F431649

General Info

Members Datasets Scaffolds Average Seq Length
390 229 383 182

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100030260|Ga0070668_1000302603
Length 205
Sequence MSWTIRRAQSWRERVGSCKPAPSMDRFEPLRRRTIALVGLMGVGKSSVGRRLANALDLPFRDADSEVETAAGRCISDIFAELGEPAFREGERRVIARLLDEPPHVLATGGGAFMDPRTRELIKQKAISVWLKTDLETLARRVGRKDTRPLLAGKDPLQVLQAQADIRYPAYAQADVTLETGDTAHHVTVDQLLRALSAYVEEHAR

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
6 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
7 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
227 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
228 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0.26
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.77
Nodule 0
Rhizoplane 3.59
Rhizosphere 78.21
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10059645 3300002459 Bacteria 786
2 rootH2_10024564 3300003320 Bacteria 4576
3 rootH2_10176406 3300003320 Bacteria 1626
4 rootH1_10055844 3300003323 Bacteria 3616
5 Ga0006562J51391_1023067 3300003578 Bacteria 5790
6 Ga0065165_1106382 3300005262 Bacteria 696
7 Ga0070658_10062090 3300005327 Bacteria 3045
8 Ga0070658_10153936 3300005327 Bacteria 1926
9 Ga0070658_10170211 3300005327 Bacteria 1830
10 Ga0070670_100000044 3300005331 Bacteria 140263
11 Ga0070666_10008244 3300005335 Bacteria 6461
12 Ga0070680_100036097 3300005336 Bacteria 3993
13 Ga0070660_100058345 3300005339 Bacteria 2992
14 Ga0070660_100125918 3300005339 Bacteria 2047
15 Ga0070691_10003676 3300005341 Bacteria 6929
16 Ga0070668_100000098 3300005347 Bacteria 53574
17 Ga0070668_100030260 3300005347 Bacteria 4116
18 Ga0070668_100121641 3300005347 Bacteria 2087
19 Ga0070669_100535114 3300005353 Bacteria 975
20 Ga0070671_100205844 3300005355 Bacteria 1669
21 Ga0070673_100040101 3300005364 Bacteria 3590
22 Ga0070659_100606623 3300005366 Bacteria 941
23 Ga0070667_100004554 3300005367 Bacteria 11668
24 Ga0070667_100194089 3300005367 Bacteria 1800
25 Ga0070709_10412947 3300005434 Unclassified 1010
26 Ga0070713_100153481 3300005436 Bacteria 2050
27 Ga0070662_100062718 3300005457 Bacteria 2717
28 Ga0070681_10003748 3300005458 Bacteria 14267
29 Ga0070679_100016884 3300005530 Bacteria 7056
30 Ga0070679_100094617 3300005530 Bacteria 2975
31 Ga0070679_100425027 3300005530 Bacteria 1274
32 Ga0068853_100002893 3300005539 Bacteria 13032
33 Ga0068853_100054088 3300005539 Bacteria 3459
34 Ga0068853_100441365 3300005539 Bacteria 1223
35 Ga0070665_100000762 3300005548 Bacteria 42638
36 Ga0070665_100000831 3300005548 Bacteria 40349
37 Ga0070665_100002025 3300005548 Bacteria 22786
38 Ga0070665_100065126 3300005548 Bacteria 3656
39 Ga0070665_100135307 3300005548 Bacteria 2466
40 Ga0068855_100083662 3300005563 Bacteria 3696
41 Ga0068855_100287460 3300005563 Bacteria 1824
42 Ga0070664_100049851 3300005564 Bacteria 3542
43 Ga0068856_100074037 3300005614 Bacteria 3372
44 Ga0068856_100131123 3300005614 Bacteria 2511
45 Ga0068859_100031606 3300005617 Bacteria 5317
46 Ga0068864_100000060 3300005618 Bacteria 124506
47 Ga0068864_100000061 3300005618 Bacteria 123373
48 Ga0068863_100000023 3300005841 Bacteria 186490
49 Ga0068863_100000810 3300005841 Bacteria 31370
50 Ga0068863_100106868 3300005841 Bacteria 2663
51 Ga0068863_100285392 3300005841 Bacteria 1600
52 Ga0068858_100000363 3300005842 Bacteria 47852
53 Ga0068858_100003504 3300005842 Bacteria 15561
54 Ga0068860_100000100 3300005843 Bacteria 144580
55 Ga0068860_100000122 3300005843 Bacteria 125178
56 Ga0068860_100170295 3300005843 Bacteria 2103
57 Ga0068862_100006370 3300005844 Bacteria 9814
58 Ga0068862_100018779 3300005844 Bacteria 5761
59 Ga0068862_100051820 3300005844 Bacteria 3510
60 Ga0070717_10151195 3300006028 Bacteria 2008
61 Ga0070717_10299460 3300006028 Bacteria 1429
62 Ga0075368_10020052 3300006042 Bacteria 2528
63 Ga0075363_100030589 3300006048 Bacteria 2788
64 Ga0075364_10002235 3300006051 Bacteria 10852
65 Ga0075362_10058914 3300006177 Bacteria 1733
66 Ga0075367_10003359 3300006178 Bacteria 7611
67 Ga0075366_10188072 3300006195 Bacteria 1255
68 Ga0097621_100229600 3300006237 Bacteria 1620
69 Ga0097620_100031606 3300006931 Bacteria 5317
70 Ga0105251_10118835 3300009011 Bacteria 1201
71 Ga0105240_10002285 3300009093 Bacteria 31035
72 Ga0105240_10027302 3300009093 Bacteria 7476
73 Ga0105240_10176329 3300009093 Bacteria 2527
74 Ga0105240_11522688 3300009093 Bacteria 701
75 Ga0105247_10082642 3300009101 Bacteria 2027
76 Ga0105241_11803615 3300009174 Bacteria 597
77 Ga0105242_10469522 3300009176 Bacteria 1190
78 Ga0105248_10000279 3300009177 Bacteria 60271
79 Ga0105248_10016737 3300009177 Bacteria 8073
80 Ga0105248_10216114 3300009177 Bacteria 2159
81 Ga0105248_10238560 3300009177 Bacteria 2047
82 Ga0105248_10690427 3300009177 Bacteria 1152
83 Ga0105237_10107090 3300009545 Bacteria 2787
84 Ga0105237_11598206 3300009545 Bacteria 659
85 Ga0105238_10038919 3300009551 Bacteria 4827
86 Ga0105238_10061571 3300009551 Bacteria 3755
87 Ga0105238_10075657 3300009551 Bacteria 3358
88 Ga0105249_10000478 3300009553 Bacteria 37253
89 Ga0105249_10832245 3300009553 Bacteria 988
90 Ga0105239_11483002 3300010375 Bacteria 784
91 Ga0105239_11562033 3300010375 Bacteria 763
92 Ga0157373_10000210 3300013100 Bacteria 47969
93 Ga0157373_10000622 3300013100 Bacteria 27778
94 Ga0157371_10079193 3300013102 Bacteria 2328
95 Ga0157371_10107463 3300013102 Bacteria 1980
96 Ga0157370_10086951 3300013104 Bacteria 2936
97 Ga0157370_10354558 3300013104 Bacteria 1352
98 Ga0157370_10791269 3300013104 Bacteria 863
99 Ga0157369_10296531 3300013105 Bacteria 1682
100 Ga0157369_10768897 3300013105 Bacteria 990
101 Ga0163162_10043870 3300013306 Bacteria 4477
102 Ga0163162_10325760 3300013306 Bacteria 1669
103 Ga0163162_10969572 3300013306 Bacteria 961
104 Ga0157372_10010089 3300013307 Bacteria 10036
105 Ga0157372_10016212 3300013307 Bacteria 7994
106 Ga0157372_10150668 3300013307 Bacteria 2684
107 Ga0157375_10061836 3300013308 Bacteria 3719
108 Ga0157375_10943828 3300013308 Bacteria 1005
109 Ga0163163_10134433 3300014325 Bacteria 2513
110 Ga0163163_10172781 3300014325 Bacteria 2208
111 Ga0163163_10215670 3300014325 Bacteria 1968
112 Ga0163163_10401027 3300014325 Bacteria 1430
113 Ga0157379_10007849 3300014968 Bacteria 9244
114 Ga0157379_10471844 3300014968 Bacteria 1160
115 Ga0157379_10500887 3300014968 Bacteria 1126
116 Ga0157376_12018427 3300014969 Bacteria 615
117 Ga0183365_10001 3300015684 Bacteria 2090444
118 Ga0213876_10007251 3300021384 Bacteria 6042
119 Ga0213876_10013544 3300021384 Bacteria 4328
120 Ga0209026_1003836 3300025250 Bacteria 4742
121 Ga0209026_1025449 3300025250 Bacteria 893
122 Ga0209148_1013572 3300025254 Bacteria 1462
123 Ga0209676_1002513 3300025292 Bacteria 12834
124 Ga0209257_1088932 3300025304 Bacteria 775
125 Ga0207710_10062106 3300025900 Bacteria 1697
126 Ga0207680_10050839 3300025903 Bacteria 2476
127 Ga0207680_10067676 3300025903 Bacteria 2201
128 Ga0207705_10003909 3300025909 Bacteria 11330
129 Ga0207705_10229918 3300025909 Bacteria 1410
130 Ga0207705_10320826 3300025909 Bacteria 1190
131 Ga0207654_10032171 3300025911 Bacteria 2896
132 Ga0207707_10037059 3300025912 Bacteria 4261
133 Ga0207707_10304337 3300025912 Bacteria 1378
134 Ga0207695_10002540 3300025913 Bacteria 26801
135 Ga0207695_10004869 3300025913 Bacteria 18113
136 Ga0207695_10034925 3300025913 Bacteria 5460
137 Ga0207671_10091757 3300025914 Bacteria 2289
138 Ga0207671_10541189 3300025914 Bacteria 928
139 Ga0207663_10068668 3300025916 Bacteria 2277
140 Ga0207660_10046833 3300025917 Bacteria 3054
141 Ga0207657_10003993 3300025919 Bacteria 15684
142 Ga0207657_10013472 3300025919 Bacteria 8020
143 Ga0207652_10089483 3300025921 Bacteria 2703
144 Ga0207681_10689061 3300025923 Bacteria 849
145 Ga0207694_10140010 3300025924 Bacteria 1945
146 Ga0207694_10242609 3300025924 Bacteria 1473
147 Ga0207650_10000065 3300025925 Bacteria 140452
148 Ga0207700_10021708 3300025928 Bacteria 4389
149 Ga0207664_10942171 3300025929 Unclassified 775
150 Ga0207644_10082613 3300025931 Bacteria 2377
151 Ga0207690_10001133 3300025932 Bacteria 16976
152 Ga0207706_10033977 3300025933 Bacteria 4539
153 Ga0207704_10000754 3300025938 Bacteria 14276
154 Ga0207711_10000684 3300025941 Bacteria 33642
155 Ga0207711_10009716 3300025941 Bacteria 8007
156 Ga0207711_10149761 3300025941 Bacteria 2105
157 Ga0207711_10301176 3300025941 Bacteria 1479
158 Ga0207711_10495967 3300025941 Unclassified 1138
159 Ga0207679_10016052 3300025945 Bacteria 4965
160 Ga0207679_10298592 3300025945 Bacteria 1387
161 Ga0207679_10402725 3300025945 Bacteria 1204
162 Ga0207667_10038738 3300025949 Bacteria 5085
163 Ga0207667_10797482 3300025949 Bacteria 941
164 Ga0207651_10034016 3300025960 Bacteria 3295
165 Ga0207712_10003999 3300025961 Bacteria 9304
166 Ga0207712_10408017 3300025961 Bacteria 1143
167 Ga0207668_10000018 3300025972 Bacteria 158577
168 Ga0207668_10000340 3300025972 Bacteria 30277
169 Ga0207668_10003586 3300025972 Bacteria 9121
170 Ga0207668_10031834 3300025972 Bacteria 3479
171 Ga0207640_10370742 3300025981 Bacteria 1157
172 Ga0207658_10000168 3300025986 Bacteria 70040
173 Ga0207658_10009178 3300025986 Bacteria 6708
174 Ga0207658_10125994 3300025986 Bacteria 2050
175 Ga0207658_10715572 3300025986 Bacteria 905
176 Ga0207677_10265548 3300026023 Bacteria 1401
177 Ga0207703_10000373 3300026035 Bacteria 47832
178 Ga0207703_10003313 3300026035 Bacteria 13519
179 Ga0207639_10020776 3300026041 Bacteria 4706
180 Ga0207639_10276851 3300026041 Bacteria 1474
181 Ga0207639_10553282 3300026041 Bacteria 1057
182 Ga0207678_10331938 3300026067 Bacteria 1309
183 Ga0207702_10082470 3300026078 Bacteria 2796
184 Ga0207702_10415585 3300026078 Bacteria 1300
185 Ga0207641_10000067 3300026088 Bacteria 155379
186 Ga0207641_10004512 3300026088 Bacteria 12036
187 Ga0207641_10084563 3300026088 Bacteria 2762
188 Ga0207641_10126562 3300026088 Bacteria 2288
189 Ga0207676_10000127 3300026095 Bacteria 66733
190 Ga0207676_10000501 3300026095 Bacteria 33019
191 Ga0207676_10757967 3300026095 Bacteria 944
192 Ga0207676_10807775 3300026095 Bacteria 915
193 Ga0207674_10263640 3300026116 Bacteria 1670
194 Ga0207683_10726558 3300026121 Bacteria 921
195 Ga0209813_10034592 3300027866 Bacteria 1509
196 Ga0268266_10000003 3300028379 Bacteria 1701703
197 Ga0268266_10001138 3300028379 Bacteria 33094
198 Ga0268266_10001678 3300028379 Bacteria 25491
199 Ga0268266_10073770 3300028379 Bacteria 2962
200 Ga0268266_10116660 3300028379 Bacteria 2371
201 Ga0268265_10001007 3300028380 Bacteria 25467
202 Ga0268265_10001898 3300028380 Bacteria 16616
203 Ga0268265_10842666 3300028380 Bacteria 896
204 Ga0268264_10000002 3300028381 Bacteria 1153045
205 Ga0268264_10000172 3300028381 Bacteria 140393
206 Ga0268264_10038750 3300028381 Bacteria 3935
207 Ga0307517_10001099 3300028786 Bacteria 45677
208 Ga0265338_10026611 3300028800 Bacteria 5827
209 Ga0265332_10095122 3300031238 Bacteria 1259
210 Ga0265325_10000157 3300031241 Bacteria 47604
211 Ga0265339_10013122 3300031249 Bacteria 5032
212 Ga0265316_10156211 3300031344 Bacteria 1707
213 Ga0307513_10000208 3300031456 Bacteria 84906
214 Ga0307513_10003813 3300031456 Bacteria 20324
215 Ga0307513_10015171 3300031456 Bacteria 9352
216 Ga0265313_10004565 3300031595 Bacteria 10548
217 Ga0307413_10213237 3300031824 Bacteria 1404
218 Ga0307413_10303063 3300031824 Bacteria 1213
219 Ga0307413_10697109 3300031824 Bacteria 843
220 Ga0307413_10838342 3300031824 Bacteria 776
221 Ga0307409_100040261 3300031995 Bacteria 3477
222 Ga0307414_10209313 3300032004 Bacteria 1592
223 Ga0307414_10277992 3300032004 Bacteria 1405
224 Ga0307414_10353803 3300032004 Bacteria 1261
225 Ga0307414_10441176 3300032004 Bacteria 1139
226 Ga0307414_10446642 3300032004 Bacteria 1133
227 Ga0307414_11151705 3300032004 Bacteria 717
228 Ga0307411_10317915 3300032005 Bacteria 1256
229 Ga0307411_10351907 3300032005 Bacteria 1201
230 Ga0307411_10573215 3300032005 Bacteria 966
231 Ga0307510_10013355 3300033180 Bacteria 9739
232 Ga0373936_0007699 3300035113 Bacteria 4045
233 Ga0373939_0204014 3300035114 Bacteria 749
234 Ga0373945_0438704 3300035116 Unclassified 576
235 Ga0373935_0252444 3300035692 Bacteria 1235
236 Ga0373927_0001609 3300035695 Bacteria 16951
237 Ga0373927_0557767 3300035695 Bacteria 757
238 Ga0373947_0378111 3300035725 Unclassified 953
239 Ga0373937_0050348 3300036401 Bacteria 3815
240 Ga0373925_0000277 3300037068 Bacteria 53450
241 Ga0373925_0020023 3300037068 Bacteria 4868
242 Ga0373925_0496958 3300037068 Bacteria 1001
243 Ga0395899_0002949 3300037312 Bacteria 13636
244 Ga0395899_0276231 3300037312 Bacteria 1144
245 Ga0395899_0329474 3300037312 Bacteria 1026
246 Ga0395900_0000006 3300037418 Bacteria 495364
247 Ga0395900_0044772 3300037418 Bacteria 4559
248 Ga0395900_0375597 3300037418 Bacteria 1390
249 Ga0395898_0012492 3300037466 Bacteria 8780
250 Ga0395898_0124780 3300037466 Bacteria 2466
251 Ga0395898_0486332 3300037466 Bacteria 1174
252 Ga0395898_0788884 3300037466 Bacteria 890
253 Ga0395905_0000593 3300037471 Bacteria 48559
254 Ga0395905_0010639 3300037471 Bacteria 8926
255 Ga0395905_0018837 3300037471 Bacteria 6547
256 Ga0395905_0023548 3300037471 Bacteria 5817
257 Ga0395905_1063905 3300037471 Bacteria 712
258 Ga0395901_0000001 3300038443 Bacteria 800383
259 Ga0395901_0513232 3300038443 Bacteria 1219
260 Ga0436365_0881710 3300039437 Bacteria 6034
261 Ga0436365_1098241 3300039437 Bacteria 2184
262 Ga0436365_1320596 3300039437 Bacteria 5834
263 Ga0436362_0910765 3300039453 Bacteria 583
264 Ga0466969_0038804 3300044656 Bacteria 2394
265 Ga0466966_0000547 3300044684 Bacteria 23971
266 Ga0466966_0439519 3300044684 Bacteria 784
267 Ga0466961_0000182 3300044693 Bacteria 42657
268 Ga0466961_0064173 3300044693 Bacteria 2334
269 Ga0466961_0243899 3300044693 Bacteria 1104
270 Ga0466963_0264710 3300044694 Bacteria 1207
271 Ga0466964_0219184 3300044706 Bacteria 923
272 Ga0466964_0328579 3300044706 Bacteria 779
273 Ga0466971_0000562 3300044719 Bacteria 14692
274 Ga0466968_0083950 3300044735 Bacteria 1404
275 Ga0466970_0015491 3300044765 Bacteria 3921
276 Ga0466957_0002614 3300044842 Bacteria 9709
277 Ga0466957_0124814 3300044842 Bacteria 1644
278 Ga0466959_0000028 3300045049 Bacteria 114144
279 Ga0466959_0181164 3300045049 Bacteria 1473
280 Ga0466958_0000162 3300045836 Bacteria 23703
281 Ga0495629_0013138 3300046459 Bacteria 5980
282 Ga0495585_0149589 3300046492 Bacteria 1218
283 Ga0495585_0179063 3300046492 Bacteria 1091
284 Ga0495594_0127698 3300046499 Bacteria 1439
285 Ga0495583_0027347 3300046506 Bacteria 2815
286 Ga0495583_0101508 3300046506 Bacteria 1227
287 Ga0495606_0180656 3300046507 Bacteria 1216
288 Ga0495643_0074428 3300046522 Bacteria 1778
289 Ga0495642_0093426 3300046528 Bacteria 1275
290 Ga0495642_0203360 3300046528 Bacteria 863
291 Ga0495597_0003430 3300046542 Bacteria 9259
292 Ga0495597_0171133 3300046542 Bacteria 882
293 Ga0495645_0113838 3300046543 Bacteria 1912
294 Ga0495622_0048084 3300046557 Bacteria 1982
295 Ga0495668_0024109 3300046616 Bacteria 3462
296 Ga0495668_0076078 3300046616 Bacteria 1843
297 Ga0495668_0641651 3300046616 Bacteria 587
298 Ga0495611_0192042 3300046648 Bacteria 953
299 Ga0495625_0021491 3300046660 Bacteria 4970
300 Ga0495669_0000005 3300046684 Bacteria 193971
301 Ga0495669_0000467 3300046684 Bacteria 18809
302 Ga0495669_0190135 3300046684 Bacteria 980
303 Ga0495669_0354243 3300046684 Bacteria 710
304 Ga0495649_0000418 3300046694 Bacteria 36933
305 Ga0495581_0242723 3300047315 Bacteria 1053
306 Ga0495672_0038533 3300047320 Bacteria 2915
307 Ga0495677_0012122 3300047445 Bacteria 3146
308 Ga0495686_0163128 3300047472 Bacteria 1301
309 Ga0495593_0130408 3300047673 Bacteria 1276
310 Ga0495602_0356439 3300048088 Bacteria 1054
311 Ga0496100_0658785 3300048903 Bacteria 815
312 Ga0496100_0732259 3300048903 Bacteria 773
313 Ga0496101_0272242 3300048904 Bacteria 1322
314 Ga0496102_0012184 3300048905 Bacteria 7434
315 Ga0496102_0072539 3300048905 Bacteria 3164
316 Ga0496103_0135120 3300048906 Bacteria 1576
317 Ga0496107_0050697 3300048910 Bacteria 2993
318 Ga0496109_0386865 3300048912 Bacteria 1321
319 Ga0496110_0181345 3300048913 Bacteria 1912
320 Ga0496112_0120929 3300048915 Bacteria 2588
321 Ga0496112_0670804 3300048915 Unclassified 966
322 Ga0496113_0428621 3300048916 Bacteria 1062
323 Ga0496115_0001297 3300048918 Bacteria 17851
324 Ga0496115_0002467 3300048918 Bacteria 13293
325 Ga0496117_0015296 3300048920 Bacteria 6550
326 Ga0496118_0017509 3300048921 Bacteria 6518
327 Ga0496119_0057137 3300048922 Bacteria 2360
328 Ga0496121_0000053 3300048924 Bacteria 312611
329 Ga0496122_0005524 3300048925 Bacteria 15017
330 Ga0496123_0000699 3300048926 Bacteria 55169
331 Ga0501033_0022928 3300049570 Bacteria 4707
332 Ga0501033_0113174 3300049570 Bacteria 1974
333 Ga0501033_0283306 3300049570 Bacteria 1170
334 Ga0501033_0394469 3300049570 Bacteria 966
335 Ga0501033_0631981 3300049570 Bacteria 732
336 Ga0501034_0175612 3300049571 Bacteria 2108
337 Ga0501034_0957345 3300049571 Bacteria 742
338 Ga0501043_0444274 3300049579 Unclassified 975
339 Ga0501043_0583010 3300049579 Bacteria 828
340 Ga0501047_0001732 3300049581 Bacteria 21205
341 Ga0501047_0047577 3300049581 Bacteria 4143
342 Ga0501047_0093326 3300049581 Bacteria 2889
343 Ga0501047_0248397 3300049581 Bacteria 1628
344 Ga0501070_0539165 3300049586 Bacteria 935
345 Ga0501083_0423635 3300049744 Bacteria 866
346 Ga0501035_0177995 3300049822 Bacteria 1834
347 Ga0501035_0413255 3300049822 Bacteria 1121
348 Ga0501035_1267138 3300049822 Bacteria 570
349 Ga0501044_0003119 3300049823 Bacteria 18782
350 Ga0501044_0176427 3300049823 Bacteria 2106
351 Ga0501044_0586503 3300049823 Bacteria 1009
352 nmdc:mga03683_499724_c1 3300050489 Bacteria 589
353 nmdc:mga03n38_17825_c1 3300050490 Bacteria 2788
354 nmdc:mga03n38_87938_c1 3300050490 Bacteria 1473
355 nmdc:mga00v17_1417_c1 3300050491 Bacteria 10795
356 nmdc:mga06z11_76704_c1 3300050494 Bacteria 1783
357 nmdc:mga04h51_41153_c1 3300050495 Bacteria 1509
358 nmdc:mga07m45_175976_c1 3300050496 Bacteria 1244
359 Ga0500635_0001351 3300053080 Bacteria 5875
360 Ga0500578_0285126 3300053086 Unclassified 984
361 Ga0500643_021413 3300053087 Bacteria 2096
362 Ga0500651_0201486 3300053093 Bacteria 1174
363 Ga0500566_0227898 3300053094 Bacteria 921
364 Ga0500641_0064492 3300053096 Bacteria 1530
365 Ga0500562_009943 3300053108 Bacteria 2406
366 Ga0500572_023074 3300053111 Bacteria 1667
367 Ga0500595_008760 3300053119 Bacteria 4114
368 Ga0500607_118105 3300053121 Bacteria 1288
369 Ga0500608_000148 3300053122 Bacteria 29285
370 Ga0500608_002477 3300053122 Bacteria 6726
371 Ga0500608_198373 3300053122 Bacteria 832
372 Ga0500614_020881 3300053123 Bacteria 1515
373 Ga0500642_0143273 3300053130 Bacteria 1121
374 Ga0500658_0100438 3300053134 Bacteria 1262
375 Ga0500559_0018889 3300053136 Bacteria 2912
376 Ga0500577_0138305 3300053142 Bacteria 1026
377 Ga0500590_121580 3300053148 Bacteria 1222
378 Ga0500616_0076970 3300053153 Bacteria 1686
379 Ga0500637_0209090 3300053178 Bacteria 1107
380 Ga0500576_102670 3300053725 Bacteria 1163
381 Ga0500625_089150 3300053729 Bacteria 1325
382 Ga0500596_001262 3300053735 Bacteria 5114
383 Ga0466962_0000142 3300061719 Bacteria 29518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100194089 Ga0070667_1001940892 161
2 3300025986 Ga0207658_10125994 Ga0207658_101259942 161
3 3300003323 rootH1_10055844 rootH1_100558443 164
4 3300005434 Ga0070709_10412947 Ga0070709_104129471 164
5 3300005436 Ga0070713_100153481 Ga0070713_1001534813 164
6 3300044694 Ga0466963_0264710 Ga0466963_0264710_635_1129 164
7 3300044706 Ga0466964_0219184 Ga0466964_0219184_12_506 164
8 3300006177 Ga0075362_10058914 Ga0075362_100589141 165
9 3300025929 Ga0207664_10942171 Ga0207664_109421712 165
10 3300031456 Ga0307513_10003813 Ga0307513_1000381316 165
11 3300037466 Ga0395898_0486332 Ga0395898_0486332_44_541 165
12 3300037466 Ga0395898_0788884 Ga0395898_0788884_370_867 165
13 3300039453 Ga0436362_0910765 Ga0436362_0910765_24_521 165
14 3300044693 Ga0466961_0243899 Ga0466961_0243899_93_590 165
15 3300045049 Ga0466959_0181164 Ga0466959_0181164_945_1442 165
16 3300046616 Ga0495668_0641651 Ga0495668_0641651_70_567 165
17 3300050489 nmdc:mga03683_499724_c1 nmdc:mga03683_499724_c1_56_553 165
18 3300050490 nmdc:mga03n38_87938_c1 nmdc:mga03n38_87938_c1_913_1410 165
19 3300049822 Ga0501035_1267138 Ga0501035_1267138_28_528 166
20 3300025916 Ga0207663_10068668 Ga0207663_100686682 168
21 3300047320 Ga0495672_0038533 Ga0495672_0038533_32_541 169
22 3300049579 Ga0501043_0444274 Ga0501043_0444274_48_605 173
23 3300013307 Ga0157372_10010089 Ga0157372_100100895 176
24 3300013307 Ga0157372_10016212 Ga0157372_100162128 176
25 3300013307 Ga0157372_10150668 Ga0157372_101506682 176
26 3300021384 Ga0213876_10007251 Ga0213876_100072515 176
27 3300025928 Ga0207700_10021708 Ga0207700_100217084 176
28 3300031238 Ga0265332_10095122 Ga0265332_100951222 176
29 3300031241 Ga0265325_10000157 Ga0265325_100001578 176
30 3300031249 Ga0265339_10013122 Ga0265339_100131223 176
31 3300031344 Ga0265316_10156211 Ga0265316_101562113 176
32 3300031595 Ga0265313_10004565 Ga0265313_100045659 176
33 3300035116 Ga0373945_0438704 Ga0373945_0438704_30_560 176
34 3300035692 Ga0373935_0252444 Ga0373935_0252444_256_786 176
35 3300036401 Ga0373937_0050348 Ga0373937_0050348_780_1310 176
36 3300037068 Ga0373925_0496958 Ga0373925_0496958_419_949 176
37 3300039437 Ga0436365_0881710 Ga0436365_0881710_2264_2794 176
38 3300048915 Ga0496112_0670804 Ga0496112_0670804_75_605 176
39 3300005331 Ga0070670_100000044 Ga0070670_10000004425 177
40 3300005335 Ga0070666_10008244 Ga0070666_100082444 177
41 3300005347 Ga0070668_100000098 Ga0070668_10000009812 177
42 3300005367 Ga0070667_100004554 Ga0070667_1000045547 177
43 3300005548 Ga0070665_100002025 Ga0070665_1000020258 177
44 3300005617 Ga0068859_100031606 Ga0068859_1000316063 177
45 3300005618 Ga0068864_100000061 Ga0068864_10000006196 177
46 3300005841 Ga0068863_100000810 Ga0068863_10000081026 177
47 3300005842 Ga0068858_100003504 Ga0068858_1000035048 177
48 3300005843 Ga0068860_100000122 Ga0068860_10000012297 177
49 3300005844 Ga0068862_100006370 Ga0068862_1000063708 177
50 3300006931 Ga0097620_100031606 Ga0097620_1000316064 177
51 3300009101 Ga0105247_10082642 Ga0105247_100826422 177
52 3300009177 Ga0105248_10216114 Ga0105248_102161142 177
53 3300009553 Ga0105249_10000478 Ga0105249_100004785 177
54 3300013306 Ga0163162_10043870 Ga0163162_100438703 177
55 3300014325 Ga0163163_10215670 Ga0163163_102156702 177
56 3300014968 Ga0157379_10007849 Ga0157379_100078495 177
57 3300025900 Ga0207710_10062106 Ga0207710_100621062 177
58 3300025903 Ga0207680_10050839 Ga0207680_100508393 177
59 3300025925 Ga0207650_10000065 Ga0207650_1000006525 177
60 3300025941 Ga0207711_10149761 Ga0207711_101497612 177
61 3300025961 Ga0207712_10003999 Ga0207712_100039997 177
62 3300025972 Ga0207668_10000340 Ga0207668_1000034025 177
63 3300025986 Ga0207658_10000168 Ga0207658_1000016826 177
64 3300026035 Ga0207703_10003313 Ga0207703_100033137 177
65 3300026088 Ga0207641_10004512 Ga0207641_1000451210 177
66 3300026095 Ga0207676_10000127 Ga0207676_100001276 177
67 3300028379 Ga0268266_10001138 Ga0268266_100011384 177
68 3300028380 Ga0268265_10001007 Ga0268265_1000100723 177
69 3300028381 Ga0268264_10000172 Ga0268264_10000172111 177
70 3300028800 Ga0265338_10026611 Ga0265338_100266112 177
71 3300037471 Ga0395905_0000593 Ga0395905_0000593_24024_24608 177
72 3300048903 Ga0496100_0732259 Ga0496100_0732259_159_698 177
73 3300048905 Ga0496102_0072539 Ga0496102_0072539_548_1087 177
74 3300048906 Ga0496103_0135120 Ga0496103_0135120_886_1425 177
75 iso_pu_bacteria 2643221598 2644000598 177
76 iso_pu_bacteria 2643221614 2644088446 177
77 iso_pu_bacteria 2643221661 2644343682 177
78 iso_pu_bacteria 2643221666 2644368840 177
79 3300013102 Ga0157371_10107463 Ga0157371_101074632 178
80 3300013104 Ga0157370_10086951 Ga0157370_100869513 178
81 3300047472 Ga0495686_0163128 Ga0495686_0163128_468_1010 178
82 3300053122 Ga0500608_000148 Ga0500608_000148_2558_3100 178
83 3300026023 Ga0207677_10265548 Ga0207677_102655482 179
84 3300026088 Ga0207641_10126562 Ga0207641_101265623 179
85 3300005262 Ga0065165_1106382 Ga0065165_11063821 180
86 3300005327 Ga0070658_10062090 Ga0070658_100620903 180
87 3300005327 Ga0070658_10153936 Ga0070658_101539362 180
88 3300005327 Ga0070658_10170211 Ga0070658_101702112 180
89 3300005336 Ga0070680_100036097 Ga0070680_1000360972 180
90 3300005339 Ga0070660_100058345 Ga0070660_1000583452 180
91 3300005339 Ga0070660_100125918 Ga0070660_1001259182 180
92 3300005341 Ga0070691_10003676 Ga0070691_100036765 180
93 3300005347 Ga0070668_100030260 Ga0070668_1000302603 180
94 3300005347 Ga0070668_100121641 Ga0070668_1001216412 180
95 3300005355 Ga0070671_100205844 Ga0070671_1002058442 180
96 3300005364 Ga0070673_100040101 Ga0070673_1000401014 180
97 3300005366 Ga0070659_100606623 Ga0070659_1006066232 180
98 3300005457 Ga0070662_100062718 Ga0070662_1000627183 180
99 3300005458 Ga0070681_10003748 Ga0070681_100037486 180
100 3300005530 Ga0070679_100016884 Ga0070679_1000168843 180
101 3300005530 Ga0070679_100094617 Ga0070679_1000946171 180
102 3300005530 Ga0070679_100425027 Ga0070679_1004250272 180
103 3300005539 Ga0068853_100054088 Ga0068853_1000540883 180
104 3300005539 Ga0068853_100441365 Ga0068853_1004413651 180
105 3300005548 Ga0070665_100000762 Ga0070665_10000076214 180
106 3300005548 Ga0070665_100000831 Ga0070665_10000083115 180
107 3300005548 Ga0070665_100065126 Ga0070665_1000651263 180
108 3300005563 Ga0068855_100083662 Ga0068855_1000836622 180
109 3300005563 Ga0068855_100287460 Ga0068855_1002874602 180
110 3300005614 Ga0068856_100074037 Ga0068856_1000740372 180
111 3300005618 Ga0068864_100000060 Ga0068864_10000006082 180
112 3300005841 Ga0068863_100000023 Ga0068863_10000002348 180
113 3300005841 Ga0068863_100106868 Ga0068863_1001068683 180
114 3300005842 Ga0068858_100000363 Ga0068858_1000003632 180
115 3300005843 Ga0068860_100000100 Ga0068860_10000010047 180
116 3300005844 Ga0068862_100018779 Ga0068862_1000187795 180
117 3300006028 Ga0070717_10151195 Ga0070717_101511952 180
118 3300006028 Ga0070717_10299460 Ga0070717_102994602 180
119 3300006042 Ga0075368_10020052 Ga0075368_100200522 180
120 3300006048 Ga0075363_100030589 Ga0075363_1000305892 180
121 3300006051 Ga0075364_10002235 Ga0075364_100022355 180
122 3300006178 Ga0075367_10003359 Ga0075367_1000335911 180
123 3300006195 Ga0075366_10188072 Ga0075366_101880722 180
124 3300006237 Ga0097621_100229600 Ga0097621_1002296002 180
125 3300009011 Ga0105251_10118835 Ga0105251_101188351 180
126 3300009093 Ga0105240_10002285 Ga0105240_100022858 180
127 3300009093 Ga0105240_10027302 Ga0105240_100273026 180
128 3300009093 Ga0105240_10176329 Ga0105240_101763292 180
129 3300009093 Ga0105240_11522688 Ga0105240_115226881 180
130 3300009174 Ga0105241_11803615 Ga0105241_118036151 180
131 3300009176 Ga0105242_10469522 Ga0105242_104695221 180
132 3300009177 Ga0105248_10000279 Ga0105248_1000027961 180
133 3300009177 Ga0105248_10016737 Ga0105248_100167372 180
134 3300009177 Ga0105248_10238560 Ga0105248_102385602 180
135 3300009177 Ga0105248_10690427 Ga0105248_106904272 180
136 3300009545 Ga0105237_10107090 Ga0105237_101070903 180
137 3300009545 Ga0105237_11598206 Ga0105237_115982061 180
138 3300009551 Ga0105238_10038919 Ga0105238_100389193 180
139 3300009551 Ga0105238_10061571 Ga0105238_100615712 180
140 3300009551 Ga0105238_10075657 Ga0105238_100756573 180
141 3300010375 Ga0105239_11483002 Ga0105239_114830021 180
142 3300010375 Ga0105239_11562033 Ga0105239_115620332 180
143 3300013104 Ga0157370_10791269 Ga0157370_107912692 180
144 3300013105 Ga0157369_10296531 Ga0157369_102965312 180
145 3300013105 Ga0157369_10768897 Ga0157369_107688972 180
146 3300013306 Ga0163162_10325760 Ga0163162_103257602 180
147 3300013306 Ga0163162_10969572 Ga0163162_109695722 180
148 3300013308 Ga0157375_10061836 Ga0157375_100618363 180
149 3300013308 Ga0157375_10943828 Ga0157375_109438281 180
150 3300014325 Ga0163163_10134433 Ga0163163_101344332 180
151 3300014325 Ga0163163_10172781 Ga0163163_101727813 180
152 3300014325 Ga0163163_10401027 Ga0163163_104010272 180
153 3300014968 Ga0157379_10471844 Ga0157379_104718442 180
154 3300014968 Ga0157379_10500887 Ga0157379_105008872 180
155 3300014969 Ga0157376_12018427 Ga0157376_120184271 180
156 3300021384 Ga0213876_10013544 Ga0213876_100135443 180
157 3300025250 Ga0209026_1025449 Ga0209026_10254491 180
158 3300025254 Ga0209148_1013572 Ga0209148_10135722 180
159 3300025903 Ga0207680_10067676 Ga0207680_100676762 180
160 3300025909 Ga0207705_10003909 Ga0207705_100039093 180
161 3300025909 Ga0207705_10229918 Ga0207705_102299182 180
162 3300025909 Ga0207705_10320826 Ga0207705_103208262 180
163 3300025911 Ga0207654_10032171 Ga0207654_100321712 180
164 3300025912 Ga0207707_10037059 Ga0207707_100370592 180
165 3300025912 Ga0207707_10304337 Ga0207707_103043372 180
166 3300025913 Ga0207695_10002540 Ga0207695_1000254013 180
167 3300025913 Ga0207695_10004869 Ga0207695_100048697 180
168 3300025913 Ga0207695_10034925 Ga0207695_100349253 180
169 3300025914 Ga0207671_10091757 Ga0207671_100917572 180
170 3300025914 Ga0207671_10541189 Ga0207671_105411892 180
171 3300025917 Ga0207660_10046833 Ga0207660_100468333 180
172 3300025919 Ga0207657_10003993 Ga0207657_1000399312 180
173 3300025919 Ga0207657_10013472 Ga0207657_100134726 180
174 3300025921 Ga0207652_10089483 Ga0207652_100894832 180
175 3300025924 Ga0207694_10140010 Ga0207694_101400102 180
176 3300025924 Ga0207694_10242609 Ga0207694_102426092 180
177 3300025931 Ga0207644_10082613 Ga0207644_100826132 180
178 3300025932 Ga0207690_10001133 Ga0207690_1000113315 180
179 3300025933 Ga0207706_10033977 Ga0207706_100339772 180
180 3300025938 Ga0207704_10000754 Ga0207704_100007543 180
181 3300025941 Ga0207711_10000684 Ga0207711_1000068431 180
182 3300025941 Ga0207711_10009716 Ga0207711_100097166 180
183 3300025941 Ga0207711_10301176 Ga0207711_103011761 180
184 3300025941 Ga0207711_10495967 Ga0207711_104959672 180
185 3300025945 Ga0207679_10298592 Ga0207679_102985922 180
186 3300025945 Ga0207679_10402725 Ga0207679_104027252 180
187 3300025949 Ga0207667_10038738 Ga0207667_100387383 180
188 3300025949 Ga0207667_10797482 Ga0207667_107974822 180
189 3300025960 Ga0207651_10034016 Ga0207651_100340164 180
190 3300025972 Ga0207668_10000018 Ga0207668_1000001887 180
191 3300025972 Ga0207668_10031834 Ga0207668_100318344 180
192 3300025981 Ga0207640_10370742 Ga0207640_103707422 180
193 3300025986 Ga0207658_10009178 Ga0207658_100091782 180
194 3300025986 Ga0207658_10715572 Ga0207658_107155722 180
195 3300026035 Ga0207703_10000373 Ga0207703_100003731 180
196 3300026041 Ga0207639_10276851 Ga0207639_102768512 180
197 3300026041 Ga0207639_10553282 Ga0207639_105532821 180
198 3300026078 Ga0207702_10415585 Ga0207702_104155852 180
199 3300026088 Ga0207641_10000067 Ga0207641_1000006777 180
200 3300026088 Ga0207641_10084563 Ga0207641_100845632 180
201 3300026095 Ga0207676_10000501 Ga0207676_100005012 180
202 3300026095 Ga0207676_10757967 Ga0207676_107579672 180
203 3300026095 Ga0207676_10807775 Ga0207676_108077752 180
204 3300026116 Ga0207674_10263640 Ga0207674_102636402 180
205 3300026121 Ga0207683_10726558 Ga0207683_107265581 180
206 3300027866 Ga0209813_10034592 Ga0209813_100345922 180
207 3300028379 Ga0268266_10000003 Ga0268266_10000003271 180
208 3300028379 Ga0268266_10001678 Ga0268266_1000167824 180
209 3300028379 Ga0268266_10116660 Ga0268266_101166603 180
210 3300028380 Ga0268265_10001898 Ga0268265_100018983 180
211 3300028380 Ga0268265_10842666 Ga0268265_108426662 180
212 3300028381 Ga0268264_10000002 Ga0268264_10000002787 180
213 3300028786 Ga0307517_10001099 Ga0307517_1000109921 180
214 3300031456 Ga0307513_10000208 Ga0307513_1000020841 180
215 3300031456 Ga0307513_10015171 Ga0307513_100151717 180
216 3300031824 Ga0307413_10213237 Ga0307413_102132372 180
217 3300031824 Ga0307413_10303063 Ga0307413_103030631 180
218 3300031824 Ga0307413_10697109 Ga0307413_106971092 180
219 3300031995 Ga0307409_100040261 Ga0307409_1000402613 180
220 3300032004 Ga0307414_10441176 Ga0307414_104411762 180
221 3300032005 Ga0307411_10317915 Ga0307411_103179152 180
222 3300032005 Ga0307411_10351907 Ga0307411_103519072 180
223 3300032005 Ga0307411_10573215 Ga0307411_105732152 180
224 3300033180 Ga0307510_10013355 Ga0307510_100133553 180
225 3300035113 Ga0373936_0007699 Ga0373936_0007699_2742_3290 180
226 3300035114 Ga0373939_0204014 Ga0373939_0204014_114_662 180
227 3300035695 Ga0373927_0001609 Ga0373927_0001609_6975_7523 180
228 3300035695 Ga0373927_0557767 Ga0373927_0557767_47_595 180
229 3300035725 Ga0373947_0378111 Ga0373947_0378111_21_569 180
230 3300037068 Ga0373925_0000277 Ga0373925_0000277_37892_38440 180
231 3300037068 Ga0373925_0020023 Ga0373925_0020023_2383_2931 180
232 3300037312 Ga0395899_0002949 Ga0395899_0002949_12424_12972 180
233 3300037312 Ga0395899_0276231 Ga0395899_0276231_576_1124 180
234 3300037312 Ga0395899_0329474 Ga0395899_0329474_147_695 180
235 3300037418 Ga0395900_0000006 Ga0395900_0000006_452458_453006 180
236 3300037418 Ga0395900_0044772 Ga0395900_0044772_105_653 180
237 3300037418 Ga0395900_0375597 Ga0395900_0375597_83_631 180
238 3300037466 Ga0395898_0012492 Ga0395898_0012492_4423_4971 180
239 3300037466 Ga0395898_0124780 Ga0395898_0124780_1225_1773 180
240 3300037471 Ga0395905_0010639 Ga0395905_0010639_7137_7685 180
241 3300037471 Ga0395905_0023548 Ga0395905_0023548_1045_1593 180
242 3300037471 Ga0395905_1063905 Ga0395905_1063905_23_571 180
243 3300038443 Ga0395901_0000001 Ga0395901_0000001_495705_496253 180
244 3300038443 Ga0395901_0513232 Ga0395901_0513232_297_845 180
245 3300039437 Ga0436365_1098241 Ga0436365_1098241_350_898 180
246 3300039437 Ga0436365_1320596 Ga0436365_1320596_1897_2445 180
247 3300044684 Ga0466966_0439519 Ga0466966_0439519_170_718 180
248 3300044706 Ga0466964_0328579 Ga0466964_0328579_38_586 180
249 3300044735 Ga0466968_0083950 Ga0466968_0083950_303_851 180
250 3300044842 Ga0466957_0124814 Ga0466957_0124814_266_814 180
251 3300046459 Ga0495629_0013138 Ga0495629_0013138_1284_1832 180
252 3300046492 Ga0495585_0149589 Ga0495585_0149589_58_606 180
253 3300046492 Ga0495585_0179063 Ga0495585_0179063_344_892 180
254 3300046499 Ga0495594_0127698 Ga0495594_0127698_849_1397 180
255 3300046506 Ga0495583_0027347 Ga0495583_0027347_111_659 180
256 3300046506 Ga0495583_0101508 Ga0495583_0101508_472_1020 180
257 3300046507 Ga0495606_0180656 Ga0495606_0180656_77_625 180
258 3300046522 Ga0495643_0074428 Ga0495643_0074428_169_717 180
259 3300046528 Ga0495642_0093426 Ga0495642_0093426_599_1147 180
260 3300046528 Ga0495642_0203360 Ga0495642_0203360_232_780 180
261 3300046542 Ga0495597_0003430 Ga0495597_0003430_8406_8954 180
262 3300046543 Ga0495645_0113838 Ga0495645_0113838_1230_1778 180
263 3300046557 Ga0495622_0048084 Ga0495622_0048084_596_1144 180
264 3300046616 Ga0495668_0024109 Ga0495668_0024109_257_805 180
265 3300046616 Ga0495668_0076078 Ga0495668_0076078_236_784 180
266 3300046648 Ga0495611_0192042 Ga0495611_0192042_81_629 180
267 3300046660 Ga0495625_0021491 Ga0495625_0021491_1132_1680 180
268 3300046684 Ga0495669_0000005 Ga0495669_0000005_163258_163806 180
269 3300046684 Ga0495669_0000467 Ga0495669_0000467_1758_2306 180
270 3300046684 Ga0495669_0190135 Ga0495669_0190135_78_626 180
271 3300046684 Ga0495669_0354243 Ga0495669_0354243_40_588 180
272 3300047315 Ga0495581_0242723 Ga0495581_0242723_190_738 180
273 3300047445 Ga0495677_0012122 Ga0495677_0012122_1220_1768 180
274 3300047673 Ga0495593_0130408 Ga0495593_0130408_35_583 180
275 3300048088 Ga0495602_0356439 Ga0495602_0356439_374_922 180
276 3300048903 Ga0496100_0658785 Ga0496100_0658785_190_738 180
277 3300048904 Ga0496101_0272242 Ga0496101_0272242_641_1189 180
278 3300048905 Ga0496102_0012184 Ga0496102_0012184_5157_5705 180
279 3300048910 Ga0496107_0050697 Ga0496107_0050697_820_1368 180
280 3300048912 Ga0496109_0386865 Ga0496109_0386865_31_579 180
281 3300048913 Ga0496110_0181345 Ga0496110_0181345_399_947 180
282 3300048915 Ga0496112_0120929 Ga0496112_0120929_1541_2089 180
283 3300048916 Ga0496113_0428621 Ga0496113_0428621_399_947 180
284 3300048918 Ga0496115_0002467 Ga0496115_0002467_4300_4848 180
285 3300048920 Ga0496117_0015296 Ga0496117_0015296_2574_3122 180
286 3300048921 Ga0496118_0017509 Ga0496118_0017509_4711_5259 180
287 3300048922 Ga0496119_0057137 Ga0496119_0057137_230_778 180
288 3300048924 Ga0496121_0000053 Ga0496121_0000053_253505_254053 180
289 3300049570 Ga0501033_0022928 Ga0501033_0022928_1606_2154 180
290 3300049570 Ga0501033_0394469 Ga0501033_0394469_30_578 180
291 3300049579 Ga0501043_0583010 Ga0501043_0583010_166_714 180
292 3300049581 Ga0501047_0001732 Ga0501047_0001732_13567_14115 180
293 3300049581 Ga0501047_0093326 Ga0501047_0093326_761_1309 180
294 3300049744 Ga0501083_0423635 Ga0501083_0423635_20_568 180
295 3300049822 Ga0501035_0413255 Ga0501035_0413255_210_758 180
296 3300049823 Ga0501044_0003119 Ga0501044_0003119_7780_8328 180
297 3300049823 Ga0501044_0586503 Ga0501044_0586503_434_982 180
298 3300050490 nmdc:mga03n38_17825_c1 nmdc:mga03n38_17825_c1_391_939 180
299 3300050491 nmdc:mga00v17_1417_c1 nmdc:mga00v17_1417_c1_7261_7809 180
300 3300050494 nmdc:mga06z11_76704_c1 nmdc:mga06z11_76704_c1_388_936 180
301 3300050495 nmdc:mga04h51_41153_c1 nmdc:mga04h51_41153_c1_394_942 180
302 3300050496 nmdc:mga07m45_175976_c1 nmdc:mga07m45_175976_c1_426_974 180
303 3300053086 Ga0500578_0285126 Ga0500578_0285126_183_731 180
304 3300053087 Ga0500643_021413 Ga0500643_021413_104_652 180
305 3300053093 Ga0500651_0201486 Ga0500651_0201486_321_869 180
306 3300053094 Ga0500566_0227898 Ga0500566_0227898_41_589 180
307 3300053096 Ga0500641_0064492 Ga0500641_0064492_246_794 180
308 3300053108 Ga0500562_009943 Ga0500562_009943_1652_2200 180
309 3300053111 Ga0500572_023074 Ga0500572_023074_853_1401 180
310 3300053119 Ga0500595_008760 Ga0500595_008760_3234_3782 180
311 3300053121 Ga0500607_118105 Ga0500607_118105_673_1221 180
312 3300053122 Ga0500608_002477 Ga0500608_002477_5833_6381 180
313 3300053123 Ga0500614_020881 Ga0500614_020881_630_1178 180
314 3300053130 Ga0500642_0143273 Ga0500642_0143273_411_959 180
315 3300053134 Ga0500658_0100438 Ga0500658_0100438_330_878 180
316 3300053136 Ga0500559_0018889 Ga0500559_0018889_348_896 180
317 3300053142 Ga0500577_0138305 Ga0500577_0138305_411_959 180
318 3300053148 Ga0500590_121580 Ga0500590_121580_296_844 180
319 3300053153 Ga0500616_0076970 Ga0500616_0076970_467_1012 180
320 3300053178 Ga0500637_0209090 Ga0500637_0209090_273_821 180
321 3300053725 Ga0500576_102670 Ga0500576_102670_128_676 180
322 3300053729 Ga0500625_089150 Ga0500625_089150_371_919 180
323 3300053735 Ga0500596_001262 Ga0500596_001262_4242_4790 180
324 iso_pu_bacteria 2739367756 2739792300 180
325 3300005539 Ga0068853_100002893 Ga0068853_10000289310 181
326 3300005564 Ga0070664_100049851 Ga0070664_1000498512 181
327 3300005614 Ga0068856_100131123 Ga0068856_1001311232 181
328 3300013100 Ga0157373_10000210 Ga0157373_100002108 181
329 3300013100 Ga0157373_10000622 Ga0157373_100006228 181
330 3300013104 Ga0157370_10354558 Ga0157370_103545582 181
331 3300015684 Ga0183365_10001 Ga0183365_100011736 181
332 3300025945 Ga0207679_10016052 Ga0207679_100160524 181
333 3300026041 Ga0207639_10020776 Ga0207639_100207763 181
334 3300026078 Ga0207702_10082470 Ga0207702_100824702 181
335 3300044656 Ga0466969_0038804 Ga0466969_0038804_1709_2290 181
336 3300044684 Ga0466966_0000547 Ga0466966_0000547_7231_7812 181
337 3300044693 Ga0466961_0000182 Ga0466961_0000182_32050_32631 181
338 3300044719 Ga0466971_0000562 Ga0466971_0000562_2507_3088 181
339 3300044765 Ga0466970_0015491 Ga0466970_0015491_2190_2771 181
340 3300044842 Ga0466957_0002614 Ga0466957_0002614_2879_3460 181
341 3300045049 Ga0466959_0000028 Ga0466959_0000028_20269_20850 181
342 3300045836 Ga0466958_0000162 Ga0466958_0000162_14976_15557 181
343 3300049570 Ga0501033_0283306 Ga0501033_0283306_456_1007 181
344 3300049571 Ga0501034_0175612 Ga0501034_0175612_570_1184 181
345 3300049571 Ga0501034_0957345 Ga0501034_0957345_181_732 181
346 3300049823 Ga0501044_0176427 Ga0501044_0176427_934_1485 181
347 3300053080 Ga0500635_0001351 Ga0500635_0001351_685_1266 181
348 3300053122 Ga0500608_198373 Ga0500608_198373_237_818 181
349 3300061719 Ga0466962_0000142 Ga0466962_0000142_21616_22197 181
350 3300003320 rootH2_10024564 rootH2_100245642 182
351 3300003320 rootH2_10176406 rootH2_101764062 182
352 3300044693 Ga0466961_0064173 Ga0466961_0064173_947_1531 182
353 3300049570 Ga0501033_0113174 Ga0501033_0113174_665_1216 182
354 3300049570 Ga0501033_0631981 Ga0501033_0631981_128_703 182
355 3300049581 Ga0501047_0047577 Ga0501047_0047577_1162_1713 182
356 3300049586 Ga0501070_0539165 Ga0501070_0539165_310_861 182
357 3300049822 Ga0501035_0177995 Ga0501035_0177995_858_1409 182
358 iso_pu_bacteria 2928972540 2928974701 182
359 iso_pu_bacteria 2977240413 2977242258 182
360 3300003578 Ga0006562J51391_1023067 Ga0006562J51391_10230677 183
361 3300013102 Ga0157371_10079193 Ga0157371_100791933 183
362 3300025292 Ga0209676_1002513 Ga0209676_10025135 183
363 3300025304 Ga0209257_1088932 Ga0209257_10889322 183
364 3300032004 Ga0307414_10446642 Ga0307414_104466422 183
365 3300032004 Ga0307414_11151705 Ga0307414_111517051 183
366 3300048925 Ga0496122_0005524 Ga0496122_0005524_837_1403 183
367 3300048926 Ga0496123_0000699 Ga0496123_0000699_33124_33690 183
368 3300049581 Ga0501047_0248397 Ga0501047_0248397_830_1417 183
369 3300025250 Ga0209026_1003836 Ga0209026_10038363 185
370 3300031824 Ga0307413_10838342 Ga0307413_108383422 186
371 3300032004 Ga0307414_10209313 Ga0307414_102093132 186
372 3300032004 Ga0307414_10277992 Ga0307414_102779922 186
373 3300032004 Ga0307414_10353803 Ga0307414_103538032 186
374 3300037471 Ga0395905_0018837 Ga0395905_0018837_4583_5179 186
375 3300046694 Ga0495649_0000418 Ga0495649_0000418_29211_29798 189
376 3300026067 Ga0207678_10331938 Ga0207678_103319383 190
377 3300048918 Ga0496115_0001297 Ga0496115_0001297_3952_4530 190
378 3300046542 Ga0495597_0171133 Ga0495597_0171133_263_865 197
379 3300002459 JGI24751J29686_10059645 JGI24751J29686_100596451 202
380 3300005353 Ga0070669_100535114 Ga0070669_1005351142 202
381 3300005548 Ga0070665_100135307 Ga0070665_1001353071 202
382 3300005841 Ga0068863_100285392 Ga0068863_1002853922 202
383 3300005843 Ga0068860_100170295 Ga0068860_1001702952 202
384 3300005844 Ga0068862_100051820 Ga0068862_1000518203 202
385 3300009553 Ga0105249_10832245 Ga0105249_108322452 202
386 3300025923 Ga0207681_10689061 Ga0207681_106890612 202
387 3300025961 Ga0207712_10408017 Ga0207712_104080172 202
388 3300025972 Ga0207668_10003586 Ga0207668_100035868 202
389 3300028379 Ga0268266_10073770 Ga0268266_100737703 202
390 3300028381 Ga0268264_10038750 Ga0268264_100387502 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

41

197

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.9588 20 180
2iyz-assembly1.cif.gz_A shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp 0.958 20 181
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.9547 12 184
2dft-assembly1.cif.gz_B structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and mg at 2.8 angstrons of resolution 0.9523 20 180
2pt5-assembly4.cif.gz_D crystal structure of shikimate kinase (aq_2177) from aquifex aeolicus vf5 0.9353 19 188
ID Description Score Start End Superfamily
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9547 12 184 3.40.50.300
af_I1JY85_1_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9334 25 186 3.40.50.300
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9282 17 182 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9187 12 184 3.40.50.300
3n2eC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9088 18 185 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2H0QUI7-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9875 18 186 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A523FV99-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9856 12 186 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A1M3LIM7-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9852 18 183 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A2E2XQK1-F1-model_v4 deleted 0.9828 17 188
AF-A0A2E4RHX2-F1-model_v4 deleted 0.9813 19 182

Feature Viewer

pLDDT pTM Quality
87.69 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map