F431074

General Info

Members Datasets Scaffolds Average Seq Length
388 249 776 62

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_102330648|Ga0075428_1023306482
Length 71
Sequence VADRKPFLLRIDSAVLDAVQRWANDDLRSLNAQIEFVLRDALKRVGRSLPASKDETAKAAKNREGREQDSE

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
248 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
249 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0
Rhizoplane 1.55
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_102330648 3300006844 Bacteria 551
2 JGI25406J46586_10098877 3300003203 Bacteria 872
3 Ga0065714_10233384 3300005288 Bacteria 811
4 Ga0065712_10836422 3300005290 Bacteria 501
5 Ga0065707_10179754 3300005295 Bacteria 1426
6 Ga0070676_10075019 3300005328 Bacteria 2038
7 Ga0070676_10237820 3300005328 Bacteria 1210
8 Ga0070690_100031492 3300005330 Bacteria 3305
9 Ga0070690_100579268 3300005330 Bacteria 849
10 Ga0070670_100152103 3300005331 Bacteria 2003
11 Ga0070677_10021549 3300005333 Bacteria 2366
12 Ga0070677_10890347 3300005333 Bacteria 514
13 Ga0068869_100241168 3300005334 Bacteria 1440
14 Ga0068869_101250035 3300005334 Bacteria 654
15 Ga0070666_10205406 3300005335 Bacteria 1386
16 Ga0070666_10309433 3300005335 Bacteria 1126
17 Ga0070666_11290203 3300005335 Bacteria 545
18 Ga0070682_100408279 3300005337 Bacteria 1029
19 Ga0068868_100055776 3300005338 Bacteria 3119
20 Ga0070660_100896052 3300005339 Bacteria 748
21 Ga0070689_100107443 3300005340 Bacteria 2215
22 Ga0070689_100186069 3300005340 Bacteria 1689
23 Ga0070661_100017763 3300005344 Bacteria 5049
24 Ga0070661_100165379 3300005344 Bacteria 1677
25 Ga0070661_100247294 3300005344 Bacteria 1375
26 Ga0070692_10470059 3300005345 Bacteria 809
27 Ga0070668_100001751 3300005347 Bacteria 15797
28 Ga0070669_100079423 3300005353 Bacteria 2440
29 Ga0070675_100019716 3300005354 Bacteria 5377
30 Ga0070675_100731473 3300005354 Bacteria 902
31 Ga0070671_100023601 3300005355 Bacteria 5035
32 Ga0070671_101215213 3300005355 Bacteria 663
33 Ga0070673_100001787 3300005364 Bacteria 12816
34 Ga0070673_100285492 3300005364 Bacteria 1449
35 Ga0070673_100546225 3300005364 Bacteria 1052
36 Ga0070673_102210057 3300005364 Bacteria 523
37 Ga0070688_100005880 3300005365 Bacteria 6493
38 Ga0070688_100369151 3300005365 Bacteria 1055
39 Ga0070659_101088055 3300005366 Bacteria 704
40 Ga0070667_100144644 3300005367 Bacteria 2084
41 Ga0070667_100239503 3300005367 Bacteria 1620
42 Ga0070667_100544822 3300005367 Bacteria 1066
43 Ga0070705_100154141 3300005440 Bacteria 1528
44 Ga0070705_101509899 3300005440 Bacteria 563
45 Ga0070700_101875347 3300005441 Bacteria 518
46 Ga0070700_101881483 3300005441 Bacteria 517
47 Ga0070694_100055981 3300005444 Bacteria 2677
48 Ga0070708_100873336 3300005445 Bacteria 845
49 Ga0070708_101000915 3300005445 Bacteria 784
50 Ga0070663_100020068 3300005455 Bacteria 4419
51 Ga0070663_100537124 3300005455 Bacteria 975
52 Ga0070678_100036660 3300005456 Bacteria 3434
53 Ga0070662_100434018 3300005457 Bacteria 1088
54 Ga0070662_100949236 3300005457 Viruses 735
55 Ga0070662_101115969 3300005457 Bacteria 677
56 Ga0070681_10007698 3300005458 Bacteria 10533
57 Ga0070681_10766547 3300005458 Bacteria 881
58 Ga0068867_100193823 3300005459 Bacteria 1623
59 Ga0068867_102184651 3300005459 Bacteria 525
60 Ga0070685_10132062 3300005466 Bacteria 1563
61 Ga0070685_10803310 3300005466 Bacteria 694
62 Ga0070707_100576421 3300005468 Bacteria 1088
63 Ga0070698_100297488 3300005471 Bacteria 1545
64 Ga0070698_100591585 3300005471 Bacteria 1050
65 Ga0070699_100227501 3300005518 Bacteria 1663
66 Ga0070699_100418811 3300005518 Bacteria 1212
67 Ga0070699_101167976 3300005518 Bacteria 706
68 Ga0070679_102194611 3300005530 Bacteria 502
69 Ga0068853_100003052 3300005539 Bacteria 12784
70 Ga0068853_100073266 3300005539 Bacteria 2985
71 Ga0068853_101559126 3300005539 Bacteria 640
72 Ga0068853_102069662 3300005539 Bacteria 552
73 Ga0070672_100015638 3300005543 Bacteria 5412
74 Ga0070686_100089091 3300005544 Bacteria 2061
75 Ga0070696_100183374 3300005546 Bacteria 1554
76 Ga0070696_101464257 3300005546 Bacteria 584
77 Ga0070693_100042380 3300005547 Bacteria 2564
78 Ga0070665_100028826 3300005548 Bacteria 5588
79 Ga0070665_100344321 3300005548 Bacteria 1496
80 Ga0070704_100186052 3300005549 Bacteria 1665
81 Ga0068855_100248316 3300005563 Bacteria 1985
82 Ga0068855_100405421 3300005563 Bacteria 1494
83 Ga0070664_100046245 3300005564 Bacteria 3676
84 Ga0068857_100113626 3300005577 Bacteria 2435
85 Ga0068857_100232135 3300005577 Bacteria 1688
86 Ga0068854_100127250 3300005578 Bacteria 1941
87 Ga0068856_100091703 3300005614 Bacteria 3022
88 Ga0068852_100068297 3300005616 Bacteria 3110
89 Ga0068859_100022620 3300005617 Bacteria 6303
90 Ga0068859_102165047 3300005617 Bacteria 614
91 Ga0068864_100144993 3300005618 Bacteria 2145
92 Ga0068864_100979613 3300005618 Bacteria 838
93 Ga0068864_101405159 3300005618 Bacteria 700
94 Ga0068861_100736809 3300005719 Bacteria 919
95 Ga0068861_101824827 3300005719 Bacteria 604
96 Ga0068851_10014768 3300005834 Bacteria 3712
97 Ga0068870_10180155 3300005840 Bacteria 1268
98 Ga0068870_11213580 3300005840 Bacteria 547
99 Ga0068863_100113733 3300005841 Bacteria 2578
100 Ga0068863_100887134 3300005841 Bacteria 892
101 Ga0068858_100046798 3300005842 Bacteria 4010
102 Ga0068858_100336718 3300005842 Bacteria 1444
103 Ga0068858_100716792 3300005842 Bacteria 974
104 Ga0068858_100767828 3300005842 Bacteria 940
105 Ga0068860_100529152 3300005843 Bacteria 1179
106 Ga0068860_100838423 3300005843 Bacteria 934
107 Ga0068862_100346211 3300005844 Bacteria 1378
108 Ga0068862_100359964 3300005844 Bacteria 1352
109 Ga0068862_102340830 3300005844 Bacteria 546
110 Ga0068862_102494834 3300005844 Bacteria 529
111 Ga0081539_10023357 3300005985 Bacteria 4052
112 Ga0070715_10162791 3300006163 Bacteria 1104
113 Ga0070716_101633909 3300006173 Bacteria 530
114 Ga0097621_100109303 3300006237 Bacteria 2335
115 Ga0097621_100217925 3300006237 Bacteria 1662
116 Ga0097621_100557489 3300006237 Bacteria 1043
117 Ga0068871_100041146 3300006358 Bacteria 3704
118 Ga0068871_100070974 3300006358 Bacteria 2863
119 Ga0075428_100937310 3300006844 Bacteria 918
120 Ga0075433_10162335 3300006852 Bacteria 1989
121 Ga0075434_102190679 3300006871 Bacteria 557
122 Ga0075429_100141939 3300006880 Bacteria 2103
123 Ga0068865_100022300 3300006881 Bacteria 4129
124 Ga0068865_100158728 3300006881 Bacteria 1723
125 Ga0068865_101036297 3300006881 Bacteria 720
126 Ga0075436_100559909 3300006914 Bacteria 840
127 Ga0097620_100022621 3300006931 Bacteria 6303
128 Ga0097620_101463557 3300006931 Bacteria 754
129 Ga0097620_101737148 3300006931 Bacteria 689
130 Ga0097620_102164911 3300006931 Bacteria 614
131 Ga0075435_100224714 3300007076 Bacteria 1595
132 Ga0075435_100922160 3300007076 Bacteria 762
133 Ga0105240_10003847 3300009093 Bacteria 23184
134 Ga0111539_10003423 3300009094 Bacteria 20893
135 Ga0111539_12070813 3300009094 Bacteria 660
136 Ga0114129_11735638 3300009147 Bacteria 761
137 Ga0114129_12455731 3300009147 Bacteria 624
138 Ga0114129_13104013 3300009147 Bacteria 543
139 Ga0105248_10236525 3300009177 Bacteria 2056
140 Ga0105237_10017375 3300009545 Bacteria 7457
141 Ga0105237_10239109 3300009545 Bacteria 1817
142 Ga0105238_10157245 3300009551 Bacteria 2248
143 Ga0105249_11518478 3300009553 Bacteria 742
144 Ga0105239_10245289 3300010375 Bacteria 2011
145 Ga0105246_10291073 3300011119 Bacteria 1314
146 Ga0157373_10395907 3300013100 Bacteria 989
147 Ga0157373_11042350 3300013100 Bacteria 612
148 Ga0157371_10003069 3300013102 Bacteria 15491
149 Ga0157370_10072982 3300013104 Bacteria 3238
150 Ga0157370_10466007 3300013104 Bacteria 1161
151 Ga0157369_10420856 3300013105 Bacteria 1385
152 Ga0157374_10257510 3300013296 Bacteria 1718
153 Ga0163162_12455760 3300013306 Bacteria 599
154 Ga0157372_10070450 3300013307 Bacteria 3934
155 Ga0157372_10179463 3300013307 Bacteria 2451
156 Ga0157375_10384053 3300013308 Bacteria 1571
157 Ga0157375_11606063 3300013308 Bacteria 769
158 Ga0163163_10099072 3300014325 Bacteria 2936
159 Ga0157380_10023524 3300014326 Bacteria 4648
160 Ga0157379_10263599 3300014968 Bacteria 1566
161 Ga0157376_10165511 3300014969 Bacteria 2009
162 Ga0163161_10055954 3300017792 Bacteria 2865
163 Ga0207697_10096461 3300025315 Bacteria 1257
164 Ga0207656_10038425 3300025321 Bacteria 2019
165 Ga0207656_10318957 3300025321 Bacteria 772
166 Ga0207653_10215546 3300025885 Bacteria 727
167 Ga0207682_10138024 3300025893 Bacteria 1092
168 Ga0207680_10028868 3300025903 Bacteria 3109
169 Ga0207680_10088272 3300025903 Bacteria 1965
170 Ga0207680_10340259 3300025903 Bacteria 1052
171 Ga0207645_10083827 3300025907 Bacteria 2045
172 Ga0207645_10585417 3300025907 Bacteria 757
173 Ga0207643_10006333 3300025908 Bacteria 6338
174 Ga0207643_10281951 3300025908 Bacteria 1030
175 Ga0207705_10226263 3300025909 Bacteria 1422
176 Ga0207684_10105517 3300025910 Bacteria 2410
177 Ga0207707_10070447 3300025912 Bacteria 3047
178 Ga0207707_11180854 3300025912 Bacteria 620
179 Ga0207695_10028505 3300025913 Bacteria 6190
180 Ga0207671_10014859 3300025914 Bacteria 6126
181 Ga0207663_10219197 3300025916 Bacteria 1383
182 Ga0207660_10508438 3300025917 Bacteria 978
183 Ga0207660_10790914 3300025917 Bacteria 774
184 Ga0207662_10496219 3300025918 Bacteria 840
185 Ga0207662_11105903 3300025918 Bacteria 563
186 Ga0207649_10047281 3300025920 Bacteria 2647
187 Ga0207649_10074640 3300025920 Bacteria 2177
188 Ga0207652_11332030 3300025921 Bacteria 621
189 Ga0207646_10532113 3300025922 Bacteria 1058
190 Ga0207646_11037228 3300025922 Bacteria 723
191 Ga0207646_11799159 3300025922 Bacteria 524
192 Ga0207681_10076590 3300025923 Bacteria 2349
193 Ga0207681_10172527 3300025923 Bacteria 1640
194 Ga0207681_11857983 3300025923 Bacteria 502
195 Ga0207694_10317267 3300025924 Bacteria 1285
196 Ga0207650_10289555 3300025925 Bacteria 1335
197 Ga0207659_10006621 3300025926 Bacteria 7116
198 Ga0207659_10014214 3300025926 Bacteria 5125
199 Ga0207659_10025329 3300025926 Bacteria 3985
200 Ga0207644_10910608 3300025931 Bacteria 737
201 Ga0207690_11746328 3300025932 Bacteria 520
202 Ga0207706_10283487 3300025933 Bacteria 1444
203 Ga0207670_10061868 3300025936 Bacteria 2556
204 Ga0207670_10106097 3300025936 Bacteria 2015
205 Ga0207669_10245095 3300025937 Bacteria 1331
206 Ga0207669_10679519 3300025937 Bacteria 844
207 Ga0207704_10377182 3300025938 Bacteria 1112
208 Ga0207665_11173048 3300025939 Bacteria 613
209 Ga0207691_10007892 3300025940 Bacteria 10257
210 Ga0207691_10975674 3300025940 Bacteria 708
211 Ga0207691_11447181 3300025940 Bacteria 563
212 Ga0207711_10186666 3300025941 Bacteria 1888
213 Ga0207689_10257802 3300025942 Bacteria 1442
214 Ga0207661_11017166 3300025944 Bacteria 763
215 Ga0207679_10103729 3300025945 Bacteria 2229
216 Ga0207667_10237469 3300025949 Bacteria 1866
217 Ga0207667_10255430 3300025949 Bacteria 1793
218 Ga0207667_10921821 3300025949 Bacteria 864
219 Ga0207651_10034010 3300025960 Bacteria 3295
220 Ga0207651_10104579 3300025960 Bacteria 2110
221 Ga0207651_10209843 3300025960 Bacteria 1567
222 Ga0207651_10670247 3300025960 Bacteria 912
223 Ga0207651_11995496 3300025960 Bacteria 521
224 Ga0207668_10079035 3300025972 Bacteria 2378
225 Ga0207668_10205502 3300025972 Bacteria 1571
226 Ga0207640_10516280 3300025981 Bacteria 998
227 Ga0207658_10055372 3300025986 Bacteria 2939
228 Ga0207658_10881063 3300025986 Bacteria 814
229 Ga0207677_10122599 3300026023 Bacteria 1958
230 Ga0207677_11286824 3300026023 Bacteria 671
231 Ga0207703_10132549 3300026035 Bacteria 2154
232 Ga0207639_10477013 3300026041 Bacteria 1136
233 Ga0207639_10833834 3300026041 Bacteria 860
234 Ga0207678_10470135 3300026067 Bacteria 1094
235 Ga0207708_10300939 3300026075 Bacteria 1304
236 Ga0207708_10907653 3300026075 Bacteria 763
237 Ga0207702_11453079 3300026078 Bacteria 679
238 Ga0207641_10335354 3300026088 Bacteria 1437
239 Ga0207641_10544832 3300026088 Bacteria 1131
240 Ga0207648_10169948 3300026089 Bacteria 1927
241 Ga0207648_11112173 3300026089 Bacteria 741
242 Ga0207676_11123843 3300026095 Bacteria 777
243 Ga0207676_11339163 3300026095 Bacteria 711
244 Ga0207676_11371110 3300026095 Bacteria 703
245 Ga0207674_10215310 3300026116 Bacteria 1869
246 Ga0207675_100329760 3300026118 Bacteria 1492
247 Ga0207675_100395899 3300026118 Bacteria 1360
248 Ga0207675_100579881 3300026118 Bacteria 1123
249 Ga0207683_10015572 3300026121 Bacteria 6472
250 Ga0209967_1045030 3300027364 Bacteria 674
251 Ga0209966_1014217 3300027695 Bacteria 1483
252 Ga0207428_10019218 3300027907 Bacteria 5826
253 Ga0207428_10882221 3300027907 Bacteria 632
254 Ga0268266_10075127 3300028379 Bacteria 2935
255 Ga0268266_10319415 3300028379 Bacteria 1453
256 Ga0268266_10877450 3300028379 Bacteria 867
257 Ga0268265_10030967 3300028380 Bacteria 3860
258 Ga0268265_10527419 3300028380 Bacteria 1117
259 Ga0268265_10738691 3300028380 Bacteria 954
260 Ga0268265_11991820 3300028380 Bacteria 588
261 Ga0268264_10783432 3300028381 Bacteria 952
262 Ga0307509_10047184 3300031507 Bacteria 4634
263 Ga0307509_10175330 3300031507 Bacteria 2017
264 Ga0307408_100011324 3300031548 Bacteria 5894
265 Ga0307408_100511221 3300031548 Bacteria 1053
266 Ga0307408_101448299 3300031548 Bacteria 648
267 Ga0307516_10903074 3300031730 Bacteria 550
268 Ga0307405_10016026 3300031731 Bacteria 4076
269 Ga0307405_10781273 3300031731 Bacteria 798
270 Ga0307413_10062788 3300031824 Bacteria 2300
271 Ga0307410_10007801 3300031852 Bacteria 5886
272 Ga0307410_10288312 3300031852 Bacteria 1291
273 Ga0307406_10013525 3300031901 Bacteria 4677
274 Ga0307407_10003872 3300031903 Bacteria 6238
275 Ga0307412_10182338 3300031911 Bacteria 1580
276 Ga0307412_10319329 3300031911 Bacteria 1235
277 Ga0307409_100013922 3300031995 Bacteria 5204
278 Ga0307409_100099097 3300031995 Bacteria 2412
279 Ga0307409_100169324 3300031995 Bacteria 1921
280 Ga0307409_100313781 3300031995 Bacteria 1464
281 Ga0307416_100058832 3300032002 Bacteria 3119
282 Ga0307416_100260538 3300032002 Bacteria 1694
283 Ga0307414_10197795 3300032004 Bacteria 1632
284 Ga0307414_10288634 3300032004 Bacteria 1382
285 Ga0307414_10331573 3300032004 Bacteria 1299
286 Ga0307411_10026558 3300032005 Bacteria 3488
287 Ga0307411_10547728 3300032005 Bacteria 986
288 Ga0307411_10691524 3300032005 Bacteria 887
289 Ga0307415_100141649 3300032126 Bacteria 1837
290 Ga0307415_100696551 3300032126 Bacteria 916
291 Ga0307415_101523985 3300032126 Bacteria 640
292 Ga0373959_0045303 3300034820 Bacteria 935
293 Ga0373934_0001053 3300035086 Bacteria 9977
294 Ga0373923_0042784 3300035111 Bacteria 1872
295 Ga0373953_0096564 3300035117 Bacteria 1240
296 Ga0373954_0005497 3300035118 Bacteria 5483
297 Ga0373956_0012683 3300035119 Bacteria 3497
298 Ga0373957_0000615 3300035120 Bacteria 9084
299 Ga0373955_0011430 3300035172 Bacteria 4230
300 Ga0373924_0063866 3300035410 Bacteria 1545
301 Ga0373931_0432856 3300035691 Bacteria 838
302 Ga0373931_0819580 3300035691 Bacteria 621
303 Ga0373935_1034776 3300035692 Bacteria 610
304 Ga0373933_0035595 3300035724 Bacteria 2908
305 Ga0373937_0174802 3300036401 Bacteria 2015
306 Ga0439439_0139179 3300041406 Bacteria 685
307 Ga0451800_0805652 3300041459 Bacteria 539
308 Ga0451802_1110846 3300041460 Unclassified 693
309 Ga0451853_1755203 3300041512 Bacteria 1830
310 Ga0439462_0049262 3300042015 Bacteria 1131
311 Ga0450892_019650 3300042130 Bacteria 656
312 Ga0439458_0061712 3300042157 Bacteria 937
313 Ga0450908_000083 3300042184 Bacteria 19276
314 Ga0453684_0546770 3300044712 Bacteria 1276
315 Ga0451576_2554129 3300045051 Bacteria 521
316 Ga0495590_0346314 3300046457 Bacteria 564
317 Ga0495651_0212664 3300046462 Bacteria 1344
318 Ga0495585_0502564 3300046492 Bacteria 576
319 Ga0495608_0168110 3300046511 Bacteria 1391
320 Ga0495652_0586236 3300046529 Bacteria 762
321 Ga0495587_0715886 3300046536 Bacteria 548
322 Ga0495633_0227797 3300046558 Bacteria 852
323 Ga0495667_0032680 3300046559 Bacteria 3485
324 Ga0495657_0309038 3300046675 Bacteria 941
325 Ga0495599_0063595 3300046678 Bacteria 2306
326 Ga0495623_0270157 3300046679 Bacteria 950
327 Ga0495658_0018426 3300046683 Bacteria 3630
328 Ga0495649_0278367 3300046694 Bacteria 855
329 Ga0495680_0135063 3300047322 Bacteria 1809
330 Ga0495675_0020625 3300047444 Bacteria 4195
331 Ga0496104_0090572 3300048907 Bacteria 2923
332 Ga0496105_0428474 3300048908 Bacteria 1046
333 Ga0496110_0743248 3300048913 Bacteria 884
334 Ga0496114_0871361 3300048917 Bacteria 781
335 Ga0496118_0179040 3300048921 Bacteria 1283
336 Ga0496118_0376634 3300048921 Bacteria 746
337 Ga0496119_0000979 3300048922 Bacteria 36683
338 Ga0496120_0001049 3300048923 Bacteria 36674
339 Ga0496121_0468031 3300048924 Bacteria 808
340 Ga0496122_0019562 3300048925 Bacteria 6176
341 Ga0496123_0021884 3300048926 Bacteria 4952
342 Ga0496124_0011000 3300048927 Bacteria 9089
343 Ga0496125_0015734 3300048928 Bacteria 7294
344 Ga0496125_0150986 3300048928 Bacteria 1596
345 Ga0496126_0007275 3300048929 Bacteria 12168
346 Ga0496126_1217296 3300048929 Bacteria 553
347 Ga0501038_1094213 3300049574 Bacteria 582
348 Ga0501040_0122951 3300049576 Bacteria 1822
349 Ga0501068_0726252 3300049584 Bacteria 650
350 Ga0501072_1157853 3300049588 Bacteria 601
351 Ga0501073_1070469 3300049589 Bacteria 554
352 Ga0501073_1204383 3300049589 Bacteria 520
353 Ga0501074_0160105 3300049590 Bacteria 1608
354 Ga0501076_1589236 3300049592 Bacteria 537
355 Ga0501225_0079031 3300049705 Bacteria 943
356 Ga0501079_0308576 3300049741 Bacteria 1238
357 Ga0501079_0793104 3300049741 Bacteria 746
358 Ga0501079_0796005 3300049741 Bacteria 744
359 Ga0501080_0126658 3300049742 Bacteria 2365
360 Ga0501035_0057569 3300049822 Bacteria 3465
361 Ga0501044_0112295 3300049823 Bacteria 2732
362 Ga0501044_0619177 3300049823 Bacteria 974
363 Ga0501045_0137139 3300049824 Bacteria 1819
364 nmdc:mga00v17_312530_c1 3300050491 Bacteria 1021
365 nmdc:mga05p37_1242341_c1 3300050507 Bacteria 765
366 nmdc:mga05p37_1820042_c1 3300050507 Bacteria 586
367 nmdc:mga09592_140422_c1 3300050508 Bacteria 2082
368 nmdc:mga09592_488813_c1 3300050508 Unclassified 1060
369 nmdc:mga0qj67_501189_c1 3300050509 Bacteria 976
370 nmdc:mga08y16_1799981_c1 3300050511 Bacteria 565
371 nmdc:mga08y16_688_c1 3300050511 Bacteria 32041
372 nmdc:mga0n895_1071778_c1 3300050512 Bacteria 784
373 nmdc:mga0n895_121208_c1 3300050512 Bacteria 1242
374 nmdc:mga0n895_1747024_c1 3300050512 Bacteria 584
375 nmdc:mga0rr50_113158_c1 3300050513 Bacteria 2150
376 nmdc:mga08x19_264665_c1 3300050514 Bacteria 1189
377 nmdc:mga0a205_10143_c1 3300050515 Bacteria 8648
378 nmdc:mga0a205_712088_c1 3300050515 Bacteria 853
379 Ga0495595_0001401 3300053084 Bacteria 9367
380 Ga0500566_0180275 3300053094 Bacteria 1084
381 Ga0500595_150380 3300053119 Bacteria 651
382 Ga0500597_016493 3300053120 Bacteria 2820
383 Ga0500614_009241 3300053123 Bacteria 2101
384 Ga0500603_013172 3300053150 Bacteria 1914
385 Ga0500622_0295959 3300053156 Bacteria 692
386 Ga0500638_121143 3300053162 Bacteria 1197
387 Ga0500637_0353266 3300053178 Bacteria 781
388 Ga0500661_097889 3300055283 Bacteria 555
389 Ga0075428_102330648
390 JGI25406J46586_10098877
391 Ga0065714_10233384
392 Ga0065712_10836422
393 Ga0065707_10179754
394 Ga0070676_10075019
395 Ga0070676_10237820
396 Ga0070690_100031492
397 Ga0070690_100579268
398 Ga0070670_100152103
399 Ga0070677_10021549
400 Ga0070677_10890347
401 Ga0068869_100241168
402 Ga0068869_101250035
403 Ga0070666_10205406
404 Ga0070666_10309433
405 Ga0070666_11290203
406 Ga0070682_100408279
407 Ga0068868_100055776
408 Ga0070660_100896052
409 Ga0070689_100107443
410 Ga0070689_100186069
411 Ga0070661_100017763
412 Ga0070661_100165379
413 Ga0070661_100247294
414 Ga0070692_10470059
415 Ga0070668_100001751
416 Ga0070669_100079423
417 Ga0070675_100019716
418 Ga0070675_100731473
419 Ga0070671_100023601
420 Ga0070671_101215213
421 Ga0070673_100001787
422 Ga0070673_100285492
423 Ga0070673_100546225
424 Ga0070673_102210057
425 Ga0070688_100005880
426 Ga0070688_100369151
427 Ga0070659_101088055
428 Ga0070667_100144644
429 Ga0070667_100239503
430 Ga0070667_100544822
431 Ga0070705_100154141
432 Ga0070705_101509899
433 Ga0070700_101875347
434 Ga0070700_101881483
435 Ga0070694_100055981
436 Ga0070708_100873336
437 Ga0070708_101000915
438 Ga0070663_100020068
439 Ga0070663_100537124
440 Ga0070678_100036660
441 Ga0070662_100434018
442 Ga0070662_100949236
443 Ga0070662_101115969
444 Ga0070681_10007698
445 Ga0070681_10766547
446 Ga0068867_100193823
447 Ga0068867_102184651
448 Ga0070685_10132062
449 Ga0070685_10803310
450 Ga0070707_100576421
451 Ga0070698_100297488
452 Ga0070698_100591585
453 Ga0070699_100227501
454 Ga0070699_100418811
455 Ga0070699_101167976
456 Ga0070679_102194611
457 Ga0068853_100003052
458 Ga0068853_100073266
459 Ga0068853_101559126
460 Ga0068853_102069662
461 Ga0070672_100015638
462 Ga0070686_100089091
463 Ga0070696_100183374
464 Ga0070696_101464257
465 Ga0070693_100042380
466 Ga0070665_100028826
467 Ga0070665_100344321
468 Ga0070704_100186052
469 Ga0068855_100248316
470 Ga0068855_100405421
471 Ga0070664_100046245
472 Ga0068857_100113626
473 Ga0068857_100232135
474 Ga0068854_100127250
475 Ga0068856_100091703
476 Ga0068852_100068297
477 Ga0068859_100022620
478 Ga0068859_102165047
479 Ga0068864_100144993
480 Ga0068864_100979613
481 Ga0068864_101405159
482 Ga0068861_100736809
483 Ga0068861_101824827
484 Ga0068851_10014768
485 Ga0068870_10180155
486 Ga0068870_11213580
487 Ga0068863_100113733
488 Ga0068863_100887134
489 Ga0068858_100046798
490 Ga0068858_100336718
491 Ga0068858_100716792
492 Ga0068858_100767828
493 Ga0068860_100529152
494 Ga0068860_100838423
495 Ga0068862_100346211
496 Ga0068862_100359964
497 Ga0068862_102340830
498 Ga0068862_102494834
499 Ga0081539_10023357
500 Ga0070715_10162791
501 Ga0070716_101633909
502 Ga0097621_100109303
503 Ga0097621_100217925
504 Ga0097621_100557489
505 Ga0068871_100041146
506 Ga0068871_100070974
507 Ga0075428_100937310
508 Ga0075433_10162335
509 Ga0075434_102190679
510 Ga0075429_100141939
511 Ga0068865_100022300
512 Ga0068865_100158728
513 Ga0068865_101036297
514 Ga0075436_100559909
515 Ga0097620_100022621
516 Ga0097620_101463557
517 Ga0097620_101737148
518 Ga0097620_102164911
519 Ga0075435_100224714
520 Ga0075435_100922160
521 Ga0105240_10003847
522 Ga0111539_10003423
523 Ga0111539_12070813
524 Ga0114129_11735638
525 Ga0114129_12455731
526 Ga0114129_13104013
527 Ga0105248_10236525
528 Ga0105237_10017375
529 Ga0105237_10239109
530 Ga0105238_10157245
531 Ga0105249_11518478
532 Ga0105239_10245289
533 Ga0105246_10291073
534 Ga0157373_10395907
535 Ga0157373_11042350
536 Ga0157371_10003069
537 Ga0157370_10072982
538 Ga0157370_10466007
539 Ga0157369_10420856
540 Ga0157374_10257510
541 Ga0163162_12455760
542 Ga0157372_10070450
543 Ga0157372_10179463
544 Ga0157375_10384053
545 Ga0157375_11606063
546 Ga0163163_10099072
547 Ga0157380_10023524
548 Ga0157379_10263599
549 Ga0157376_10165511
550 Ga0163161_10055954
551 Ga0207697_10096461
552 Ga0207656_10038425
553 Ga0207656_10318957
554 Ga0207653_10215546
555 Ga0207682_10138024
556 Ga0207680_10028868
557 Ga0207680_10088272
558 Ga0207680_10340259
559 Ga0207645_10083827
560 Ga0207645_10585417
561 Ga0207643_10006333
562 Ga0207643_10281951
563 Ga0207705_10226263
564 Ga0207684_10105517
565 Ga0207707_10070447
566 Ga0207707_11180854
567 Ga0207695_10028505
568 Ga0207671_10014859
569 Ga0207663_10219197
570 Ga0207660_10508438
571 Ga0207660_10790914
572 Ga0207662_10496219
573 Ga0207662_11105903
574 Ga0207649_10047281
575 Ga0207649_10074640
576 Ga0207652_11332030
577 Ga0207646_10532113
578 Ga0207646_11037228
579 Ga0207646_11799159
580 Ga0207681_10076590
581 Ga0207681_10172527
582 Ga0207681_11857983
583 Ga0207694_10317267
584 Ga0207650_10289555
585 Ga0207659_10006621
586 Ga0207659_10014214
587 Ga0207659_10025329
588 Ga0207644_10910608
589 Ga0207690_11746328
590 Ga0207706_10283487
591 Ga0207670_10061868
592 Ga0207670_10106097
593 Ga0207669_10245095
594 Ga0207669_10679519
595 Ga0207704_10377182
596 Ga0207665_11173048
597 Ga0207691_10007892
598 Ga0207691_10975674
599 Ga0207691_11447181
600 Ga0207711_10186666
601 Ga0207689_10257802
602 Ga0207661_11017166
603 Ga0207679_10103729
604 Ga0207667_10237469
605 Ga0207667_10255430
606 Ga0207667_10921821
607 Ga0207651_10034010
608 Ga0207651_10104579
609 Ga0207651_10209843
610 Ga0207651_10670247
611 Ga0207651_11995496
612 Ga0207668_10079035
613 Ga0207668_10205502
614 Ga0207640_10516280
615 Ga0207658_10055372
616 Ga0207658_10881063
617 Ga0207677_10122599
618 Ga0207677_11286824
619 Ga0207703_10132549
620 Ga0207639_10477013
621 Ga0207639_10833834
622 Ga0207678_10470135
623 Ga0207708_10300939
624 Ga0207708_10907653
625 Ga0207702_11453079
626 Ga0207641_10335354
627 Ga0207641_10544832
628 Ga0207648_10169948
629 Ga0207648_11112173
630 Ga0207676_11123843
631 Ga0207676_11339163
632 Ga0207676_11371110
633 Ga0207674_10215310
634 Ga0207675_100329760
635 Ga0207675_100395899
636 Ga0207675_100579881
637 Ga0207683_10015572
638 Ga0209967_1045030
639 Ga0209966_1014217
640 Ga0207428_10019218
641 Ga0207428_10882221
642 Ga0268266_10075127
643 Ga0268266_10319415
644 Ga0268266_10877450
645 Ga0268265_10030967
646 Ga0268265_10527419
647 Ga0268265_10738691
648 Ga0268265_11991820
649 Ga0268264_10783432
650 Ga0307509_10047184
651 Ga0307509_10175330
652 Ga0307408_100011324
653 Ga0307408_100511221
654 Ga0307408_101448299
655 Ga0307516_10903074
656 Ga0307405_10016026
657 Ga0307405_10781273
658 Ga0307413_10062788
659 Ga0307410_10007801
660 Ga0307410_10288312
661 Ga0307406_10013525
662 Ga0307407_10003872
663 Ga0307412_10182338
664 Ga0307412_10319329
665 Ga0307409_100013922
666 Ga0307409_100099097
667 Ga0307409_100169324
668 Ga0307409_100313781
669 Ga0307416_100058832
670 Ga0307416_100260538
671 Ga0307414_10197795
672 Ga0307414_10288634
673 Ga0307414_10331573
674 Ga0307411_10026558
675 Ga0307411_10547728
676 Ga0307411_10691524
677 Ga0307415_100141649
678 Ga0307415_100696551
679 Ga0307415_101523985
680 Ga0373959_0045303
681 Ga0373934_0001053
682 Ga0373923_0042784
683 Ga0373953_0096564
684 Ga0373954_0005497
685 Ga0373956_0012683
686 Ga0373957_0000615
687 Ga0373955_0011430
688 Ga0373924_0063866
689 Ga0373931_0432856
690 Ga0373931_0819580
691 Ga0373935_1034776
692 Ga0373933_0035595
693 Ga0373937_0174802
694 Ga0439439_0139179
695 Ga0451800_0805652
696 Ga0451802_1110846
697 Ga0451853_1755203
698 Ga0439462_0049262
699 Ga0450892_019650
700 Ga0439458_0061712
701 Ga0450908_000083
702 Ga0453684_0546770
703 Ga0451576_2554129
704 Ga0495590_0346314
705 Ga0495651_0212664
706 Ga0495585_0502564
707 Ga0495608_0168110
708 Ga0495652_0586236
709 Ga0495587_0715886
710 Ga0495633_0227797
711 Ga0495667_0032680
712 Ga0495657_0309038
713 Ga0495599_0063595
714 Ga0495623_0270157
715 Ga0495658_0018426
716 Ga0495649_0278367
717 Ga0495680_0135063
718 Ga0495675_0020625
719 Ga0496104_0090572
720 Ga0496105_0428474
721 Ga0496110_0743248
722 Ga0496114_0871361
723 Ga0496118_0179040
724 Ga0496118_0376634
725 Ga0496119_0000979
726 Ga0496120_0001049
727 Ga0496121_0468031
728 Ga0496122_0019562
729 Ga0496123_0021884
730 Ga0496124_0011000
731 Ga0496125_0015734
732 Ga0496125_0150986
733 Ga0496126_0007275
734 Ga0496126_1217296
735 Ga0501038_1094213
736 Ga0501040_0122951
737 Ga0501068_0726252
738 Ga0501072_1157853
739 Ga0501073_1070469
740 Ga0501073_1204383
741 Ga0501074_0160105
742 Ga0501076_1589236
743 Ga0501225_0079031
744 Ga0501079_0308576
745 Ga0501079_0793104
746 Ga0501079_0796005
747 Ga0501080_0126658
748 Ga0501035_0057569
749 Ga0501044_0112295
750 Ga0501044_0619177
751 Ga0501045_0137139
752 nmdc:mga00v17_312530_c1
753 nmdc:mga05p37_1242341_c1
754 nmdc:mga05p37_1820042_c1
755 nmdc:mga09592_140422_c1
756 nmdc:mga09592_488813_c1
757 nmdc:mga0qj67_501189_c1
758 nmdc:mga08y16_1799981_c1
759 nmdc:mga08y16_688_c1
760 nmdc:mga0n895_1071778_c1
761 nmdc:mga0n895_121208_c1
762 nmdc:mga0n895_1747024_c1
763 nmdc:mga0rr50_113158_c1
764 nmdc:mga08x19_264665_c1
765 nmdc:mga0a205_10143_c1
766 nmdc:mga0a205_712088_c1
767 Ga0495595_0001401
768 Ga0500566_0180275
769 Ga0500595_150380
770 Ga0500597_016493
771 Ga0500614_009241
772 Ga0500603_013172
773 Ga0500622_0295959
774 Ga0500638_121143
775 Ga0500637_0353266
776 Ga0500661_097889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n70-assembly1.cif.gz_A crystal structure of atpase delta1-79 spa47 r191a 0.5555 12 53
5syr-assembly2.cif.gz_B crystal structure of atpase delta1-79 spa47 r350a 0.555 12 53
6n73-assembly2.cif.gz_B crystal structure of atpase delta1-79 spa47 r271a 0.5548 12 53
6n74-assembly2.cif.gz_B crystal structure of atpase delta1-79 spa47 r271e 0.5542 12 53
6n71-assembly2.cif.gz_B crystal structure of atpase delta1-79 spa47 r191e 0.5525 12 53
ID Description Score Start End Superfamily
4javB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8292 9 50 1.10.287.130
4javB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.5906 9 50 1.10.287.130
af_O80765_10_126_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.4877 29 55 3.30.420.40
1bazA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.4828 7 51 1.10.1220.10
1bdtB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.4687 7 49 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A849HFZ1-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.5523 7 61 GO:0006355
AF-A0A062XKV2-F1-model_v4 CopG-like ribbon-helix-helix domain-containing protein 0.5023 5 58 GO:0006355
AF-A0A849HFZ1-F1-model_v4 Ribbon-helix-helix protein, CopG family 0.4937 7 61 GO:0006355
AF-A0A139WVB7-F1-model_v4 CopG-like ribbon-helix-helix domain-containing protein 0.4813 7 61 GO:0006355
AF-A0A150M2A9-F1-model_v4 Toxin-antitoxin system HicB family antitoxin 0.4703 5 61 GO:0006355

Map