F430868

General Info

Members Datasets Scaffolds Average Seq Length
387 187 774 199

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100090583|Ga0307408_1000905832
Length 239
Sequence LDFGFNRSCNRFVKIQSIFSETTFSKNLNAFNAQANPKSEIRNRTGLIKLDNKKVDLEKIAHGVRLILEGIGEDADRDGLQKTPERVAQFYAELTEGMWEDARSHIVPLPGDTHDEMVIVKDISIASVCEHHLAPFVGKCHIAYIPKGGRIVGLSKLARIAEIFARRLQVQERLTQEIAQTLFDELQPLGVMVVVEAEHTCMTLRGVKKPGAKTITSSVLGGFRKDARTRAEAMSLIKG

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.03
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 20.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100090583 3300031548 Bacteria 2308
2 SwRhRL3b_contig_313608 2162886006 Bacteria 1313
3 JGI24034J26672_10000005 3300002239 Bacteria 404185
4 Ga0065704_10080533 3300005289 Bacteria 3929
5 Ga0065715_10049854 3300005293 Unclassified 997
6 Ga0065707_10098681 3300005295 Bacteria 3066
7 Ga0065707_10107583 3300005295 Bacteria 2548
8 Ga0070690_100040543 3300005330 Unclassified 2945
9 Ga0070690_100147467 3300005330 Unclassified 1602
10 Ga0070690_100281755 3300005330 Unclassified 1186
11 Ga0070670_100045903 3300005331 Bacteria 3756
12 Ga0070670_101343674 3300005331 Bacteria 655
13 Ga0070677_10251536 3300005333 Unclassified 877
14 Ga0068869_100067582 3300005334 Bacteria 2637
15 Ga0070666_10100027 3300005335 Bacteria 1997
16 Ga0070680_100088290 3300005336 Bacteria 2565
17 Ga0070682_100189641 3300005337 Unclassified 1442
18 Ga0070689_100168879 3300005340 Bacteria 1772
19 Ga0070661_100074118 3300005344 Bacteria 2506
20 Ga0070668_100814530 3300005347 Bacteria 830
21 Ga0070671_100196200 3300005355 Bacteria 1711
22 Ga0070674_100620763 3300005356 Bacteria 916
23 Ga0070673_100201785 3300005364 Bacteria 1713
24 Ga0070673_101185652 3300005364 Unclassified 715
25 Ga0070688_100171936 3300005365 Unclassified 1496
26 Ga0070688_100480057 3300005365 Bacteria 934
27 Ga0070659_100060031 3300005366 Bacteria 3003
28 Ga0070659_100274603 3300005366 Bacteria 1401
29 Ga0070667_100206863 3300005367 Bacteria 1743
30 Ga0070703_10000091 3300005406 Bacteria 45812
31 Ga0070703_10193952 3300005406 Bacteria 793
32 Ga0070701_10401257 3300005438 Bacteria 869
33 Ga0070705_100256270 3300005440 Bacteria 1231
34 Ga0070700_100001208 3300005441 Bacteria 12794
35 Ga0070694_100000775 3300005444 Bacteria 17866
36 Ga0070694_100016685 3300005444 Bacteria 4625
37 Ga0070694_100123891 3300005444 Bacteria 1858
38 Ga0070694_100129086 3300005444 Unclassified 1824
39 Ga0070708_100130987 3300005445 Unclassified 2321
40 Ga0070708_100170886 3300005445 Bacteria 2029
41 Ga0070708_100181189 3300005445 Bacteria 1969
42 Ga0070663_100343271 3300005455 Unclassified 1207
43 Ga0070678_100106815 3300005456 Unclassified 2182
44 Ga0070681_10103834 3300005458 Bacteria 2785
45 Ga0068867_100512477 3300005459 Bacteria 1033
46 Ga0070685_10041860 3300005466 Unclassified 2611
47 Ga0070685_10717405 3300005466 Unclassified 730
48 Ga0070706_100061496 3300005467 Bacteria 3468
49 Ga0070706_100107798 3300005467 Bacteria 2591
50 Ga0070706_100338028 3300005467 Bacteria 1404
51 Ga0070707_100028879 3300005468 Bacteria 5278
52 Ga0070707_100104793 3300005468 Bacteria 2742
53 Ga0070707_100235019 3300005468 Bacteria 1784
54 Ga0070707_100300417 3300005468 Unclassified 1560
55 Ga0070707_100398064 3300005468 Bacteria 1337
56 Ga0070707_100671379 3300005468 Bacteria 999
57 Ga0070698_100000164 3300005471 Bacteria 61194
58 Ga0070698_100021387 3300005471 Bacteria 6777
59 Ga0070698_100219153 3300005471 Unclassified 1837
60 Ga0070698_100472135 3300005471 Bacteria 1191
61 Ga0070699_100061554 3300005518 Bacteria 3252
62 Ga0070679_100482927 3300005530 Unclassified 1183
63 Ga0070697_100201973 3300005536 Bacteria 1690
64 Ga0068853_100007442 3300005539 Bacteria 8762
65 Ga0068853_100192535 3300005539 Unclassified 1853
66 Ga0070672_100461416 3300005543 Bacteria 1095
67 Ga0070686_100162830 3300005544 Bacteria 1572
68 Ga0070686_100167152 3300005544 Bacteria 1553
69 Ga0070686_100655018 3300005544 Unclassified 833
70 Ga0070695_100299410 3300005545 Bacteria 1188
71 Ga0070696_100268868 3300005546 Bacteria 1296
72 Ga0070693_100306074 3300005547 Unclassified 1073
73 Ga0070665_100306585 3300005548 Bacteria 1591
74 Ga0070704_100170324 3300005549 Bacteria 1731
75 Ga0070704_100685956 3300005549 Bacteria 907
76 Ga0068857_100344907 3300005577 Bacteria 1378
77 Ga0068857_100595217 3300005577 Bacteria 1045
78 Ga0068857_100668631 3300005577 Unclassified 985
79 Ga0068857_100827340 3300005577 Unclassified 885
80 Ga0070702_100028916 3300005615 Bacteria 3008
81 Ga0070702_100332660 3300005615 Bacteria 1063
82 Ga0070702_100571155 3300005615 Bacteria 843
83 Ga0068852_100182180 3300005616 Unclassified 1976
84 Ga0068852_100697321 3300005616 Unclassified 1025
85 Ga0068859_100035305 3300005617 Bacteria 5017
86 Ga0068859_100039222 3300005617 Bacteria 4751
87 Ga0068859_100120353 3300005617 Bacteria 2692
88 Ga0068859_100152653 3300005617 Bacteria 2385
89 Ga0068859_100740975 3300005617 Bacteria 1072
90 Ga0068864_100013605 3300005618 Bacteria 6746
91 Ga0068864_100024436 3300005618 Bacteria 5083
92 Ga0068864_100115731 3300005618 Bacteria 2392
93 Ga0068864_100172021 3300005618 Unclassified 1975
94 Ga0068864_100400195 3300005618 Bacteria 1305
95 Ga0068866_10063655 3300005718 Bacteria 1923
96 Ga0068861_100221267 3300005719 Bacteria 1600
97 Ga0068861_100338899 3300005719 Unclassified 1315
98 Ga0068851_10341095 3300005834 Unclassified 870
99 Ga0068863_100018375 3300005841 Bacteria 6691
100 Ga0068863_100416004 3300005841 Bacteria 1316
101 Ga0068858_100000026 3300005842 Bacteria 153013
102 Ga0068858_100014863 3300005842 Bacteria 7323
103 Ga0068858_100151970 3300005842 Bacteria 2177
104 Ga0068858_100586400 3300005842 Bacteria 1081
105 Ga0068860_100041628 3300005843 Bacteria 4388
106 Ga0068860_100346941 3300005843 Bacteria 1460
107 Ga0068860_100360765 3300005843 Bacteria 1432
108 Ga0068860_100386115 3300005843 Bacteria 1383
109 Ga0068860_100436139 3300005843 Bacteria 1301
110 Ga0068860_101057300 3300005843 Bacteria 830
111 Ga0068862_100039662 3300005844 Unclassified 4000
112 Ga0068862_100045110 3300005844 Bacteria 3761
113 Ga0068862_100074866 3300005844 Bacteria 2927
114 Ga0068862_100119049 3300005844 Bacteria 2326
115 Ga0068862_100299935 3300005844 Bacteria 1478
116 Ga0068862_100336516 3300005844 Unclassified 1397
117 Ga0081539_10054983 3300005985 Bacteria 2218
118 Ga0081539_10206638 3300005985 Bacteria 903
119 Ga0070715_10000018 3300006163 Bacteria 124487
120 Ga0070716_100000017 3300006173 Bacteria 88957
121 Ga0070716_100138867 3300006173 Bacteria 1547
122 Ga0097621_100003941 3300006237 Bacteria 10284
123 Ga0097621_100576152 3300006237 Unclassified 1027
124 Ga0068871_100003493 3300006358 Bacteria 10806
125 Ga0075428_100189967 3300006844 Unclassified 2221
126 Ga0075433_10087057 3300006852 Bacteria 2759
127 Ga0075433_10306724 3300006852 Bacteria 1405
128 Ga0075434_100015765 3300006871 Bacteria 7254
129 Ga0075434_100375550 3300006871 Unclassified 1443
130 Ga0075434_100657358 3300006871 Unclassified 1066
131 Ga0075429_100173639 3300006880 Bacteria 1888
132 Ga0068865_101070356 3300006881 Bacteria 709
133 Ga0097620_100035305 3300006931 Bacteria 5017
134 Ga0097620_100039224 3300006931 Bacteria 4751
135 Ga0097620_100120353 3300006931 Bacteria 2692
136 Ga0097620_100152641 3300006931 Bacteria 2385
137 Ga0097620_100740975 3300006931 Bacteria 1072
138 Ga0075435_100080304 3300007076 Bacteria 2677
139 Ga0099794_10066081 3300007265 Bacteria 1764
140 Ga0105251_10210718 3300009011 Unclassified 875
141 Ga0105251_10256359 3300009011 Bacteria 789
142 Ga0105250_10061221 3300009092 Bacteria 1513
143 Ga0105240_10220408 3300009093 Bacteria 2210
144 Ga0111539_10116418 3300009094 Bacteria 3134
145 Ga0105247_10000022 3300009101 Bacteria 219796
146 Ga0105247_10003696 3300009101 Bacteria 9931
147 Ga0105247_10222677 3300009101 Bacteria 1278
148 Ga0105247_10441050 3300009101 Bacteria 936
149 Ga0114129_10043671 3300009147 Bacteria 6306
150 Ga0114129_10277844 3300009147 Bacteria 2238
151 Ga0114129_10535837 3300009147 Unclassified 1525
152 Ga0114129_10686020 3300009147 Bacteria 1318
153 Ga0114129_11386737 3300009147 Bacteria 868
154 Ga0105243_10000084 3300009148 Bacteria 106821
155 Ga0105243_10138210 3300009148 Bacteria 2075
156 Ga0105241_10038467 3300009174 Bacteria 3606
157 Ga0105241_10107503 3300009174 Bacteria 2228
158 Ga0105242_10000229 3300009176 Bacteria 44171
159 Ga0105248_10068479 3300009177 Bacteria 3984
160 Ga0105248_10078245 3300009177 Bacteria 3718
161 Ga0105237_10028594 3300009545 Bacteria 5676
162 Ga0105237_10165980 3300009545 Bacteria 2207
163 Ga0105249_10388274 3300009553 Bacteria 1423
164 Ga0105249_10520367 3300009553 Bacteria 1237
165 Ga0105239_10235993 3300010375 Bacteria 2052
166 Ga0105239_10441666 3300010375 Unclassified 1475
167 Ga0105246_10480065 3300011119 Bacteria 1051
168 Ga0157373_10023890 3300013100 Unclassified 4429
169 Ga0157373_10093104 3300013100 Bacteria 2122
170 Ga0157373_10140330 3300013100 Bacteria 1699
171 Ga0157373_10523690 3300013100 Unclassified 858
172 Ga0157369_10334665 3300013105 Bacteria 1573
173 Ga0157374_10048751 3300013296 Bacteria 3931
174 Ga0157378_10030511 3300013297 Bacteria 4764
175 Ga0157378_10042433 3300013297 Unclassified 4038
176 Ga0157378_10117303 3300013297 Bacteria 2449
177 Ga0157378_10212836 3300013297 Bacteria 1833
178 Ga0163162_10058913 3300013306 Unclassified 3871
179 Ga0163162_10098628 3300013306 Bacteria 3011
180 Ga0163162_10258633 3300013306 Bacteria 1873
181 Ga0163162_10274226 3300013306 Bacteria 1819
182 Ga0157372_10008691 3300013307 Bacteria 10786
183 Ga0157372_10057443 3300013307 Bacteria 4350
184 Ga0157372_10104985 3300013307 Bacteria 3231
185 Ga0157372_10146186 3300013307 Bacteria 2726
186 Ga0157372_10590370 3300013307 Unclassified 1295
187 Ga0157375_10023051 3300013308 Bacteria 5739
188 Ga0157375_10049694 3300013308 Unclassified 4111
189 Ga0157375_10673769 3300013308 Unclassified 1189
190 Ga0157375_10775681 3300013308 Bacteria 1109
191 Ga0163163_10036597 3300014325 Bacteria 4769
192 Ga0163163_10579134 3300014325 Unclassified 1185
193 Ga0163163_11803534 3300014325 Bacteria 672
194 Ga0157380_10000627 3300014326 Bacteria 21695
195 Ga0157380_10208597 3300014326 Bacteria 1739
196 Ga0182008_10088602 3300014497 Bacteria 1525
197 Ga0157379_10018901 3300014968 Bacteria 6080
198 Ga0157379_10070977 3300014968 Unclassified 3116
199 Ga0163161_10062206 3300017792 Bacteria 2719
200 Ga0163161_10139080 3300017792 Bacteria 1837
201 Ga0163161_10286808 3300017792 Bacteria 1293
202 Ga0163161_10363379 3300017792 Bacteria 1153
203 Ga0213876_10000268 3300021384 Bacteria 48407
204 Ga0213876_10102702 3300021384 Bacteria 1516
205 Ga0207672_1000046 3300025223 Bacteria 16046
206 Ga0207653_10000034 3300025885 Bacteria 103130
207 Ga0207642_10009617 3300025899 Bacteria 3371
208 Ga0207710_10000001 3300025900 Bacteria 1797433
209 Ga0207710_10004588 3300025900 Bacteria 6009
210 Ga0207680_10173969 3300025903 Bacteria 1452
211 Ga0207685_10000022 3300025905 Bacteria 125184
212 Ga0207684_10008995 3300025910 Bacteria 8856
213 Ga0207684_10105820 3300025910 Bacteria 2406
214 Ga0207684_10558015 3300025910 Bacteria 979
215 Ga0207654_10277851 3300025911 Bacteria 1132
216 Ga0207707_10010071 3300025912 Bacteria 8201
217 Ga0207671_10209207 3300025914 Unclassified 1525
218 Ga0207671_10360846 3300025914 Bacteria 1153
219 Ga0207662_10133927 3300025918 Bacteria 1565
220 Ga0207662_10192991 3300025918 Unclassified 1315
221 Ga0207662_10633039 3300025918 Bacteria 746
222 Ga0207652_10428438 3300025921 Unclassified 1193
223 Ga0207646_10032515 3300025922 Bacteria 4721
224 Ga0207646_10074897 3300025922 Bacteria 3024
225 Ga0207646_10135214 3300025922 Bacteria 2220
226 Ga0207646_10534759 3300025922 Unclassified 1055
227 Ga0207650_10002493 3300025925 Bacteria 12801
228 Ga0207650_10460355 3300025925 Bacteria 1059
229 Ga0207659_10390233 3300025926 Unclassified 1162
230 Ga0207659_10564081 3300025926 Unclassified 969
231 Ga0207644_10002044 3300025931 Bacteria 13063
232 Ga0207644_10045762 3300025931 Bacteria 3114
233 Ga0207644_10332964 3300025931 Unclassified 1230
234 Ga0207644_10355031 3300025931 Unclassified 1191
235 Ga0207644_10498725 3300025931 Unclassified 1004
236 Ga0207706_10468599 3300025933 Bacteria 1089
237 Ga0207686_10000015 3300025934 Bacteria 202118
238 Ga0207686_10000144 3300025934 Bacteria 55991
239 Ga0207709_10000043 3300025935 Bacteria 248179
240 Ga0207709_10673194 3300025935 Bacteria 826
241 Ga0207670_10005908 3300025936 Bacteria 6755
242 Ga0207670_10117804 3300025936 Bacteria 1925
243 Ga0207669_10039159 3300025937 Bacteria 2736
244 Ga0207665_10000033 3300025939 Bacteria 89014
245 Ga0207691_10404179 3300025940 Bacteria 1165
246 Ga0207711_10009657 3300025941 Bacteria 8039
247 Ga0207711_10060869 3300025941 Bacteria 3254
248 Ga0207689_10110659 3300025942 Bacteria 2257
249 Ga0207661_10519549 3300025944 Bacteria 1089
250 Ga0207651_11052752 3300025960 Unclassified 728
251 Ga0207712_10135811 3300025961 Bacteria 1881
252 Ga0207712_10248829 3300025961 Bacteria 1436
253 Ga0207712_10688070 3300025961 Bacteria 892
254 Ga0207668_10053464 3300025972 Bacteria 2799
255 Ga0207668_10361239 3300025972 Bacteria 1217
256 Ga0207658_10061618 3300025986 Bacteria 2804
257 Ga0207658_10575707 3300025986 Bacteria 1010
258 Ga0207677_10229444 3300026023 Bacteria 1494
259 Ga0207703_10000291 3300026035 Bacteria 55245
260 Ga0207703_10006636 3300026035 Bacteria 9232
261 Ga0207703_10048151 3300026035 Unclassified 3439
262 Ga0207703_10121816 3300026035 Bacteria 2240
263 Ga0207703_10195295 3300026035 Bacteria 1795
264 Ga0207678_10466556 3300026067 Unclassified 1099
265 Ga0207708_10255339 3300026075 Unclassified 1414
266 Ga0207641_10005244 3300026088 Bacteria 11081
267 Ga0207641_10208360 3300026088 Bacteria 1807
268 Ga0207641_10294795 3300026088 Bacteria 1530
269 Ga0207648_10476361 3300026089 Bacteria 1140
270 Ga0207648_10508975 3300026089 Bacteria 1102
271 Ga0207676_10001919 3300026095 Bacteria 15191
272 Ga0207676_10022653 3300026095 Bacteria 4621
273 Ga0207676_10088342 3300026095 Unclassified 2537
274 Ga0207676_10161581 3300026095 Bacteria 1941
275 Ga0207676_10191776 3300026095 Bacteria 1799
276 Ga0207674_10593882 3300026116 Unclassified 1070
277 Ga0207674_10643375 3300026116 Unclassified 1024
278 Ga0207675_100370797 3300026118 Unclassified 1406
279 Ga0207675_101054913 3300026118 Bacteria 832
280 Ga0207683_10203156 3300026121 Unclassified 1802
281 Ga0207698_10579732 3300026142 Bacteria 1103
282 Ga0207698_10615977 3300026142 Bacteria 1072
283 Ga0207428_10042886 3300027907 Bacteria 3658
284 Ga0268266_10236529 3300028379 Bacteria 1684
285 Ga0268265_10073933 3300028380 Bacteria 2664
286 Ga0268265_10087964 3300028380 Bacteria 2474
287 Ga0268265_10103195 3300028380 Bacteria 2309
288 Ga0268265_10106217 3300028380 Bacteria 2280
289 Ga0268265_10287282 3300028380 Bacteria 1475
290 Ga0268264_10207256 3300028381 Bacteria 1797
291 Ga0268264_10306722 3300028381 Bacteria 1496
292 Ga0268264_10361413 3300028381 Bacteria 1385
293 Ga0268264_10389388 3300028381 Bacteria 1337
294 Ga0307408_100008229 3300031548 Bacteria 6881
295 Ga0307408_100403866 3300031548 Bacteria 1174
296 Ga0307408_100707507 3300031548 Bacteria 906
297 Ga0307408_101156224 3300031548 Bacteria 720
298 Ga0307405_10031587 3300031731 Bacteria 3119
299 Ga0307405_10055038 3300031731 Bacteria 2488
300 Ga0307405_10426368 3300031731 Bacteria 1045
301 Ga0307413_10003391 3300031824 Bacteria 6701
302 Ga0307413_10224678 3300031824 Bacteria 1374
303 Ga0307413_10279952 3300031824 Bacteria 1254
304 Ga0307410_10000236 3300031852 Bacteria 20825
305 Ga0307410_10007952 3300031852 Bacteria 5846
306 Ga0307410_10065983 3300031852 Bacteria 2491
307 Ga0307410_10496788 3300031852 Bacteria 1003
308 Ga0307410_10602196 3300031852 Bacteria 917
309 Ga0307410_10834050 3300031852 Bacteria 786
310 Ga0307406_10123842 3300031901 Bacteria 1802
311 Ga0307406_10329769 3300031901 Bacteria 1184
312 Ga0307406_10344562 3300031901 Bacteria 1162
313 Ga0307407_10002695 3300031903 Bacteria 7042
314 Ga0307407_10095331 3300031903 Bacteria 1834
315 Ga0307407_10260847 3300031903 Bacteria 1192
316 Ga0307407_10278261 3300031903 Bacteria 1158
317 Ga0307412_10505708 3300031911 Bacteria 1007
318 Ga0307409_100003736 3300031995 Bacteria 8361
319 Ga0307409_100006264 3300031995 Bacteria 6969
320 Ga0307409_100008965 3300031995 Bacteria 6112
321 Ga0307409_100181961 3300031995 Unclassified 1862
322 Ga0307409_100280553 3300031995 Bacteria 1540
323 Ga0307409_100343191 3300031995 Bacteria 1406
324 Ga0307409_100353638 3300031995 Bacteria 1387
325 Ga0307409_100487309 3300031995 Unclassified 1198
326 Ga0307409_100765757 3300031995 Bacteria 970
327 Ga0307416_100004832 3300032002 Bacteria 8196
328 Ga0307416_100055826 3300032002 Unclassified 3183
329 Ga0307416_100181149 3300032002 Unclassified 1975
330 Ga0307416_100414628 3300032002 Bacteria 1389
331 Ga0307416_100433158 3300032002 Bacteria 1363
332 Ga0307416_100709427 3300032002 Unclassified 1096
333 Ga0307416_101105202 3300032002 Unclassified 897
334 Ga0307416_101812630 3300032002 Bacteria 714
335 Ga0307414_10223027 3300032004 Bacteria 1549
336 Ga0307414_10333790 3300032004 Unclassified 1295
337 Ga0307414_10392719 3300032004 Bacteria 1203
338 Ga0307411_10018806 3300032005 Bacteria 3974
339 Ga0307411_10095773 3300032005 Unclassified 2085
340 Ga0307411_10246534 3300032005 Bacteria 1402
341 Ga0307411_10256087 3300032005 Bacteria 1379
342 Ga0307411_10859015 3300032005 Unclassified 803
343 Ga0307415_100013046 3300032126 Bacteria 4834
344 Ga0307415_100092150 3300032126 Unclassified 2197
345 Ga0307415_100125870 3300032126 Bacteria 1931
346 Ga0307415_100155428 3300032126 Bacteria 1766
347 Ga0307415_100231850 3300032126 Bacteria 1487
348 Ga0307415_100472350 3300032126 Bacteria 1090
349 Ga0307415_100584338 3300032126 Bacteria 991
350 Ga0395900_0119131 3300037418 Unclassified 2710
351 Ga0395901_0702977 3300038443 Bacteria 1008
352 Ga0436365_0013216 3300039437 Bacteria 44926
353 Ga0436365_0850018 3300039437 Bacteria 48462
354 Ga0436365_1831733 3300039437 Bacteria 2553
355 Ga0439439_0097395 3300041406 Unclassified 808
356 Ga0451577_0806312 3300042876 Bacteria 848
357 Ga0453684_0715242 3300044712 Bacteria 1087
358 Ga0451576_0092329 3300045051 Bacteria 3148
359 Ga0451576_0672661 3300045051 Bacteria 1088
360 Ga0495628_0824387 3300046516 Bacteria 648
361 Ga0495632_0044694 3300046519 Bacteria 2210
362 Ga0495598_0024149 3300046537 Bacteria 1645
363 Ga0495621_0041342 3300046539 Bacteria 1619
364 Ga0495659_0020926 3300046664 Bacteria 2201
365 Ga0495599_0229387 3300046678 Bacteria 1134
366 Ga0495600_0037802 3300046809 Bacteria 3140
367 Ga0495684_0032826 3300047471 Bacteria 3988
368 Ga0496104_0068156 3300048907 Unclassified 3381
369 Ga0496105_0189915 3300048908 Bacteria 1680
370 Ga0496109_0078810 3300048912 Bacteria 3034
371 Ga0496114_0219864 3300048917 Bacteria 1667
372 Ga0501072_0097258 3300049588 Unclassified 2339
373 Ga0501227_048516 3300049665 Bacteria 1066
374 Ga0501235_018960 3300049669 Bacteria 1526
375 Ga0501221_006445 3300049704 Bacteria 1986
376 Ga0501225_0011355 3300049705 Bacteria 2507
377 nmdc:mga05p37_830340_c1 3300050507 Bacteria 1006
378 nmdc:mga09592_150006_c1 3300050508 Bacteria 2011
379 nmdc:mga0n895_133901_c1 3300050512 Bacteria 2504
380 nmdc:mga0n895_363075_c1 3300050512 Bacteria 1466
381 nmdc:mga0n895_554603_c1 3300050512 Bacteria 1155
382 nmdc:mga0n895_607015_c1 3300050512 Unclassified 1096
383 nmdc:mga0rr50_68969_c1 3300050513 Bacteria 2690
384 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
385 Ga0500577_0014278 3300053142 Bacteria 2451
386 Ga0501084_0348078 3300054114 Unclassified 1252
387 Ga0590077_072526 3300059426 Bacteria 788
388 Ga0307408_100090583
389 SwRhRL3b_contig_313608
390 JGI24034J26672_10000005
391 Ga0065704_10080533
392 Ga0065715_10049854
393 Ga0065707_10098681
394 Ga0065707_10107583
395 Ga0070690_100040543
396 Ga0070690_100147467
397 Ga0070690_100281755
398 Ga0070670_100045903
399 Ga0070670_101343674
400 Ga0070677_10251536
401 Ga0068869_100067582
402 Ga0070666_10100027
403 Ga0070680_100088290
404 Ga0070682_100189641
405 Ga0070689_100168879
406 Ga0070661_100074118
407 Ga0070668_100814530
408 Ga0070671_100196200
409 Ga0070674_100620763
410 Ga0070673_100201785
411 Ga0070673_101185652
412 Ga0070688_100171936
413 Ga0070688_100480057
414 Ga0070659_100060031
415 Ga0070659_100274603
416 Ga0070667_100206863
417 Ga0070703_10000091
418 Ga0070703_10193952
419 Ga0070701_10401257
420 Ga0070705_100256270
421 Ga0070700_100001208
422 Ga0070694_100000775
423 Ga0070694_100016685
424 Ga0070694_100123891
425 Ga0070694_100129086
426 Ga0070708_100130987
427 Ga0070708_100170886
428 Ga0070708_100181189
429 Ga0070663_100343271
430 Ga0070678_100106815
431 Ga0070681_10103834
432 Ga0068867_100512477
433 Ga0070685_10041860
434 Ga0070685_10717405
435 Ga0070706_100061496
436 Ga0070706_100107798
437 Ga0070706_100338028
438 Ga0070707_100028879
439 Ga0070707_100104793
440 Ga0070707_100235019
441 Ga0070707_100300417
442 Ga0070707_100398064
443 Ga0070707_100671379
444 Ga0070698_100000164
445 Ga0070698_100021387
446 Ga0070698_100219153
447 Ga0070698_100472135
448 Ga0070699_100061554
449 Ga0070679_100482927
450 Ga0070697_100201973
451 Ga0068853_100007442
452 Ga0068853_100192535
453 Ga0070672_100461416
454 Ga0070686_100162830
455 Ga0070686_100167152
456 Ga0070686_100655018
457 Ga0070695_100299410
458 Ga0070696_100268868
459 Ga0070693_100306074
460 Ga0070665_100306585
461 Ga0070704_100170324
462 Ga0070704_100685956
463 Ga0068857_100344907
464 Ga0068857_100595217
465 Ga0068857_100668631
466 Ga0068857_100827340
467 Ga0070702_100028916
468 Ga0070702_100332660
469 Ga0070702_100571155
470 Ga0068852_100182180
471 Ga0068852_100697321
472 Ga0068859_100035305
473 Ga0068859_100039222
474 Ga0068859_100120353
475 Ga0068859_100152653
476 Ga0068859_100740975
477 Ga0068864_100013605
478 Ga0068864_100024436
479 Ga0068864_100115731
480 Ga0068864_100172021
481 Ga0068864_100400195
482 Ga0068866_10063655
483 Ga0068861_100221267
484 Ga0068861_100338899
485 Ga0068851_10341095
486 Ga0068863_100018375
487 Ga0068863_100416004
488 Ga0068858_100000026
489 Ga0068858_100014863
490 Ga0068858_100151970
491 Ga0068858_100586400
492 Ga0068860_100041628
493 Ga0068860_100346941
494 Ga0068860_100360765
495 Ga0068860_100386115
496 Ga0068860_100436139
497 Ga0068860_101057300
498 Ga0068862_100039662
499 Ga0068862_100045110
500 Ga0068862_100074866
501 Ga0068862_100119049
502 Ga0068862_100299935
503 Ga0068862_100336516
504 Ga0081539_10054983
505 Ga0081539_10206638
506 Ga0070715_10000018
507 Ga0070716_100000017
508 Ga0070716_100138867
509 Ga0097621_100003941
510 Ga0097621_100576152
511 Ga0068871_100003493
512 Ga0075428_100189967
513 Ga0075433_10087057
514 Ga0075433_10306724
515 Ga0075434_100015765
516 Ga0075434_100375550
517 Ga0075434_100657358
518 Ga0075429_100173639
519 Ga0068865_101070356
520 Ga0097620_100035305
521 Ga0097620_100039224
522 Ga0097620_100120353
523 Ga0097620_100152641
524 Ga0097620_100740975
525 Ga0075435_100080304
526 Ga0099794_10066081
527 Ga0105251_10210718
528 Ga0105251_10256359
529 Ga0105250_10061221
530 Ga0105240_10220408
531 Ga0111539_10116418
532 Ga0105247_10000022
533 Ga0105247_10003696
534 Ga0105247_10222677
535 Ga0105247_10441050
536 Ga0114129_10043671
537 Ga0114129_10277844
538 Ga0114129_10535837
539 Ga0114129_10686020
540 Ga0114129_11386737
541 Ga0105243_10000084
542 Ga0105243_10138210
543 Ga0105241_10038467
544 Ga0105241_10107503
545 Ga0105242_10000229
546 Ga0105248_10068479
547 Ga0105248_10078245
548 Ga0105237_10028594
549 Ga0105237_10165980
550 Ga0105249_10388274
551 Ga0105249_10520367
552 Ga0105239_10235993
553 Ga0105239_10441666
554 Ga0105246_10480065
555 Ga0157373_10023890
556 Ga0157373_10093104
557 Ga0157373_10140330
558 Ga0157373_10523690
559 Ga0157369_10334665
560 Ga0157374_10048751
561 Ga0157378_10030511
562 Ga0157378_10042433
563 Ga0157378_10117303
564 Ga0157378_10212836
565 Ga0163162_10058913
566 Ga0163162_10098628
567 Ga0163162_10258633
568 Ga0163162_10274226
569 Ga0157372_10008691
570 Ga0157372_10057443
571 Ga0157372_10104985
572 Ga0157372_10146186
573 Ga0157372_10590370
574 Ga0157375_10023051
575 Ga0157375_10049694
576 Ga0157375_10673769
577 Ga0157375_10775681
578 Ga0163163_10036597
579 Ga0163163_10579134
580 Ga0163163_11803534
581 Ga0157380_10000627
582 Ga0157380_10208597
583 Ga0182008_10088602
584 Ga0157379_10018901
585 Ga0157379_10070977
586 Ga0163161_10062206
587 Ga0163161_10139080
588 Ga0163161_10286808
589 Ga0163161_10363379
590 Ga0213876_10000268
591 Ga0213876_10102702
592 Ga0207672_1000046
593 Ga0207653_10000034
594 Ga0207642_10009617
595 Ga0207710_10000001
596 Ga0207710_10004588
597 Ga0207680_10173969
598 Ga0207685_10000022
599 Ga0207684_10008995
600 Ga0207684_10105820
601 Ga0207684_10558015
602 Ga0207654_10277851
603 Ga0207707_10010071
604 Ga0207671_10209207
605 Ga0207671_10360846
606 Ga0207662_10133927
607 Ga0207662_10192991
608 Ga0207662_10633039
609 Ga0207652_10428438
610 Ga0207646_10032515
611 Ga0207646_10074897
612 Ga0207646_10135214
613 Ga0207646_10534759
614 Ga0207650_10002493
615 Ga0207650_10460355
616 Ga0207659_10390233
617 Ga0207659_10564081
618 Ga0207644_10002044
619 Ga0207644_10045762
620 Ga0207644_10332964
621 Ga0207644_10355031
622 Ga0207644_10498725
623 Ga0207706_10468599
624 Ga0207686_10000015
625 Ga0207686_10000144
626 Ga0207709_10000043
627 Ga0207709_10673194
628 Ga0207670_10005908
629 Ga0207670_10117804
630 Ga0207669_10039159
631 Ga0207665_10000033
632 Ga0207691_10404179
633 Ga0207711_10009657
634 Ga0207711_10060869
635 Ga0207689_10110659
636 Ga0207661_10519549
637 Ga0207651_11052752
638 Ga0207712_10135811
639 Ga0207712_10248829
640 Ga0207712_10688070
641 Ga0207668_10053464
642 Ga0207668_10361239
643 Ga0207658_10061618
644 Ga0207658_10575707
645 Ga0207677_10229444
646 Ga0207703_10000291
647 Ga0207703_10006636
648 Ga0207703_10048151
649 Ga0207703_10121816
650 Ga0207703_10195295
651 Ga0207678_10466556
652 Ga0207708_10255339
653 Ga0207641_10005244
654 Ga0207641_10208360
655 Ga0207641_10294795
656 Ga0207648_10476361
657 Ga0207648_10508975
658 Ga0207676_10001919
659 Ga0207676_10022653
660 Ga0207676_10088342
661 Ga0207676_10161581
662 Ga0207676_10191776
663 Ga0207674_10593882
664 Ga0207674_10643375
665 Ga0207675_100370797
666 Ga0207675_101054913
667 Ga0207683_10203156
668 Ga0207698_10579732
669 Ga0207698_10615977
670 Ga0207428_10042886
671 Ga0268266_10236529
672 Ga0268265_10073933
673 Ga0268265_10087964
674 Ga0268265_10103195
675 Ga0268265_10106217
676 Ga0268265_10287282
677 Ga0268264_10207256
678 Ga0268264_10306722
679 Ga0268264_10361413
680 Ga0268264_10389388
681 Ga0307408_100008229
682 Ga0307408_100403866
683 Ga0307408_100707507
684 Ga0307408_101156224
685 Ga0307405_10031587
686 Ga0307405_10055038
687 Ga0307405_10426368
688 Ga0307413_10003391
689 Ga0307413_10224678
690 Ga0307413_10279952
691 Ga0307410_10000236
692 Ga0307410_10007952
693 Ga0307410_10065983
694 Ga0307410_10496788
695 Ga0307410_10602196
696 Ga0307410_10834050
697 Ga0307406_10123842
698 Ga0307406_10329769
699 Ga0307406_10344562
700 Ga0307407_10002695
701 Ga0307407_10095331
702 Ga0307407_10260847
703 Ga0307407_10278261
704 Ga0307412_10505708
705 Ga0307409_100003736
706 Ga0307409_100006264
707 Ga0307409_100008965
708 Ga0307409_100181961
709 Ga0307409_100280553
710 Ga0307409_100343191
711 Ga0307409_100353638
712 Ga0307409_100487309
713 Ga0307409_100765757
714 Ga0307416_100004832
715 Ga0307416_100055826
716 Ga0307416_100181149
717 Ga0307416_100414628
718 Ga0307416_100433158
719 Ga0307416_100709427
720 Ga0307416_101105202
721 Ga0307416_101812630
722 Ga0307414_10223027
723 Ga0307414_10333790
724 Ga0307414_10392719
725 Ga0307411_10018806
726 Ga0307411_10095773
727 Ga0307411_10246534
728 Ga0307411_10256087
729 Ga0307411_10859015
730 Ga0307415_100013046
731 Ga0307415_100092150
732 Ga0307415_100125870
733 Ga0307415_100155428
734 Ga0307415_100231850
735 Ga0307415_100472350
736 Ga0307415_100584338
737 Ga0395900_0119131
738 Ga0395901_0702977
739 Ga0436365_0013216
740 Ga0436365_0850018
741 Ga0436365_1831733
742 Ga0439439_0097395
743 Ga0451577_0806312
744 Ga0453684_0715242
745 Ga0451576_0092329
746 Ga0451576_0672661
747 Ga0495628_0824387
748 Ga0495632_0044694
749 Ga0495598_0024149
750 Ga0495621_0041342
751 Ga0495659_0020926
752 Ga0495599_0229387
753 Ga0495600_0037802
754 Ga0495684_0032826
755 Ga0496104_0068156
756 Ga0496105_0189915
757 Ga0496109_0078810
758 Ga0496114_0219864
759 Ga0501072_0097258
760 Ga0501227_048516
761 Ga0501235_018960
762 Ga0501221_006445
763 Ga0501225_0011355
764 nmdc:mga05p37_830340_c1
765 nmdc:mga09592_150006_c1
766 nmdc:mga0n895_133901_c1
767 nmdc:mga0n895_363075_c1
768 nmdc:mga0n895_554603_c1
769 nmdc:mga0n895_607015_c1
770 nmdc:mga0rr50_68969_c1
771 nmdc:mga08x19_13_c1
772 Ga0500577_0014278
773 Ga0501084_0348078
774 Ga0590077_072526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

60

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9518 73 203
7alc-assembly1.cif.gz_B-2 human gch-gfrp stimulatory complex 0.9387 22 203
7alc-assembly1.cif.gz_C-2 human gch-gfrp stimulatory complex 0.938 24 203
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9365 73 203
6z85-assembly1.cif.gz_A inhibitory human gtp cyclohydrolase i - gfrp complex 0.9333 22 203
ID Description Score Start End Superfamily
4uqfG01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9845 21 67 1.10.286.10
1wplF01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9666 22 70 1.10.286.10
1wplG01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9637 22 70 1.10.286.10
1wplH01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9637 22 70 1.10.286.10
1wplA01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9628 22 70 1.10.286.10
ID Description Score Start End GO Terms
AF-A0A350MV80-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.952 21 161 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A0K2QW22-F1-model_v4 deleted 0.9451 22 153
AF-R6Z0E3-F1-model_v4 deleted 0.9399 19 204
AF-B8IWN6-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.9395 23 204 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-U1RN88-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9394 18 159 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654

Map