F431416

General Info

Members Datasets Scaffolds Average Seq Length
389 241 778 263

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10022349|Ga0105249_100223494
Length 289
Sequence VDRDQRLDRRRLLAPRGPAILGGWRVTGTGPAPTTAGGRDLLRPLKLFGLFFRIGALNELQYRANLAVQLFQSALALGTGLAVLGLVFGQTTNLGGWTQSELLAVMGVHILMGGVIRTAIQPNMERLMTDVRQGTLDFVLTKPEDAQVMISVREFRIWQAVDVVVGAIVLAPGLVFAGCLLLGAVMIYCFWLILTTAAFWIVRMDELHELFDGIYQSGRWPVTIYPGWLRISLTYLVPIAFAVTLPAEALTSRLTIETLALAAAFAVLLLVVTRWFWRLGLRNYSGASA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.11
Rhizosphere 85.86
Stem 0
Stem Tuber 0
Unclassified 10.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10022349 3300009553 Bacteria 5665
2 JGI24752J21851_1007564 3300001976 Bacteria 1418
3 JGI24742J22300_10013614 3300002244 Unclassified 1362
4 rootH1_10065869 3300003316 Unclassified 1541
5 Ga0070658_10097517 3300005327 Bacteria 2427
6 Ga0070690_100260175 3300005330 Bacteria 1231
7 Ga0070670_100038244 3300005331 Bacteria 4126
8 Ga0068869_100011835 3300005334 Bacteria 5739
9 Ga0068869_100036392 3300005334 Bacteria 3495
10 Ga0070666_10085061 3300005335 Bacteria 2166
11 Ga0070666_10089041 3300005335 Unclassified 2118
12 Ga0070680_100030175 3300005336 Bacteria 4355
13 Ga0068868_100048208 3300005338 Bacteria 3341
14 Ga0068868_100172192 3300005338 Bacteria 1792
15 Ga0068868_100578297 3300005338 Unclassified 993
16 Ga0070660_100177406 3300005339 Bacteria 1723
17 Ga0070660_100571797 3300005339 Bacteria 944
18 Ga0070691_10039380 3300005341 Bacteria 2233
19 Ga0070692_10001396 3300005345 Bacteria 8741
20 Ga0070668_100211745 3300005347 Unclassified 1595
21 Ga0070668_100242116 3300005347 Bacteria 1494
22 Ga0070668_100336761 3300005347 Unclassified 1274
23 Ga0070675_100004578 3300005354 Bacteria 10557
24 Ga0070675_100268555 3300005354 Bacteria 1496
25 Ga0070675_100284956 3300005354 Bacteria 1453
26 Ga0070675_100453657 3300005354 Bacteria 1150
27 Ga0070671_100002162 3300005355 Bacteria 15166
28 Ga0070671_100314857 3300005355 Bacteria 1333
29 Ga0070673_100008681 3300005364 Bacteria 6774
30 Ga0070688_100033955 3300005365 Bacteria 3086
31 Ga0070667_100034801 3300005367 Bacteria 4217
32 Ga0070667_100063414 3300005367 Bacteria 3131
33 Ga0070703_10034261 3300005406 Bacteria 1549
34 Ga0070709_10012847 3300005434 Bacteria 4695
35 Ga0070713_100015889 3300005436 Bacteria 5644
36 Ga0070713_100125878 3300005436 Bacteria 2253
37 Ga0070713_100401433 3300005436 Unclassified 1280
38 Ga0070701_10087394 3300005438 Bacteria 1701
39 Ga0070711_100074414 3300005439 Bacteria 2402
40 Ga0070711_100246510 3300005439 Bacteria 1399
41 Ga0070705_100204058 3300005440 Bacteria 1358
42 Ga0070705_100322530 3300005440 Bacteria 1116
43 Ga0070700_100024411 3300005441 Bacteria 3550
44 Ga0070694_100028878 3300005444 Bacteria 3614
45 Ga0070694_100070580 3300005444 Bacteria 2405
46 Ga0070694_100201295 3300005444 Unclassified 1485
47 Ga0070708_100022168 3300005445 Bacteria 5383
48 Ga0070708_100152188 3300005445 Unclassified 2152
49 Ga0070708_100226087 3300005445 Bacteria 1756
50 Ga0070663_100003644 3300005455 Bacteria 8919
51 Ga0070678_100005454 3300005456 Bacteria 7356
52 Ga0070662_100231431 3300005457 Bacteria 1478
53 Ga0070681_10003444 3300005458 Bacteria 14814
54 Ga0070681_10070929 3300005458 Bacteria 3448
55 Ga0068867_100328193 3300005459 Bacteria 1270
56 Ga0070685_10144188 3300005466 Bacteria 1503
57 Ga0070707_100003031 3300005468 Bacteria 15927
58 Ga0070698_100126991 3300005471 Bacteria 2507
59 Ga0070699_100005964 3300005518 Bacteria 10638
60 Ga0070699_100141952 3300005518 Bacteria 2121
61 Ga0070679_100649483 3300005530 Unclassified 998
62 Ga0070684_100031063 3300005535 Bacteria 4545
63 Ga0068853_100133563 3300005539 Bacteria 2223
64 Ga0070672_100312261 3300005543 Bacteria 1335
65 Ga0070686_100270200 3300005544 Bacteria 1250
66 Ga0070686_100397029 3300005544 Unclassified 1048
67 Ga0070695_100004883 3300005545 Bacteria 7896
68 Ga0070695_100228420 3300005545 Bacteria 1344
69 Ga0070696_100011919 3300005546 Bacteria 5828
70 Ga0070696_100164082 3300005546 Bacteria 1638
71 Ga0070696_100221467 3300005546 Bacteria 1420
72 Ga0070693_100006628 3300005547 Bacteria 5621
73 Ga0070665_100118940 3300005548 Bacteria 2644
74 Ga0070704_100018138 3300005549 Bacteria 4491
75 Ga0070704_100062865 3300005549 Bacteria 2662
76 Ga0068855_100054685 3300005563 Bacteria 4691
77 Ga0070664_100363686 3300005564 Bacteria 1318
78 Ga0070664_100406366 3300005564 Bacteria 1246
79 Ga0068854_100159727 3300005578 Unclassified 1744
80 Ga0068856_100017622 3300005614 Bacteria 6921
81 Ga0068856_100473526 3300005614 Bacteria 1273
82 Ga0070702_100000524 3300005615 Bacteria 13799
83 Ga0070702_100012396 3300005615 Bacteria 4270
84 Ga0070702_100557805 3300005615 Bacteria 851
85 Ga0068859_100013623 3300005617 Bacteria 8152
86 Ga0068864_100655110 3300005618 Bacteria 1023
87 Ga0068851_10009129 3300005834 Bacteria 4606
88 Ga0068870_10002275 3300005840 Bacteria 7977
89 Ga0068863_100002666 3300005841 Bacteria 17649
90 Ga0068863_100236521 3300005841 Bacteria 1763
91 Ga0068858_100020561 3300005842 Bacteria 6167
92 Ga0068858_100570804 3300005842 Bacteria 1096
93 Ga0068860_100025808 3300005843 Bacteria 5667
94 Ga0068862_100353851 3300005844 Unclassified 1363
95 Ga0081455_10024328 3300005937 Bacteria 5609
96 Ga0081455_10141831 3300005937 Bacteria 1865
97 Ga0081540_1026105 3300005983 Bacteria 3342
98 Ga0081539_10008361 3300005985 Bacteria 9042
99 Ga0081539_10024762 3300005985 Bacteria 3884
100 Ga0081539_10035619 3300005985 Bacteria 2988
101 Ga0081539_10072970 3300005985 Bacteria 1832
102 Ga0081539_10092731 3300005985 Unclassified 1557
103 Ga0070717_10167455 3300006028 Bacteria 1909
104 Ga0097621_100018553 3300006237 Bacteria 5318
105 Ga0097621_100196600 3300006237 Bacteria 1749
106 Ga0068871_100054570 3300006358 Bacteria 3242
107 Ga0075428_100150004 3300006844 Bacteria 2533
108 Ga0075428_100198464 3300006844 Bacteria 2170
109 Ga0075428_100227978 3300006844 Bacteria 2011
110 Ga0075430_100335250 3300006846 Unclassified 1250
111 Ga0075433_10009489 3300006852 Bacteria 7776
112 Ga0075433_10040429 3300006852 Bacteria 4036
113 Ga0075433_10220833 3300006852 Bacteria 1683
114 Ga0075433_10385246 3300006852 Bacteria 1238
115 Ga0075434_100021676 3300006871 Bacteria 6248
116 Ga0075429_100188381 3300006880 Bacteria 1808
117 Ga0075436_100005036 3300006914 Bacteria 9085
118 Ga0075436_100046888 3300006914 Bacteria 2981
119 Ga0097620_100013620 3300006931 Bacteria 8152
120 Ga0075435_100059098 3300007076 Bacteria 3107
121 Ga0075435_100314813 3300007076 Bacteria 1339
122 Ga0075435_100337441 3300007076 Unclassified 1291
123 Ga0075435_100485446 3300007076 Bacteria 1067
124 Ga0105251_10022770 3300009011 Bacteria 3245
125 Ga0111539_10006816 3300009094 Bacteria 14690
126 Ga0111539_10016408 3300009094 Bacteria 9184
127 Ga0111539_10368303 3300009094 Unclassified 1672
128 Ga0105245_10196666 3300009098 Bacteria 1934
129 Ga0105247_10028661 3300009101 Bacteria 3369
130 Ga0114129_10081955 3300009147 Bacteria 4484
131 Ga0114129_10094125 3300009147 Bacteria 4149
132 Ga0114129_10129995 3300009147 Bacteria 3460
133 Ga0114129_10158734 3300009147 Bacteria 3092
134 Ga0114129_10188683 3300009147 Bacteria 2800
135 Ga0105243_10183506 3300009148 Bacteria 1822
136 Ga0105243_10401566 3300009148 Bacteria 1273
137 Ga0105241_10002351 3300009174 Bacteria 14207
138 Ga0105242_10480283 3300009176 Unclassified 1178
139 Ga0105248_10022062 3300009177 Bacteria 7054
140 Ga0105248_10053773 3300009177 Bacteria 4517
141 Ga0105248_10822971 3300009177 Bacteria 1048
142 Ga0105238_10239375 3300009551 Bacteria 1792
143 Ga0099796_10042684 3300010159 Bacteria 1542
144 Ga0105239_10034328 3300010375 Bacteria 5570
145 Ga0105246_10000555 3300011119 Bacteria 20583
146 Ga0105246_10196913 3300011119 Bacteria 1564
147 Ga0157373_10058504 3300013100 Bacteria 2733
148 Ga0157370_10106855 3300013104 Bacteria 2619
149 Ga0157369_10103706 3300013105 Bacteria 3030
150 Ga0157374_10037715 3300013296 Bacteria 4439
151 Ga0157372_10011286 3300013307 Bacteria 9504
152 Ga0157372_10532220 3300013307 Bacteria 1370
153 Ga0157375_10165377 3300013308 Bacteria 2357
154 Ga0157375_10983275 3300013308 Unclassified 984
155 Ga0163163_10215710 3300014325 Bacteria 1968
156 Ga0163163_10241151 3300014325 Unclassified 1857
157 Ga0163163_10488984 3300014325 Bacteria 1292
158 Ga0182008_10063482 3300014497 Bacteria 1819
159 Ga0157377_10031845 3300014745 Bacteria 2868
160 Ga0157377_10033973 3300014745 Bacteria 2788
161 Ga0157379_10026618 3300014968 Bacteria 5148
162 Ga0157376_10218285 3300014969 Bacteria 1764
163 Ga0206356_11443973 3300020070 Bacteria 1404
164 Ga0207656_10008611 3300025321 Bacteria 3760
165 Ga0207688_10095269 3300025901 Bacteria 1713
166 Ga0207680_10059452 3300025903 Bacteria 2322
167 Ga0207699_10339173 3300025906 Unclassified 1058
168 Ga0207645_10019408 3300025907 Bacteria 4457
169 Ga0207645_10117911 3300025907 Bacteria 1722
170 Ga0207643_10000317 3300025908 Bacteria 33376
171 Ga0207643_10064480 3300025908 Bacteria 2096
172 Ga0207705_10064385 3300025909 Bacteria 2649
173 Ga0207684_10174836 3300025910 Bacteria 1851
174 Ga0207654_10007437 3300025911 Bacteria 5517
175 Ga0207707_10009812 3300025912 Bacteria 8303
176 Ga0207707_10025672 3300025912 Bacteria 5153
177 Ga0207663_10170669 3300025916 Unclassified 1545
178 Ga0207660_10331335 3300025917 Bacteria 1217
179 Ga0207662_10150087 3300025918 Bacteria 1482
180 Ga0207657_10022426 3300025919 Bacteria 5908
181 Ga0207649_10002488 3300025920 Bacteria 10296
182 Ga0207652_10032252 3300025921 Bacteria 4401
183 Ga0207646_10022501 3300025922 Bacteria 5807
184 Ga0207681_10501325 3300025923 Bacteria 994
185 Ga0207694_10075556 3300025924 Bacteria 2637
186 Ga0207650_10002428 3300025925 Bacteria 12975
187 Ga0207659_10088291 3300025926 Bacteria 2309
188 Ga0207687_10007027 3300025927 Bacteria 7421
189 Ga0207687_10124882 3300025927 Bacteria 1930
190 Ga0207687_10241054 3300025927 Bacteria 1433
191 Ga0207687_10346505 3300025927 Bacteria 1209
192 Ga0207700_10368954 3300025928 Unclassified 1253
193 Ga0207644_10018567 3300025931 Bacteria 4707
194 Ga0207706_10243902 3300025933 Bacteria 1570
195 Ga0207686_10031151 3300025934 Bacteria 3165
196 Ga0207669_10017371 3300025937 Bacteria 3688
197 Ga0207691_10128497 3300025940 Bacteria 2240
198 Ga0207711_10211919 3300025941 Bacteria 1770
199 Ga0207711_10418496 3300025941 Bacteria 1246
200 Ga0207711_10423778 3300025941 Unclassified 1238
201 Ga0207689_10002410 3300025942 Bacteria 17400
202 Ga0207689_10171805 3300025942 Bacteria 1787
203 Ga0207679_10001020 3300025945 Bacteria 17898
204 Ga0207679_10105631 3300025945 Bacteria 2212
205 Ga0207679_10503811 3300025945 Bacteria 1081
206 Ga0207667_10085610 3300025949 Bacteria 3263
207 Ga0207651_10041187 3300025960 Bacteria 3064
208 Ga0207651_10519335 3300025960 Bacteria 1032
209 Ga0207712_10107237 3300025961 Unclassified 2088
210 Ga0207677_10019030 3300026023 Bacteria 4136
211 Ga0207703_10065239 3300026035 Bacteria 2991
212 Ga0207703_10421096 3300026035 Bacteria 1243
213 Ga0207639_10478470 3300026041 Bacteria 1135
214 Ga0207678_10000535 3300026067 Bacteria 34675
215 Ga0207678_10086712 3300026067 Bacteria 2675
216 Ga0207708_10060685 3300026075 Bacteria 2886
217 Ga0207708_10062289 3300026075 Bacteria 2849
218 Ga0207702_10001977 3300026078 Bacteria 19927
219 Ga0207641_10007792 3300026088 Bacteria 8899
220 Ga0207641_10106483 3300026088 Bacteria 2479
221 Ga0207648_10042792 3300026089 Bacteria 3977
222 Ga0207676_10004152 3300026095 Bacteria 10228
223 Ga0207675_100146705 3300026118 Bacteria 2244
224 Ga0207675_100334917 3300026118 Unclassified 1480
225 Ga0207683_10001170 3300026121 Bacteria 23723
226 Ga0207683_10057603 3300026121 Bacteria 3411
227 Ga0207683_10340767 3300026121 Bacteria 1375
228 Ga0207698_10001804 3300026142 Bacteria 12505
229 Ga0209974_10034883 3300027876 Bacteria 1670
230 Ga0207428_10018332 3300027907 Bacteria 5981
231 Ga0268266_10390821 3300028379 Bacteria 1314
232 Ga0268264_10039745 3300028381 Bacteria 3886
233 Ga0265334_10090111 3300028573 Bacteria 1120
234 Ga0265316_10004976 3300031344 Bacteria 13047
235 Ga0265316_10017028 3300031344 Bacteria 6291
236 Ga0265316_10157256 3300031344 Unclassified 1700
237 Ga0265316_10166468 3300031344 Unclassified 1646
238 Ga0307408_100230003 3300031548 Bacteria 1518
239 Ga0316579_10009365 3300031691 Bacteria 4116
240 Ga0265342_10038596 3300031712 Bacteria 2907
241 Ga0265342_10039813 3300031712 Unclassified 2853
242 Ga0316577_10011679 3300031733 Bacteria 4765
243 Ga0307409_100072346 3300031995 Bacteria 2745
244 Ga0307409_100081335 3300031995 Bacteria 2618
245 Ga0307416_100242868 3300032002 Bacteria 1746
246 Ga0307416_100260927 3300032002 Bacteria 1693
247 Ga0307414_10447373 3300032004 Bacteria 1132
248 Ga0307411_10271362 3300032005 Bacteria 1345
249 Ga0307415_100034883 3300032126 Bacteria 3280
250 Ga0307415_100280200 3300032126 Bacteria 1370
251 Ga0373943_0068847 3300035170 Unclassified 1788
252 Ga0373943_0108430 3300035170 Bacteria 1461
253 Ga0373947_0055491 3300035725 Bacteria 2393
254 Ga0395899_0009682 3300037312 Bacteria 7396
255 Ga0395900_0085164 3300037418 Bacteria 3248
256 Ga0395900_0088564 3300037418 Unclassified 3182
257 Ga0395898_0040998 3300037466 Bacteria 4575
258 Ga0395905_0035495 3300037471 Bacteria 4682
259 Ga0395905_0090010 3300037471 Bacteria 2876
260 Ga0395905_0250380 3300037471 Bacteria 1655
261 Ga0395901_0074651 3300038443 Bacteria 3537
262 Ga0395901_0270436 3300038443 Bacteria 1768
263 Ga0400489_01560 3300039093 Unclassified 1914
264 Ga0400489_20493 3300039093 Bacteria 54769
265 Ga0439466_0056677 3300041411 Bacteria 1271
266 Ga0451853_3317621 3300041512 Bacteria 1610
267 Ga0439448_0028061 3300042005 Bacteria 1776
268 Ga0439463_043806 3300042016 Bacteria 1139
269 Ga0439446_0062633 3300042156 Bacteria 1126
270 Ga0439458_0024322 3300042157 Bacteria 1416
271 Ga0439464_0007780 3300042439 Bacteria 2804
272 Ga0451577_0171216 3300042876 Bacteria 1957
273 Ga0466963_0410582 3300044694 Unclassified 955
274 Ga0453684_0743693 3300044712 Bacteria 1062
275 Ga0466970_0076476 3300044765 Bacteria 1804
276 Ga0466960_0021781 3300044901 Bacteria 2858
277 Ga0466967_0149787 3300045976 Bacteria 2180
278 Ga0495641_0081473 3300046461 Unclassified 1450
279 Ga0495656_0091988 3300046615 Bacteria 1388
280 Ga0495589_0049307 3300046794 Bacteria 2084
281 Ga0495676_0126936 3300047321 Unclassified 1848
282 Ga0496101_0020351 3300048904 Bacteria 4540
283 Ga0496101_0071845 3300048904 Bacteria 2538
284 Ga0496101_0193512 3300048904 Bacteria 1570
285 Ga0496102_0015143 3300048905 Bacteria 6715
286 Ga0496102_0031646 3300048905 Bacteria 4746
287 Ga0496102_0111263 3300048905 Bacteria 2553
288 Ga0496102_0231058 3300048905 Bacteria 1744
289 Ga0496102_0248859 3300048905 Bacteria 1676
290 Ga0496103_0011062 3300048906 Bacteria 5343
291 Ga0496103_0108847 3300048906 Bacteria 1759
292 Ga0496104_0000751 3300048907 Bacteria 27730
293 Ga0496104_0007978 3300048907 Bacteria 9390
294 Ga0496104_0024465 3300048907 Bacteria 5554
295 Ga0496104_0628920 3300048907 Unclassified 983
296 Ga0496105_0004950 3300048908 Bacteria 10074
297 Ga0496105_0008723 3300048908 Bacteria 7889
298 Ga0496105_0057796 3300048908 Bacteria 3202
299 Ga0496106_0009312 3300048909 Bacteria 7259
300 Ga0496106_0190821 3300048909 Bacteria 1629
301 Ga0496106_0237833 3300048909 Bacteria 1455
302 Ga0496106_0390103 3300048909 Bacteria 1119
303 Ga0496107_0591647 3300048910 Unclassified 820
304 Ga0496108_0004399 3300048911 Bacteria 11342
305 Ga0496108_0031683 3300048911 Bacteria 4388
306 Ga0496108_0141660 3300048911 Bacteria 2071
307 Ga0496109_0006717 3300048912 Bacteria 9685
308 Ga0496109_0018745 3300048912 Bacteria 6085
309 Ga0496109_0049600 3300048912 Bacteria 3822
310 Ga0496109_0226747 3300048912 Bacteria 1757
311 Ga0496110_0008614 3300048913 Bacteria 8215
312 Ga0496110_0008769 3300048913 Bacteria 8147
313 Ga0496110_0049852 3300048913 Bacteria 3675
314 Ga0496110_0065164 3300048913 Bacteria 3221
315 Ga0496110_0102008 3300048913 Bacteria 2573
316 Ga0496110_0185778 3300048913 Unclassified 1887
317 Ga0496111_0004802 3300048914 Bacteria 8572
318 Ga0496111_0016115 3300048914 Bacteria 5148
319 Ga0496111_0031093 3300048914 Bacteria 3801
320 Ga0496111_0095646 3300048914 Unclassified 2179
321 Ga0496112_0006173 3300048915 Bacteria 10479
322 Ga0496112_0017946 3300048915 Bacteria 6659
323 Ga0496112_0032260 3300048915 Bacteria 5085
324 Ga0496112_0218235 3300048915 Bacteria 1863
325 Ga0496112_0305071 3300048915 Bacteria 1537
326 Ga0496113_0003875 3300048916 Bacteria 9059
327 Ga0496113_0004287 3300048916 Bacteria 8738
328 Ga0496113_0023592 3300048916 Bacteria 4363
329 Ga0496114_0031549 3300048917 Bacteria 4360
330 Ga0496114_0046246 3300048917 Bacteria 3617
331 Ga0496114_0329794 3300048917 Unclassified 1349
332 Ga0496115_0026315 3300048918 Bacteria 4540
333 Ga0501031_0000606 3300049568 Bacteria 21133
334 Ga0501032_0012577 3300049569 Bacteria 6043
335 Ga0501033_0054381 3300049570 Bacteria 2962
336 Ga0501036_0001341 3300049572 Bacteria 18917
337 Ga0501036_0008752 3300049572 Bacteria 8307
338 Ga0501037_0135075 3300049573 Bacteria 1767
339 Ga0501038_0030108 3300049574 Bacteria 4806
340 Ga0501039_0001267 3300049575 Bacteria 18469
341 Ga0501040_0008469 3300049576 Bacteria 6681
342 Ga0501041_0001640 3300049577 Bacteria 12508
343 Ga0501042_0004166 3300049578 Bacteria 9194
344 Ga0501046_0008606 3300049580 Bacteria 8878
345 Ga0501048_0007139 3300049582 Bacteria 8489
346 Ga0501048_0063811 3300049582 Bacteria 2605
347 Ga0501068_0143153 3300049584 Bacteria 1499
348 Ga0501068_0255828 3300049584 Bacteria 1117
349 Ga0501070_0170579 3300049586 Bacteria 1792
350 Ga0501071_0001256 3300049587 Bacteria 14371
351 Ga0501074_0018844 3300049590 Bacteria 5013
352 Ga0501075_0013942 3300049591 Bacteria 5750
353 Ga0501075_0309024 3300049591 Bacteria 1205
354 Ga0501076_0000362 3300049592 Bacteria 28185
355 Ga0501076_0256000 3300049592 Bacteria 1433
356 Ga0501077_0016252 3300049593 Bacteria 4687
357 Ga0501216_022943 3300049660 Bacteria 1107
358 Ga0501079_0011166 3300049741 Bacteria 6850
359 Ga0501080_0018503 3300049742 Bacteria 6444
360 Ga0501081_0002063 3300049743 Bacteria 12536
361 Ga0501083_0240559 3300049744 Bacteria 1178
362 Ga0501044_0002666 3300049823 Bacteria 20304
363 Ga0501045_0012992 3300049824 Bacteria 5870
364 nmdc:mga05p37_215047_c1 3300050507 Bacteria 2322
365 nmdc:mga05p37_286729_c1 3300050507 Bacteria 1961
366 nmdc:mga05p37_438276_c1 3300050507 Unclassified 1516
367 nmdc:mga05p37_637_c1 3300050507 Bacteria 38821
368 nmdc:mga05p37_75417_c1 3300050507 Bacteria 4151
369 nmdc:mga09592_253901_c1 3300050508 Bacteria 1524
370 nmdc:mga09592_41697_c1 3300050508 Unclassified 3859
371 nmdc:mga08y16_12473_c1 3300050511 Bacteria 8942
372 nmdc:mga0n895_231875_c1 3300050512 Bacteria 1874
373 nmdc:mga0n895_4386_c1 3300050512 Bacteria 11579
374 nmdc:mga0rr50_58372_c1 3300050513 Bacteria 2892
375 nmdc:mga08x19_8254_c1 3300050514 Bacteria 6192
376 nmdc:mga08x19_8500_c1 3300050514 Bacteria 6117
377 Ga0495612_0000036 3300053078 Bacteria 67883
378 Ga0501084_0047996 3300054114 Bacteria 3575
379 Ga0501084_0482199 3300054114 Bacteria 1048
380 Ga0590071_000977 3300059421 Bacteria 7854
381 Ga0590071_029614 3300059421 Bacteria 1302
382 Ga0590074_002259 3300059423 Bacteria 3161
383 Ga0590075_002177 3300059424 Bacteria 4710
384 Ga0590077_001014 3300059426 Bacteria 7064
385 Ga0501082_0022520 3300060353 Bacteria 5426
386 Ga0501082_0100727 3300060353 Bacteria 2499
387 Ga0530510_0012733 3300061734 Bacteria 5912
388 Ga0530510_0094949 3300061734 Bacteria 2178
389 Ga0530510_0191605 3300061734 Bacteria 1518
390 Ga0105249_10022349
391 JGI24752J21851_1007564
392 JGI24742J22300_10013614
393 rootH1_10065869
394 Ga0070658_10097517
395 Ga0070690_100260175
396 Ga0070670_100038244
397 Ga0068869_100011835
398 Ga0068869_100036392
399 Ga0070666_10085061
400 Ga0070666_10089041
401 Ga0070680_100030175
402 Ga0068868_100048208
403 Ga0068868_100172192
404 Ga0068868_100578297
405 Ga0070660_100177406
406 Ga0070660_100571797
407 Ga0070691_10039380
408 Ga0070692_10001396
409 Ga0070668_100211745
410 Ga0070668_100242116
411 Ga0070668_100336761
412 Ga0070675_100004578
413 Ga0070675_100268555
414 Ga0070675_100284956
415 Ga0070675_100453657
416 Ga0070671_100002162
417 Ga0070671_100314857
418 Ga0070673_100008681
419 Ga0070688_100033955
420 Ga0070667_100034801
421 Ga0070667_100063414
422 Ga0070703_10034261
423 Ga0070709_10012847
424 Ga0070713_100015889
425 Ga0070713_100125878
426 Ga0070713_100401433
427 Ga0070701_10087394
428 Ga0070711_100074414
429 Ga0070711_100246510
430 Ga0070705_100204058
431 Ga0070705_100322530
432 Ga0070700_100024411
433 Ga0070694_100028878
434 Ga0070694_100070580
435 Ga0070694_100201295
436 Ga0070708_100022168
437 Ga0070708_100152188
438 Ga0070708_100226087
439 Ga0070663_100003644
440 Ga0070678_100005454
441 Ga0070662_100231431
442 Ga0070681_10003444
443 Ga0070681_10070929
444 Ga0068867_100328193
445 Ga0070685_10144188
446 Ga0070707_100003031
447 Ga0070698_100126991
448 Ga0070699_100005964
449 Ga0070699_100141952
450 Ga0070679_100649483
451 Ga0070684_100031063
452 Ga0068853_100133563
453 Ga0070672_100312261
454 Ga0070686_100270200
455 Ga0070686_100397029
456 Ga0070695_100004883
457 Ga0070695_100228420
458 Ga0070696_100011919
459 Ga0070696_100164082
460 Ga0070696_100221467
461 Ga0070693_100006628
462 Ga0070665_100118940
463 Ga0070704_100018138
464 Ga0070704_100062865
465 Ga0068855_100054685
466 Ga0070664_100363686
467 Ga0070664_100406366
468 Ga0068854_100159727
469 Ga0068856_100017622
470 Ga0068856_100473526
471 Ga0070702_100000524
472 Ga0070702_100012396
473 Ga0070702_100557805
474 Ga0068859_100013623
475 Ga0068864_100655110
476 Ga0068851_10009129
477 Ga0068870_10002275
478 Ga0068863_100002666
479 Ga0068863_100236521
480 Ga0068858_100020561
481 Ga0068858_100570804
482 Ga0068860_100025808
483 Ga0068862_100353851
484 Ga0081455_10024328
485 Ga0081455_10141831
486 Ga0081540_1026105
487 Ga0081539_10008361
488 Ga0081539_10024762
489 Ga0081539_10035619
490 Ga0081539_10072970
491 Ga0081539_10092731
492 Ga0070717_10167455
493 Ga0097621_100018553
494 Ga0097621_100196600
495 Ga0068871_100054570
496 Ga0075428_100150004
497 Ga0075428_100198464
498 Ga0075428_100227978
499 Ga0075430_100335250
500 Ga0075433_10009489
501 Ga0075433_10040429
502 Ga0075433_10220833
503 Ga0075433_10385246
504 Ga0075434_100021676
505 Ga0075429_100188381
506 Ga0075436_100005036
507 Ga0075436_100046888
508 Ga0097620_100013620
509 Ga0075435_100059098
510 Ga0075435_100314813
511 Ga0075435_100337441
512 Ga0075435_100485446
513 Ga0105251_10022770
514 Ga0111539_10006816
515 Ga0111539_10016408
516 Ga0111539_10368303
517 Ga0105245_10196666
518 Ga0105247_10028661
519 Ga0114129_10081955
520 Ga0114129_10094125
521 Ga0114129_10129995
522 Ga0114129_10158734
523 Ga0114129_10188683
524 Ga0105243_10183506
525 Ga0105243_10401566
526 Ga0105241_10002351
527 Ga0105242_10480283
528 Ga0105248_10022062
529 Ga0105248_10053773
530 Ga0105248_10822971
531 Ga0105238_10239375
532 Ga0099796_10042684
533 Ga0105239_10034328
534 Ga0105246_10000555
535 Ga0105246_10196913
536 Ga0157373_10058504
537 Ga0157370_10106855
538 Ga0157369_10103706
539 Ga0157374_10037715
540 Ga0157372_10011286
541 Ga0157372_10532220
542 Ga0157375_10165377
543 Ga0157375_10983275
544 Ga0163163_10215710
545 Ga0163163_10241151
546 Ga0163163_10488984
547 Ga0182008_10063482
548 Ga0157377_10031845
549 Ga0157377_10033973
550 Ga0157379_10026618
551 Ga0157376_10218285
552 Ga0206356_11443973
553 Ga0207656_10008611
554 Ga0207688_10095269
555 Ga0207680_10059452
556 Ga0207699_10339173
557 Ga0207645_10019408
558 Ga0207645_10117911
559 Ga0207643_10000317
560 Ga0207643_10064480
561 Ga0207705_10064385
562 Ga0207684_10174836
563 Ga0207654_10007437
564 Ga0207707_10009812
565 Ga0207707_10025672
566 Ga0207663_10170669
567 Ga0207660_10331335
568 Ga0207662_10150087
569 Ga0207657_10022426
570 Ga0207649_10002488
571 Ga0207652_10032252
572 Ga0207646_10022501
573 Ga0207681_10501325
574 Ga0207694_10075556
575 Ga0207650_10002428
576 Ga0207659_10088291
577 Ga0207687_10007027
578 Ga0207687_10124882
579 Ga0207687_10241054
580 Ga0207687_10346505
581 Ga0207700_10368954
582 Ga0207644_10018567
583 Ga0207706_10243902
584 Ga0207686_10031151
585 Ga0207669_10017371
586 Ga0207691_10128497
587 Ga0207711_10211919
588 Ga0207711_10418496
589 Ga0207711_10423778
590 Ga0207689_10002410
591 Ga0207689_10171805
592 Ga0207679_10001020
593 Ga0207679_10105631
594 Ga0207679_10503811
595 Ga0207667_10085610
596 Ga0207651_10041187
597 Ga0207651_10519335
598 Ga0207712_10107237
599 Ga0207677_10019030
600 Ga0207703_10065239
601 Ga0207703_10421096
602 Ga0207639_10478470
603 Ga0207678_10000535
604 Ga0207678_10086712
605 Ga0207708_10060685
606 Ga0207708_10062289
607 Ga0207702_10001977
608 Ga0207641_10007792
609 Ga0207641_10106483
610 Ga0207648_10042792
611 Ga0207676_10004152
612 Ga0207675_100146705
613 Ga0207675_100334917
614 Ga0207683_10001170
615 Ga0207683_10057603
616 Ga0207683_10340767
617 Ga0207698_10001804
618 Ga0209974_10034883
619 Ga0207428_10018332
620 Ga0268266_10390821
621 Ga0268264_10039745
622 Ga0265334_10090111
623 Ga0265316_10004976
624 Ga0265316_10017028
625 Ga0265316_10157256
626 Ga0265316_10166468
627 Ga0307408_100230003
628 Ga0316579_10009365
629 Ga0265342_10038596
630 Ga0265342_10039813
631 Ga0316577_10011679
632 Ga0307409_100072346
633 Ga0307409_100081335
634 Ga0307416_100242868
635 Ga0307416_100260927
636 Ga0307414_10447373
637 Ga0307411_10271362
638 Ga0307415_100034883
639 Ga0307415_100280200
640 Ga0373943_0068847
641 Ga0373943_0108430
642 Ga0373947_0055491
643 Ga0395899_0009682
644 Ga0395900_0085164
645 Ga0395900_0088564
646 Ga0395898_0040998
647 Ga0395905_0035495
648 Ga0395905_0090010
649 Ga0395905_0250380
650 Ga0395901_0074651
651 Ga0395901_0270436
652 Ga0400489_01560
653 Ga0400489_20493
654 Ga0439466_0056677
655 Ga0451853_3317621
656 Ga0439448_0028061
657 Ga0439463_043806
658 Ga0439446_0062633
659 Ga0439458_0024322
660 Ga0439464_0007780
661 Ga0451577_0171216
662 Ga0466963_0410582
663 Ga0453684_0743693
664 Ga0466970_0076476
665 Ga0466960_0021781
666 Ga0466967_0149787
667 Ga0495641_0081473
668 Ga0495656_0091988
669 Ga0495589_0049307
670 Ga0495676_0126936
671 Ga0496101_0020351
672 Ga0496101_0071845
673 Ga0496101_0193512
674 Ga0496102_0015143
675 Ga0496102_0031646
676 Ga0496102_0111263
677 Ga0496102_0231058
678 Ga0496102_0248859
679 Ga0496103_0011062
680 Ga0496103_0108847
681 Ga0496104_0000751
682 Ga0496104_0007978
683 Ga0496104_0024465
684 Ga0496104_0628920
685 Ga0496105_0004950
686 Ga0496105_0008723
687 Ga0496105_0057796
688 Ga0496106_0009312
689 Ga0496106_0190821
690 Ga0496106_0237833
691 Ga0496106_0390103
692 Ga0496107_0591647
693 Ga0496108_0004399
694 Ga0496108_0031683
695 Ga0496108_0141660
696 Ga0496109_0006717
697 Ga0496109_0018745
698 Ga0496109_0049600
699 Ga0496109_0226747
700 Ga0496110_0008614
701 Ga0496110_0008769
702 Ga0496110_0049852
703 Ga0496110_0065164
704 Ga0496110_0102008
705 Ga0496110_0185778
706 Ga0496111_0004802
707 Ga0496111_0016115
708 Ga0496111_0031093
709 Ga0496111_0095646
710 Ga0496112_0006173
711 Ga0496112_0017946
712 Ga0496112_0032260
713 Ga0496112_0218235
714 Ga0496112_0305071
715 Ga0496113_0003875
716 Ga0496113_0004287
717 Ga0496113_0023592
718 Ga0496114_0031549
719 Ga0496114_0046246
720 Ga0496114_0329794
721 Ga0496115_0026315
722 Ga0501031_0000606
723 Ga0501032_0012577
724 Ga0501033_0054381
725 Ga0501036_0001341
726 Ga0501036_0008752
727 Ga0501037_0135075
728 Ga0501038_0030108
729 Ga0501039_0001267
730 Ga0501040_0008469
731 Ga0501041_0001640
732 Ga0501042_0004166
733 Ga0501046_0008606
734 Ga0501048_0007139
735 Ga0501048_0063811
736 Ga0501068_0143153
737 Ga0501068_0255828
738 Ga0501070_0170579
739 Ga0501071_0001256
740 Ga0501074_0018844
741 Ga0501075_0013942
742 Ga0501075_0309024
743 Ga0501076_0000362
744 Ga0501076_0256000
745 Ga0501077_0016252
746 Ga0501216_022943
747 Ga0501079_0011166
748 Ga0501080_0018503
749 Ga0501081_0002063
750 Ga0501083_0240559
751 Ga0501044_0002666
752 Ga0501045_0012992
753 nmdc:mga05p37_215047_c1
754 nmdc:mga05p37_286729_c1
755 nmdc:mga05p37_438276_c1
756 nmdc:mga05p37_637_c1
757 nmdc:mga05p37_75417_c1
758 nmdc:mga09592_253901_c1
759 nmdc:mga09592_41697_c1
760 nmdc:mga08y16_12473_c1
761 nmdc:mga0n895_231875_c1
762 nmdc:mga0n895_4386_c1
763 nmdc:mga0rr50_58372_c1
764 nmdc:mga08x19_8254_c1
765 nmdc:mga08x19_8500_c1
766 Ga0495612_0000036
767 Ga0501084_0047996
768 Ga0501084_0482199
769 Ga0590071_000977
770 Ga0590071_029614
771 Ga0590074_002259
772 Ga0590075_002177
773 Ga0590077_001014
774 Ga0501082_0022520
775 Ga0501082_0100727
776 Ga0530510_0012733
777 Ga0530510_0094949
778 Ga0530510_0191605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

74

288

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6627 4 254
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6397 4 254
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6284 4 257
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6244 4 257
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.586 8 254
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5411 58 253 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4306 58 253 3.40.1710.10
af_A0A2R8QG20_101_236_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3564 143 260 1.20.1250.20
af_I1JJR6_181_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3476 51 253 1.20.120.1770
af_A0A0N7KR22_176_382_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3288 56 260 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A651I4U6-F1-model_v4 ABC transporter permease 0.9444 7 261 GO:0016020
AF-A0A3D1TSM2-F1-model_v4 ABC transporter permease 0.9363 1 261 GO:0016020
AF-A0A7V7SUV2-F1-model_v4 ABC transporter permease 0.9359 4 261 GO:0016020
AF-A0A363T638-F1-model_v4 ABC transporter permease 0.9349 3 261 GO:0016020
AF-A0A7Y9IBR0-F1-model_v4 ABC-2 type transport system permease protein 0.9339 30 261 GO:0016020

Map