397526_c1 3300050491 Bacteria 896
378 nmdc:mga00v17_722647_c1 3300050491 Bacteria 638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049764 Ga0501267_012428 Ga0501267_012428_36_407 106
2 iso_pu_bacteria 2842780639 2842783319 108
3 iso_pu_bacteria 8002869464 8002871333 108
4 3300017792 Ga0163161_11938313 Ga0163161_119383132 110
5 iso_pu_bacteria 2919513703 2919515064 110
6 iso_pu_bacteria 2919675420 2919676315 110
7 3300003187 JGI25151J46595_10000361 JGI25151J46595_100003617 111
8 3300003187 JGI25151J46595_10053505 JGI25151J46595_100535052 111
9 3300003187 JGI25151J46595_10097324 JGI25151J46595_100973242 111
10 3300003771 Ga0055526_1000072 Ga0055526_100007231 111
11 3300003771 Ga0055526_1008020 Ga0055526_10080205 111
12 3300003773 Ga0055537_1000412 Ga0055537_10004129 111
13 3300003775 Ga0055524_1000173 Ga0055524_100017317 111
14 3300003775 Ga0055524_1033572 Ga0055524_10335722 111
15 3300003781 Ga0055536_1017664 Ga0055536_10176644 111
16 3300003784 Ga0055534_1000077 Ga0055534_100007736 111
17 3300003784 Ga0055534_1013900 Ga0055534_10139002 111
18 3300003790 Ga0055528_1000085 Ga0055528_100008517 111
19 3300005288 Ga0065714_10015082 Ga0065714_100150823 111
20 3300005293 Ga0065715_10036727 Ga0065715_100367272 111
21 3300005293 Ga0065715_10092549 Ga0065715_100925494 111
22 3300005293 Ga0065715_10142965 Ga0065715_101429652 111
23 3300005331 Ga0070670_100268606 Ga0070670_1002686062 111
24 3300005331 Ga0070670_100545514 Ga0070670_1005455142 111
25 3300005353 Ga0070669_101470625 Ga0070669_1014706251 111
26 3300005353 Ga0070669_102052790 Ga0070669_1020527901 111
27 3300005355 Ga0070671_100035437 Ga0070671_1000354373 111
28 3300005355 Ga0070671_100110464 Ga0070671_1001104643 111
29 3300005841 Ga0068863_100158160 Ga0068863_1001581602 111
30 3300009092 Ga0105250_10224673 Ga0105250_102246731 111
31 3300009177 Ga0105248_11074388 Ga0105248_110743882 111
32 3300009553 Ga0105249_11175031 Ga0105249_111750312 111
33 3300012482 Ga0157318_1000255 Ga0157318_10002552 111
34 3300012500 Ga0157314_1045772 Ga0157314_10457721 111
35 3300012510 Ga0157316_1000222 Ga0157316_10002223 111
36 3300012510 Ga0157316_1031329 Ga0157316_10313291 111
37 3300012512 Ga0157327_1034322 Ga0157327_10343221 111
38 3300013104 Ga0157370_10765633 Ga0157370_107656331 111
39 3300013306 Ga0163162_11088738 Ga0163162_110887382 111
40 3300014326 Ga0157380_10237356 Ga0157380_102373563 111
41 3300014326 Ga0157380_12027322 Ga0157380_120273222 111
42 3300014497 Ga0182008_10030320 Ga0182008_100303202 111
43 3300015689 Ga0183360_10001 Ga0183360_100012872 111
44 3300025245 Ga0207425_1016972 Ga0207425_10169723 111
45 3300025245 Ga0207425_1046416 Ga0207425_10464161 111
46 3300025263 Ga0209565_1000001 Ga0209565_10000011015 111
47 3300025263 Ga0209565_1004969 Ga0209565_10049693 111
48 3300025273 Ga0209673_1000001 Ga0209673_10000011015 111
49 3300025273 Ga0209673_1042282 Ga0209673_10422822 111
50 3300025291 Ga0209675_1000001 Ga0209675_10000011519 111
51 3300025291 Ga0209675_1014049 Ga0209675_10140492 111
52 3300025292 Ga0209676_1001943 Ga0209676_10019432 111
53 3300025292 Ga0209676_1001947 Ga0209676_10019473 111
54 3300025292 Ga0209676_1019065 Ga0209676_10190654 111
55 3300025294 Ga0209025_1000006 Ga0209025_1000006171 111
56 3300025294 Ga0209025_1002378 Ga0209025_100237811 111
57 3300025294 Ga0209025_1008259 Ga0209025_10082599 111
58 3300025295 Ga0209564_1000001 Ga0209564_10000011681 111
59 3300025295 Ga0209564_1010773 Ga0209564_10107733 111
60 3300025297 Ga0209758_1007486 Ga0209758_10074865 111
61 3300025297 Ga0209758_1088004 Ga0209758_10880042 111
62 3300025298 Ga0209050_1005770 Ga0209050_100577010 111
63 3300025298 Ga0209050_1010132 Ga0209050_10101325 111
64 3300025299 Ga0209256_1000006 Ga0209256_1000006117 111
65 3300025299 Ga0209256_1008458 Ga0209256_10084584 111
66 3300025299 Ga0209256_1009683 Ga0209256_10096833 111
67 3300025303 Ga0209051_1017835 Ga0209051_10178353 111
68 3300025304 Ga0209257_1000343 Ga0209257_100034390 111
69 3300025304 Ga0209257_1001069 Ga0209257_100106932 111
70 3300025304 Ga0209257_1003696 Ga0209257_10036964 111
71 3300025304 Ga0209257_1015651 Ga0209257_10156515 111
72 3300025304 Ga0209257_1018022 Ga0209257_10180221 111
73 3300025925 Ga0207650_10429895 Ga0207650_104298952 111
74 3300025925 Ga0207650_10702205 Ga0207650_107022052 111
75 3300025926 Ga0207659_10368125 Ga0207659_103681252 111
76 3300025931 Ga0207644_10123034 Ga0207644_101230342 111
77 3300025931 Ga0207644_10612647 Ga0207644_106126472 111
78 3300025941 Ga0207711_10332000 Ga0207711_103320001 111
79 3300026095 Ga0207676_10033342 Ga0207676_100333423 111
80 3300027552 Ga0209982_1041690 Ga0209982_10416902 111
81 3300027614 Ga0209970_1036423 Ga0209970_10364233 111
82 3300027617 Ga0210002_1027206 Ga0210002_10272062 111
83 3300027876 Ga0209974_10016221 Ga0209974_100162211 111
84 3300031548 Ga0307408_100501007 Ga0307408_1005010072 111
85 3300031731 Ga0307405_10247542 Ga0307405_102475421 111
86 3300031731 Ga0307405_10302589 Ga0307405_103025892 111
87 3300031824 Ga0307413_10107376 Ga0307413_101073761 111
88 3300031824 Ga0307413_10281768 Ga0307413_102817681 111
89 3300031824 Ga0307413_11350231 Ga0307413_113502311 111
90 3300031852 Ga0307410_10025616 Ga0307410_100256164 111
91 3300031852 Ga0307410_10182230 Ga0307410_101822303 111
92 3300031852 Ga0307410_10263501 Ga0307410_102635011 111
93 3300031901 Ga0307406_10001113 Ga0307406_100011136 111
94 3300031901 Ga0307406_10065088 Ga0307406_100650882 111
95 3300031901 Ga0307406_10594911 Ga0307406_105949112 111
96 3300031901 Ga0307406_10633596 Ga0307406_106335962 111
97 3300031901 Ga0307406_11399667 Ga0307406_113996672 111
98 3300031911 Ga0307412_10041181 Ga0307412_100411813 111
99 3300031911 Ga0307412_10228806 Ga0307412_102288063 111
100 3300031911 Ga0307412_10328108 Ga0307412_103281083 111
101 3300031911 Ga0307412_10605113 Ga0307412_106051132 111
102 3300031911 Ga0307412_11466558 Ga0307412_114665581 111
103 3300031911 Ga0307412_11675957 Ga0307412_116759571 111
104 3300031995 Ga0307409_100095227 Ga0307409_1000952273 111
105 3300032002 Ga0307416_100061859 Ga0307416_1000618593 111
106 3300032002 Ga0307416_100258584 Ga0307416_1002585842 111
107 3300032002 Ga0307416_100470804 Ga0307416_1004708043 111
108 3300032002 Ga0307416_101649920 Ga0307416_1016499202 111
109 3300032002 Ga0307416_103131875 Ga0307416_1031318751 111
110 3300032004 Ga0307414_10061120 Ga0307414_100611203 111
111 3300032004 Ga0307414_10138933 Ga0307414_101389332 111
112 3300032004 Ga0307414_10163332 Ga0307414_101633324 111
113 3300032004 Ga0307414_10173737 Ga0307414_101737373 111
114 3300032004 Ga0307414_10465273 Ga0307414_104652732 111
115 3300032004 Ga0307414_10880741 Ga0307414_108807411 111
116 3300032004 Ga0307414_11203368 Ga0307414_112033682 111
117 3300032005 Ga0307411_10002372 Ga0307411_100023728 111
118 3300032005 Ga0307411_10076074 Ga0307411_100760742 111
119 3300032005 Ga0307411_10325046 Ga0307411_103250462 111
120 3300032005 Ga0307411_10464370 Ga0307411_104643702 111
121 3300032005 Ga0307411_11074590 Ga0307411_110745901 111
122 3300032126 Ga0307415_100356623 Ga0307415_1003566232 111
123 3300032126 Ga0307415_100660366 Ga0307415_1006603661 111
124 3300035092 Ga0373952_0201680 Ga0373952_0201680_110_454 111
125 3300037312 Ga0395899_0040802 Ga0395899_0040802_2931_3272 111
126 3300037418 Ga0395900_0252279 Ga0395900_0252279_567_908 111
127 3300037418 Ga0395900_0451786 Ga0395900_0451786_344_685 111
128 3300037466 Ga0395898_0159746 Ga0395898_0159746_1036_1407 111
129 3300037466 Ga0395898_0244028 Ga0395898_0244028_905_1246 111
130 3300037471 Ga0395905_0010224 Ga0395905_0010224_7076_7417 111
131 3300037471 Ga0395905_0113968 Ga0395905_0113968_1874_2215 111
132 3300038443 Ga0395901_0005945 Ga0395901_0005945_4584_4925 111
133 3300038443 Ga0395901_0099975 Ga0395901_0099975_73_444 111
134 3300039437 Ga0436365_1132593 Ga0436365_1132593_76_438 111
135 3300041404 Ga0439436_0009982 Ga0439436_0009982_1263_1601 111
136 3300041404 Ga0439436_0124659 Ga0439436_0124659_333_671 111
137 3300041406 Ga0439439_0064190 Ga0439439_0064190_489_827 111
138 3300041407 Ga0439447_000511 Ga0439447_000511_12114_12455 111
139 3300041453 Ga0451797_1471673 Ga0451797_1471673_112_453 111
140 3300041509 Ga0451843_0312013 Ga0451843_0312013_72_413 111
141 3300041509 Ga0451843_0479938 Ga0451843_0479938_287_628 111
142 3300042004 Ga0439445_0061694 Ga0439445_0061694_443_784 111
143 3300042006 Ga0439432_118283 Ga0439432_118283_65_403 111
144 3300042006 Ga0439432_215605 Ga0439432_215605_64_402 111
145 3300042007 Ga0439449_0009728 Ga0439449_0009728_809_1147 111
146 3300042007 Ga0439449_0016168 Ga0439449_0016168_400_738 111
147 3300042007 Ga0439449_0042090 Ga0439449_0042090_830_1171 111
148 3300042007 Ga0439449_0062619 Ga0439449_0062619_360_701 111
149 3300042007 Ga0439449_0063244 Ga0439449_0063244_439_780 111
150 3300042010 Ga0439452_004705 Ga0439452_004705_3831_4172 111
151 3300042015 Ga0439462_0046224 Ga0439462_0046224_382_723 111
152 3300042015 Ga0439462_0056280 Ga0439462_0056280_479_817 111
153 3300042134 Ga0450898_039104 Ga0450898_039104_540_878 111
154 3300046525 Ga0495663_0023045 Ga0495663_0023045_180_518 111
155 3300046525 Ga0495663_0113971 Ga0495663_0113971_489_833 111
156 3300046525 Ga0495663_0338036 Ga0495663_0338036_162_500 111
157 3300046539 Ga0495621_0000165 Ga0495621_0000165_10655_11065 111
158 3300046539 Ga0495621_0188061 Ga0495621_0188061_388_726 111
159 3300046615 Ga0495656_0003909 Ga0495656_0003909_2167_2508 111
160 3300046615 Ga0495656_0014996 Ga0495656_0014996_575_913 111
161 3300046615 Ga0495656_0016308 Ga0495656_0016308_2158_2496 111
162 3300046615 Ga0495656_0711592 Ga0495656_0711592_47_391 111
163 3300046615 Ga0495656_0737423 Ga0495656_0737423_18_428 111
164 3300046616 Ga0495668_0000741 Ga0495668_0000741_27112_27453 111
165 3300046691 Ga0495670_0043367 Ga0495670_0043367_59_397 111
166 3300046691 Ga0495670_0237695 Ga0495670_0237695_218_559 111
167 3300047318 Ga0495636_0024655 Ga0495636_0024655_846_1256 111
168 3300047318 Ga0495636_0043716 Ga0495636_0043716_1191_1532 111
169 3300047318 Ga0495636_0044492 Ga0495636_0044492_502_840 111
170 3300047318 Ga0495636_0052423 Ga0495636_0052423_1005_1343 111
171 3300047318 Ga0495636_0053267 Ga0495636_0053267_354_692 111
172 3300047447 Ga0495685_050799 Ga0495685_050799_276_614 111
173 3300048090 Ga0495615_0041833 Ga0495615_0041833_695_1105 111
174 3300048903 Ga0496100_0256469 Ga0496100_0256469_729_1070 111
175 3300048904 Ga0496101_0661312 Ga0496101_0661312_376_717 111
176 3300048911 Ga0496108_0110856 Ga0496108_0110856_213_557 111
177 3300048911 Ga0496108_0954231 Ga0496108_0954231_240_581 111
178 3300048912 Ga0496109_0205787 Ga0496109_0205787_1253_1594 111
179 3300048913 Ga0496110_0160063 Ga0496110_0160063_1400_1804 111
180 3300048914 Ga0496111_0324824 Ga0496111_0324824_568_912 111
181 3300048914 Ga0496111_0655717 Ga0496111_0655717_78_422 111
182 3300048924 Ga0496121_0000676 Ga0496121_0000676_6353_6694 111
183 3300048927 Ga0496124_0078342 Ga0496124_0078342_1993_2397 111
184 3300048928 Ga0496125_0136730 Ga0496125_0136730_841_1179 111
185 3300049568 Ga0501031_0029264 Ga0501031_0029264_670_1038 111
186 3300049569 Ga0501032_0015147 Ga0501032_0015147_2072_2440 111
187 3300049569 Ga0501032_0363040 Ga0501032_0363040_513_854 111
188 3300049570 Ga0501033_0000799 Ga0501033_0000799_8103_8444 111
189 3300049571 Ga0501034_0008862 Ga0501034_0008862_3534_3875 111
190 3300049571 Ga0501034_0057961 Ga0501034_0057961_2743_3111 111
191 3300049572 Ga0501036_1296461 Ga0501036_1296461_64_405 111
192 3300049573 Ga0501037_0012970 Ga0501037_0012970_1200_1568 111
193 3300049573 Ga0501037_0236627 Ga0501037_0236627_408_749 111
194 3300049574 Ga0501038_0001851 Ga0501038_0001851_11665_12033 111
195 3300049575 Ga0501039_0023751 Ga0501039_0023751_1347_1715 111
196 3300049579 Ga0501043_0025339 Ga0501043_0025339_86_454 111
197 3300049579 Ga0501043_0029422 Ga0501043_0029422_3878_4219 111
198 3300049580 Ga0501046_1060804 Ga0501046_1060804_101_439 111
199 3300049581 Ga0501047_1321248 Ga0501047_1321248_140_481 111
200 3300049586 Ga0501070_0014436 Ga0501070_0014436_2920_3288 111
201 3300049587 Ga0501071_0448358 Ga0501071_0448358_568_936 111
202 3300049589 Ga0501073_0041648 Ga0501073_0041648_125_493 111
203 3300049649 Ga0501198_073919 Ga0501198_073919_218_559 111
204 3300049652 Ga0501202_039224 Ga0501202_039224_648_986 111
205 3300049652 Ga0501202_063767 Ga0501202_063767_119_460 111
206 3300049656 Ga0501209_108178 Ga0501209_108178_465_806 111
207 3300049663 Ga0501223_010957 Ga0501223_010957_459_800 111
208 3300049669 Ga0501235_136294 Ga0501235_136294_275_613 111
209 3300049671 Ga0501238_075437 Ga0501238_075437_153_491 111
210 3300049673 Ga0501240_030023 Ga0501240_030023_70_408 111
211 3300049674 Ga0501242_017454 Ga0501242_017454_54_392 111
212 3300049674 Ga0501242_074505 Ga0501242_074505_18_356 111
213 3300049675 Ga0501243_071677 Ga0501243_071677_65_406 111
214 3300049680 Ga0501250_008786 Ga0501250_008786_571_912 111
215 3300049680 Ga0501250_009642 Ga0501250_009642_282_620 111
216 3300049680 Ga0501250_015393 Ga0501250_015393_530_868 111
217 3300049685 Ga0501256_014482 Ga0501256_014482_379_720 111
218 3300049686 Ga0501257_059009 Ga0501257_059009_54_395 111
219 3300049686 Ga0501257_083516 Ga0501257_083516_411_749 111
220 3300049705 Ga0501225_0242759 Ga0501225_0242759_200_538 111
221 3300049707 Ga0501234_049567 Ga0501234_049567_103_441 111
222 3300049708 Ga0501245_019099 Ga0501245_019099_605_946 111
223 3300049741 Ga0501079_0822893 Ga0501079_0822893_288_656 111
224 3300049742 Ga0501080_0002101 Ga0501080_0002101_8776_9144 111
225 3300049757 Ga0501232_026921 Ga0501232_026921_374_712 111
226 3300049760 Ga0501263_012384 Ga0501263_012384_351_692 111
227 3300049760 Ga0501263_049704 Ga0501263_049704_208_552 111
228 3300049763 Ga0501266_003278 Ga0501266_003278_1260_1598 111
229 3300049763 Ga0501266_004889 Ga0501266_004889_674_1012 111
230 3300049763 Ga0501266_087988 Ga0501266_087988_20_361 111
231 3300049764 Ga0501267_045304 Ga0501267_045304_113_454 111
232 3300049769 Ga0501272_011643 Ga0501272_011643_324_662 111
233 3300049771 Ga0501274_002763 Ga0501274_002763_613_954 111
234 3300049775 Ga0501279_004877 Ga0501279_004877_1029_1370 111
235 3300049822 Ga0501035_0029466 Ga0501035_0029466_4576_4944 111
236 3300049823 Ga0501044_0019597 Ga0501044_0019597_116_484 111
237 iso_pu_bacteria 2995948881 2995950227 111
238 2162886007 SwRhRL2b_contig_123878 SwRhRL2b_0506.00001770 112
239 3300003502 JGI26143J51219_1003605 JGI26143J51219_10036052 112
240 3300003794 Ga0055531_10041694 Ga0055531_100416941 112
241 3300005289 Ga0065704_10000583 Ga0065704_1000058315 112
242 3300005289 Ga0065704_10147326 Ga0065704_101473263 112
243 3300005289 Ga0065704_10148401 Ga0065704_101484012 112
244 3300005289 Ga0065704_10217373 Ga0065704_102173732 112
245 3300005347 Ga0070668_100581899 Ga0070668_1005818992 112
246 3300005353 Ga0070669_100025134 Ga0070669_1000251345 112
247 3300005530 Ga0070679_100518259 Ga0070679_1005182592 112
248 3300005578 Ga0068854_100992195 Ga0068854_1009921952 112
249 3300005834 Ga0068851_10156525 Ga0068851_101565252 112
250 3300006051 Ga0075364_10000070 Ga0075364_1000007029 112
251 3300006051 Ga0075364_10125513 Ga0075364_101255134 112
252 3300006051 Ga0075364_10159149 Ga0075364_101591492 112
253 3300006186 Ga0075369_10462594 Ga0075369_104625942 112
254 3300009984 Ga0105029_101901 Ga0105029_1019011 112
255 3300009993 Ga0105028_104087 Ga0105028_1040871 112
256 3300010375 Ga0105239_12478731 Ga0105239_124787311 112
257 3300012490 Ga0157322_1027949 Ga0157322_10279491 112
258 3300012513 Ga0157326_1019964 Ga0157326_10199642 112
259 3300012515 Ga0157338_1018801 Ga0157338_10188012 112
260 3300013102 Ga0157371_10044436 Ga0157371_100444363 112
261 3300013104 Ga0157370_10042408 Ga0157370_100424085 112
262 3300013297 Ga0157378_10168883 Ga0157378_101688832 112
263 3300013307 Ga0157372_10933264 Ga0157372_109332642 112
264 3300015261 Ga0182006_1008198 Ga0182006_10081984 112
265 3300025292 Ga0209676_1000129 Ga0209676_1000129158 112
266 3300025304 Ga0209257_1000219 Ga0209257_1000219106 112
267 3300025304 Ga0209257_1000802 Ga0209257_100080217 112
268 3300025923 Ga0207681_10020827 Ga0207681_100208276 112
269 3300025972 Ga0207668_10532167 Ga0207668_105321671 112
270 3300027364 Ga0209967_1016259 Ga0209967_10162592 112
271 3300027378 Ga0209981_1010711 Ga0209981_10107112 112
272 3300027424 Ga0209984_1009196 Ga0209984_10091962 112
273 3300027471 Ga0209995_1002809 Ga0209995_10028093 112
274 3300027543 Ga0209999_1001354 Ga0209999_10013542 112
275 3300027552 Ga0209982_1001413 Ga0209982_10014135 112
276 3300027614 Ga0209970_1006603 Ga0209970_10066032 112
277 3300027617 Ga0210002_1015408 Ga0210002_10154082 112
278 3300027665 Ga0209983_1000063 Ga0209983_10000636 112
279 3300027682 Ga0209971_1001701 Ga0209971_10017012 112
280 3300027876 Ga0209974_10008200 Ga0209974_100082004 112
281 3300030732 Ga0316176_1206035 Ga0316176_12060352 112
282 3300030733 Ga0314311_1082420 Ga0314311_10824202 112
283 3300030733 Ga0314311_1246246 Ga0314311_12462462 112
284 3300030744 Ga0316181_1038593 Ga0316181_10385933 112
285 3300030744 Ga0316181_1067530 Ga0316181_10675301 112
286 3300031456 Ga0307513_10154637 Ga0307513_101546373 112
287 3300031456 Ga0307513_10167781 Ga0307513_101677812 112
288 3300031824 Ga0307413_10588899 Ga0307413_105888992 112
289 3300032002 Ga0307416_100020947 Ga0307416_1000209477 112
290 3300032004 Ga0307414_10019094 Ga0307414_100190945 112
291 3300032004 Ga0307414_10085282 Ga0307414_100852823 112
292 3300032004 Ga0307414_10111897 Ga0307414_101118972 112
293 3300032004 Ga0307414_10128695 Ga0307414_101286952 112
294 3300032005 Ga0307411_10813686 Ga0307411_108136861 112
295 3300032005 Ga0307411_11237048 Ga0307411_112370482 112
296 3300037471 Ga0395905_0012366 Ga0395905_0012366_1354_1695 112
297 3300037471 Ga0395905_1513799 Ga0395905_1513799_169_546 112
298 3300039145 Ga0237816_00207 Ga0237816_00207_1572_1937 112
299 3300041404 Ga0439436_0071369 Ga0439436_0071369_424_780 112
300 3300041406 Ga0439439_0243427 Ga0439439_0243427_130_486 112
301 3300041410 Ga0439461_0007839 Ga0439461_0007839_1034_1390 112
302 3300041413 Ga0439465_0002111 Ga0439465_0002111_629_985 112
303 3300041413 Ga0439465_0024866 Ga0439465_0024866_289_627 112
304 3300041413 Ga0439465_0056937 Ga0439465_0056937_253_609 112
305 3300041441 Ga0451787_346656 Ga0451787_346656_118_474 112
306 3300041451 Ga0451791_0226875 Ga0451791_0226875_662_1018 112
307 3300041451 Ga0451791_1364133 Ga0451791_1364133_639_995 112
308 3300041451 Ga0451791_1781082 Ga0451791_1781082_1473_1829 112
309 3300041452 Ga0451793_0143457 Ga0451793_0143457_573_929 112
310 3300041452 Ga0451793_0227202 Ga0451793_0227202_583_939 112
311 3300041452 Ga0451793_1375422 Ga0451793_1375422_45_395 112
312 3300041453 Ga0451797_0065786 Ga0451797_0065786_341_697 112
313 3300041458 Ga0451798_1103794 Ga0451798_1103794_411_767 112
314 3300041459 Ga0451800_0191401 Ga0451800_0191401_349_705 112
315 3300041460 Ga0451802_0356266 Ga0451802_0356266_508_864 112
316 3300041486 Ga0451807_0796977 Ga0451807_0796977_1346_1702 112
317 3300041486 Ga0451807_2616195 Ga0451807_2616195_136_474 112
318 3300041491 Ga0451833_0720149 Ga0451833_0720149_170_526 112
319 3300041494 Ga0451837_0224084 Ga0451837_0224084_302_646 112
320 3300041509 Ga0451843_0003990 Ga0451843_0003990_411_755 112
321 3300041509 Ga0451843_1684342 Ga0451843_1684342_581_937 112
322 3300041511 Ga0451855_1286829 Ga0451855_1286829_84_455 112
323 3300041512 Ga0451853_1035966 Ga0451853_1035966_92_436 112
324 3300041997 Ga0439431_0004920 Ga0439431_0004920_1173_1529 112
325 3300041999 Ga0439433_0203385 Ga0439433_0203385_134_472 112
326 3300042004 Ga0439445_0010356 Ga0439445_0010356_844_1182 112
327 3300042007 Ga0439449_0026666 Ga0439449_0026666_317_673 112
328 3300042007 Ga0439449_0103593 Ga0439449_0103593_582_920 112
329 3300042435 Ga0439434_0123706 Ga0439434_0123706_81_437 112
330 3300042436 Ga0439435_0121492 Ga0439435_0121492_133_489 112
331 3300045976 Ga0466967_1248056 Ga0466967_1248056_64_411 112
332 3300046501 Ga0495607_0089111 Ga0495607_0089111_596_955 112
333 3300046507 Ga0495606_0012950 Ga0495606_0012950_2854_3222 112
334 3300046512 Ga0495610_0000773 Ga0495610_0000773_17492_17845 112
335 3300046513 Ga0495616_0010205 Ga0495616_0010205_3796_4155 112
336 3300046518 Ga0495631_0002796 Ga0495631_0002796_4650_5003 112
337 3300046525 Ga0495663_0001252 Ga0495663_0001252_5129_5476 112
338 3300046525 Ga0495663_0001840 Ga0495663_0001840_5929_6285 112
339 3300046525 Ga0495663_0025116 Ga0495663_0025116_751_1104 112
340 3300046558 Ga0495633_0004648 Ga0495633_0004648_5727_6074 112
341 3300046660 Ga0495625_0247797 Ga0495625_0247797_199_555 112
342 3300046692 Ga0495671_0021163 Ga0495671_0021163_1035_1391 112
343 3300046810 Ga0495660_0002739 Ga0495660_0002739_2923_3276 112
344 3300047318 Ga0495636_0056061 Ga0495636_0056061_29_382 112
345 3300047470 Ga0495681_0242281 Ga0495681_0242281_298_657 112
346 3300048903 Ga0496100_0032395 Ga0496100_0032395_2423_2761 112
347 3300048904 Ga0496101_0251071 Ga0496101_0251071_134_472 112
348 3300048905 Ga0496102_0906312 Ga0496102_0906312_320_658 112
349 3300048909 Ga0496106_0241378 Ga0496106_0241378_635_973 112
350 3300048912 Ga0496109_1146626 Ga0496109_1146626_67_414 112
351 3300048917 Ga0496114_0000944 Ga0496114_0000944_19651_19989 112
352 3300048917 Ga0496114_1005851 Ga0496114_1005851_278_631 112
353 3300048919 Ga0496116_0067793 Ga0496116_0067793_161_514 112
354 3300048922 Ga0496119_0148935 Ga0496119_0148935_777_1130 112
355 3300048923 Ga0496120_0312246 Ga0496120_0312246_309_671 112
356 3300048924 Ga0496121_0049243 Ga0496121_0049243_531_884 112
357 3300048926 Ga0496123_0015665 Ga0496123_0015665_1334_1693 112
358 3300048926 Ga0496123_0023574 Ga0496123_0023574_1408_1764 112
359 3300048927 Ga0496124_0000866 Ga0496124_0000866_34761_35114 112
360 3300048927 Ga0496124_0014750 Ga0496124_0014750_2591_2944 112
361 3300048928 Ga0496125_0012341 Ga0496125_0012341_4555_4908 112
362 3300048928 Ga0496125_0016150 Ga0496125_0016150_3522_3875 112
363 3300048928 Ga0496125_0051958 Ga0496125_0051958_2065_2430 112
364 3300048929 Ga0496126_0019968 Ga0496126_0019968_753_1091 112
365 3300048929 Ga0496126_0322451 Ga0496126_0322451_757_1116 112
366 3300049513 Ga0501290_010527 Ga0501290_010527_825_1163 112
367 3300049513 Ga0501290_026834 Ga0501290_026834_409_756 112
368 3300049523 Ga0501300_012014 Ga0501300_012014_656_1003 112
369 3300049568 Ga0501031_0097010 Ga0501031_0097010_470_820 112
370 3300049569 Ga0501032_0193218 Ga0501032_0193218_77_427 112
371 3300049571 Ga0501034_0000513 Ga0501034_0000513_32008_32355 112
372 3300049574 Ga0501038_0054328 Ga0501038_0054328_1523_1873 112
373 3300049579 Ga0501043_0047276 Ga0501043_0047276_387_737 112
374 3300049581 Ga0501047_0206044 Ga0501047_0206044_168_512 112
375 3300049586 Ga0501070_0262242 Ga0501070_0262242_314_664 112
376 3300049705 Ga0501225_0010015 Ga0501225_0010015_206_544 112
377 3300049742 Ga0501080_0612241 Ga0501080_0612241_15_365 112
378 3300049822 Ga0501035_0310240 Ga0501035_0310240_423_773 112
379 3300049823 Ga0501044_0305530 Ga0501044_0305530_176_526 112
380 3300049823 Ga0501044_1139922 Ga0501044_1139922_173_523 112
381 3300050491 nmdc:mga00v17_22300_c1 nmdc:mga00v17_22300_c1_3270_3614 112
382 3300050491 nmdc:mga00v17_397526_c1 nmdc:mga00v17_397526_c1_296_640 112
383 3300050491 nmdc:mga00v17_722647_c1 nmdc:mga00v17_722647_c1_86_433 112
384 iso_pu_bacteria 2524614729 2525556251 112
385 iso_pu_bacteria 2627854209 2630649481 112
386 iso_pu_bacteria 2747842428 2747951117 112
387 iso_pu_bacteria 2765235840 2765577678 112
388 iso_pu_bacteria 2895511927 2895512420 112
389 iso_pu_bacteria 2895522137 2895522431 112
390 iso_pu_bacteria 2895525241 2895525797 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04342

DMT_6

Putative member of DMT superfamily (DUF486)

30

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7379 4 108
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7035 4 108
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.697 4 109
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.6954 4 108
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.6935 7 109
ID Description Score Start End Superfamily
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8238 4 108 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7847 4 109 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7715 8 109 1.10.3730.20
af_Q69YG0_38_145_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7611 7 109 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7573 4 107 1.10.3730.20
ID Description Score Start End GO Terms
AF-J6JAF8-F1-model_v4 Membrane protein, putative 0.9914 3 110 GO:0016020
AF-W6R971-F1-model_v4 Transmembrane protein 0.9863 2 112 GO:0016020
AF-A0A376AFY6-F1-model_v4 EamA domain-containing protein 0.9857 2 112 GO:0016020
AF-B8IYE0-F1-model_v4 DMT family protein 0.9853 7 112 GO:0016020
AF-W8II37-F1-model_v4 deleted 0.9851 1 112

Feature Viewer

pLDDT pTM Quality
93.54 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map