F430802

General Info

Members Datasets Scaffolds Average Seq Length
387 192 387 160

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10892184|Ga0114129_108921842
Length 188
Sequence LRWCTTRRAAAIGAAGHEEAMARRNSAPRVGVVMGSESDWEIMQHAVAQLAAFGIPHEARVLSAHRTPDDAFAYAEKAAANGLACIIAGAGGAAHLAGVLAAKTILPVLGVPIPSKYLRGEDSLLSTVQMPKGVPVATFAIGEAGAANAGLFAVAMLARSDATLAAKLAEFRAKQAAAIRAATLPPKR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 99.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10171765 3300005328 Bacteria 1403
2 Ga0070683_100082141 3300005329 Bacteria 3017
3 Ga0070690_100274169 3300005330 Bacteria 1201
4 Ga0070690_100527877 3300005330 Bacteria 887
5 Ga0070680_100114533 3300005336 Bacteria 2246
6 Ga0070689_100389689 3300005340 Bacteria 1176
7 Ga0070687_100176544 3300005343 Unclassified 1276
8 Ga0070692_10099594 3300005345 Bacteria 1591
9 Ga0070692_10397833 3300005345 Bacteria 869
10 Ga0070692_11153694 3300005345 Bacteria 549
11 Ga0070668_100627447 3300005347 Bacteria 942
12 Ga0070669_100082311 3300005353 Bacteria 2399
13 Ga0070669_101316686 3300005353 Bacteria 626
14 Ga0070671_100335380 3300005355 Unclassified 1289
15 Ga0070674_100016447 3300005356 Bacteria 4636
16 Ga0070659_100630950 3300005366 Bacteria 923
17 Ga0070703_10003886 3300005406 Bacteria 4229
18 Ga0070701_10090759 3300005438 Bacteria 1673
19 Ga0070705_100143720 3300005440 Bacteria 1574
20 Ga0070705_100438453 3300005440 Bacteria 977
21 Ga0070700_100287346 3300005441 Bacteria 1195
22 Ga0070700_100714997 3300005441 Unclassified 798
23 Ga0070694_100032640 3300005444 Bacteria 3420
24 Ga0070694_100164946 3300005444 Bacteria 1628
25 Ga0070694_100165437 3300005444 Bacteria 1626
26 Ga0070694_100168921 3300005444 Bacteria 1610
27 Ga0070694_100580607 3300005444 Bacteria 901
28 Ga0070708_100032954 3300005445 Bacteria 4498
29 Ga0070708_100068927 3300005445 Bacteria 3180
30 Ga0070708_101254006 3300005445 Bacteria 693
31 Ga0070681_10611819 3300005458 Bacteria 1004
32 Ga0068867_100141406 3300005459 Bacteria 1882
33 Ga0068867_100673705 3300005459 Bacteria 910
34 Ga0070706_100041215 3300005467 Bacteria 4262
35 Ga0070706_100297736 3300005467 Bacteria 1505
36 Ga0070706_100461379 3300005467 Bacteria 1182
37 Ga0070706_100704422 3300005467 Bacteria 936
38 Ga0070706_101041682 3300005467 Bacteria 754
39 Ga0070707_100042587 3300005468 Bacteria 4347
40 Ga0070707_100255788 3300005468 Bacteria 1704
41 Ga0070707_100312486 3300005468 Bacteria 1527
42 Ga0070707_100476066 3300005468 Bacteria 1210
43 Ga0070707_100579358 3300005468 Bacteria 1085
44 Ga0070707_101840974 3300005468 Bacteria 572
45 Ga0070698_100015200 3300005471 Bacteria 8138
46 Ga0070698_100097284 3300005471 Bacteria 2919
47 Ga0070698_100276598 3300005471 Bacteria 1610
48 Ga0070698_100563398 3300005471 Bacteria 1079
49 Ga0070699_100001364 3300005518 Bacteria 22452
50 Ga0070699_100058874 3300005518 Bacteria 3328
51 Ga0070699_100077301 3300005518 Bacteria 2897
52 Ga0070699_100240702 3300005518 Unclassified 1615
53 Ga0070699_100307887 3300005518 Bacteria 1422
54 Ga0070699_100503388 3300005518 Bacteria 1100
55 Ga0070679_100212724 3300005530 Bacteria 1897
56 Ga0070679_100282006 3300005530 Bacteria 1614
57 Ga0070684_100127586 3300005535 Bacteria 2292
58 Ga0070697_100062551 3300005536 Bacteria 3038
59 Ga0070697_100073834 3300005536 Bacteria 2801
60 Ga0070697_100077544 3300005536 Bacteria 2734
61 Ga0070697_100384446 3300005536 Bacteria 1216
62 Ga0070697_100682572 3300005536 Unclassified 905
63 Ga0070697_100782452 3300005536 Bacteria 844
64 Ga0070697_100815249 3300005536 Bacteria 826
65 Ga0068853_101019379 3300005539 Bacteria 797
66 Ga0070695_100027783 3300005545 Bacteria 3507
67 Ga0070695_100059601 3300005545 Bacteria 2472
68 Ga0070695_100131676 3300005545 Bacteria 1724
69 Ga0070695_100250098 3300005545 Bacteria 1290
70 Ga0070695_100848841 3300005545 Bacteria 735
71 Ga0070696_100054686 3300005546 Bacteria 2782
72 Ga0070696_100109770 3300005546 Bacteria 1985
73 Ga0070696_100132335 3300005546 Bacteria 1816
74 Ga0070696_100446503 3300005546 Bacteria 1020
75 Ga0070696_100556253 3300005546 Bacteria 920
76 Ga0070696_100630941 3300005546 Bacteria 867
77 Ga0070693_100297223 3300005547 Bacteria 1087
78 Ga0070704_100056786 3300005549 Bacteria 2781
79 Ga0070704_100182088 3300005549 Bacteria 1681
80 Ga0070704_100195598 3300005549 Bacteria 1628
81 Ga0070704_100213657 3300005549 Bacteria 1564
82 Ga0070704_100247764 3300005549 Unclassified 1461
83 Ga0070704_100604004 3300005549 Bacteria 964
84 Ga0070704_101099207 3300005549 Bacteria 722
85 Ga0070664_100425170 3300005564 Bacteria 1217
86 Ga0068857_100015283 3300005577 Bacteria 6700
87 Ga0068857_100440110 3300005577 Bacteria 1218
88 Ga0068854_100218200 3300005578 Bacteria 1508
89 Ga0070702_100045943 3300005615 Bacteria 2473
90 Ga0068859_100169271 3300005617 Bacteria 2265
91 Ga0068859_100223940 3300005617 Bacteria 1969
92 Ga0068861_100126419 3300005719 Bacteria 2069
93 Ga0068861_100483774 3300005719 Bacteria 1116
94 Ga0068861_100486273 3300005719 Bacteria 1113
95 Ga0068858_100327486 3300005842 Bacteria 1465
96 Ga0075428_100001230 3300006844 Bacteria 27391
97 Ga0075428_100445687 3300006844 Bacteria 1387
98 Ga0075430_100057671 3300006846 Bacteria 3266
99 Ga0075430_100199904 3300006846 Bacteria 1660
100 Ga0075431_100028535 3300006847 Bacteria 5738
101 Ga0075431_100232491 3300006847 Bacteria 1878
102 Ga0075433_10056016 3300006852 Bacteria 3443
103 Ga0075433_10058816 3300006852 Bacteria 3363
104 Ga0075433_10104186 3300006852 Bacteria 2513
105 Ga0075433_10147136 3300006852 Bacteria 2094
106 Ga0075433_10197814 3300006852 Bacteria 1787
107 Ga0075433_10206004 3300006852 Bacteria 1748
108 Ga0075433_11151948 3300006852 Bacteria 674
109 Ga0075434_100000003 3300006871 Bacteria 134839
110 Ga0075434_100470802 3300006871 Bacteria 1278
111 Ga0075434_100597786 3300006871 Unclassified 1122
112 Ga0075434_100659498 3300006871 Bacteria 1064
113 Ga0075434_100760259 3300006871 Bacteria 986
114 Ga0075434_100966990 3300006871 Bacteria 866
115 Ga0075434_100996528 3300006871 Bacteria 852
116 Ga0075429_100005954 3300006880 Bacteria 10530
117 Ga0075429_101495128 3300006880 Bacteria 588
118 Ga0075436_100032095 3300006914 Bacteria 3619
119 Ga0075436_100090465 3300006914 Bacteria 2127
120 Ga0075436_100118426 3300006914 Unclassified 1852
121 Ga0075436_100423576 3300006914 Bacteria 967
122 Ga0075436_100582802 3300006914 Bacteria 823
123 Ga0075436_100961603 3300006914 Bacteria 640
124 Ga0097620_100169270 3300006931 Bacteria 2265
125 Ga0097620_100223939 3300006931 Bacteria 1969
126 Ga0075435_100000614 3300007076 Bacteria 21898
127 Ga0075435_100019695 3300007076 Bacteria 5158
128 Ga0075435_100099323 3300007076 Bacteria 2410
129 Ga0075435_100334351 3300007076 Unclassified 1297
130 Ga0075435_100522810 3300007076 Bacteria 1026
131 Ga0075435_100673502 3300007076 Bacteria 898
132 Ga0075435_101221680 3300007076 Bacteria 658
133 Ga0099794_10008759 3300007265 Bacteria 4214
134 Ga0111539_10289852 3300009094 Bacteria 1905
135 Ga0105245_10061016 3300009098 Bacteria 3398
136 Ga0105245_12005354 3300009098 Bacteria 632
137 Ga0105245_12135555 3300009098 Bacteria 614
138 Ga0114129_10012796 3300009147 Bacteria 11941
139 Ga0114129_10034590 3300009147 Bacteria 7138
140 Ga0114129_10044134 3300009147 Bacteria 6271
141 Ga0114129_10060065 3300009147 Bacteria 5315
142 Ga0114129_10098943 3300009147 Bacteria 4037
143 Ga0114129_10130479 3300009147 Bacteria 3452
144 Ga0114129_10137414 3300009147 Bacteria 3352
145 Ga0114129_10160489 3300009147 Bacteria 3071
146 Ga0114129_10300709 3300009147 Bacteria 2139
147 Ga0114129_10892184 3300009147 Bacteria 1127
148 Ga0105243_10126389 3300009148 Bacteria 2164
149 Ga0105243_10698924 3300009148 Bacteria 988
150 Ga0105243_11682750 3300009148 Bacteria 663
151 Ga0105242_10016961 3300009176 Bacteria 5668
152 Ga0105242_10078423 3300009176 Bacteria 2757
153 Ga0105242_10540079 3300009176 Bacteria 1116
154 Ga0105248_10063580 3300009177 Bacteria 4143
155 Ga0105249_10606237 3300009553 Bacteria 1150
156 Ga0105249_10773346 3300009553 Bacteria 1023
157 Ga0157369_10568791 3300013105 Bacteria 1171
158 Ga0157378_10566166 3300013297 Unclassified 1144
159 Ga0157378_10605716 3300013297 Bacteria 1107
160 Ga0157380_10009190 3300014326 Bacteria 7072
161 Ga0157380_10903968 3300014326 Bacteria 909
162 Ga0157377_10048518 3300014745 Bacteria 2383
163 Ga0207653_10000388 3300025885 Bacteria 19982
164 Ga0207642_10102257 3300025899 Bacteria 1441
165 Ga0207688_10101503 3300025901 Unclassified 1662
166 Ga0207647_10369925 3300025904 Bacteria 810
167 Ga0207645_10194390 3300025907 Bacteria 1334
168 Ga0207684_10000013 3300025910 Bacteria 443468
169 Ga0207684_10015911 3300025910 Bacteria 6465
170 Ga0207684_10105754 3300025910 Bacteria 2407
171 Ga0207684_10141218 3300025910 Bacteria 2070
172 Ga0207684_11215118 3300025910 Bacteria 624
173 Ga0207707_10288678 3300025912 Bacteria 1419
174 Ga0207707_10994376 3300025912 Bacteria 689
175 Ga0207663_10867193 3300025916 Bacteria 721
176 Ga0207660_10035840 3300025917 Bacteria 3447
177 Ga0207660_10108234 3300025917 Bacteria 2087
178 Ga0207662_10006022 3300025918 Bacteria 6518
179 Ga0207662_10050039 3300025918 Bacteria 2481
180 Ga0207662_10066492 3300025918 Bacteria 2172
181 Ga0207662_10683961 3300025918 Bacteria 718
182 Ga0207652_10064403 3300025921 Bacteria 3172
183 Ga0207646_10000254 3300025922 Bacteria 72539
184 Ga0207646_10001660 3300025922 Bacteria 27175
185 Ga0207646_10002550 3300025922 Bacteria 21519
186 Ga0207646_10005942 3300025922 Bacteria 12734
187 Ga0207646_10292735 3300025922 Bacteria 1471
188 Ga0207646_10344184 3300025922 Bacteria 1347
189 Ga0207646_10582775 3300025922 Bacteria 1005
190 Ga0207681_10321487 3300025923 Bacteria 1231
191 Ga0207690_10444845 3300025932 Bacteria 1041
192 Ga0207686_10004433 3300025934 Bacteria 7526
193 Ga0207686_10269577 3300025934 Bacteria 1252
194 Ga0207709_10034779 3300025935 Bacteria 2973
195 Ga0207670_10519821 3300025936 Bacteria 969
196 Ga0207669_10022892 3300025937 Bacteria 3326
197 Ga0207711_10214779 3300025941 Bacteria 1758
198 Ga0207689_10101686 3300025942 Bacteria 2361
199 Ga0207689_10286513 3300025942 Bacteria 1364
200 Ga0207661_10105175 3300025944 Bacteria 2378
201 Ga0207679_10200616 3300025945 Bacteria 1666
202 Ga0207667_10296800 3300025949 Bacteria 1651
203 Ga0207651_10569512 3300025960 Bacteria 987
204 Ga0207712_10216185 3300025961 Bacteria 1530
205 Ga0207712_10815026 3300025961 Bacteria 821
206 Ga0207712_11093079 3300025961 Bacteria 710
207 Ga0207668_10765644 3300025972 Bacteria 853
208 Ga0207677_10109231 3300026023 Bacteria 2056
209 Ga0207639_10581668 3300026041 Bacteria 1031
210 Ga0207708_10037202 3300026075 Bacteria 3707
211 Ga0207708_10123892 3300026075 Bacteria 2016
212 Ga0207708_10331160 3300026075 Bacteria 1245
213 Ga0207648_10026223 3300026089 Bacteria 5180
214 Ga0207648_10188508 3300026089 Bacteria 1827
215 Ga0207648_10664053 3300026089 Bacteria 964
216 Ga0207674_10002294 3300026116 Bacteria 24251
217 Ga0207675_100023658 3300026118 Bacteria 5714
218 Ga0207675_100030262 3300026118 Bacteria 5042
219 Ga0207675_100115297 3300026118 Bacteria 2539
220 Ga0207675_100558318 3300026118 Bacteria 1145
221 Ga0207428_10226396 3300027907 Bacteria 1400
222 Ga0268265_10107889 3300028380 Bacteria 2265
223 Ga0268265_10154390 3300028380 Bacteria 1941
224 Ga0268264_10114564 3300028381 Bacteria 2367
225 Ga0265336_10024107 3300028666 Bacteria 1925
226 Ga0265324_10136315 3300029957 Bacteria 833
227 Ga0265330_10022434 3300031235 Bacteria 2872
228 Ga0265329_10005431 3300031242 Bacteria 5149
229 Ga0265331_10020657 3300031250 Bacteria 3378
230 Ga0265331_10151470 3300031250 Bacteria 1053
231 Ga0265316_10078329 3300031344 Bacteria 2537
232 Ga0307408_100312810 3300031548 Bacteria 1320
233 Ga0265313_10016145 3300031595 Bacteria 4308
234 Ga0316575_10012758 3300031665 Bacteria 3131
235 Ga0316575_10024359 3300031665 Bacteria 2343
236 Ga0316579_10009386 3300031691 Bacteria 4112
237 Ga0316579_10183648 3300031691 Bacteria 1011
238 Ga0265314_10064745 3300031711 Bacteria 2473
239 Ga0265342_10267252 3300031712 Bacteria 909
240 Ga0316576_10357778 3300031727 Bacteria 1086
241 Ga0316578_10047971 3300031728 Bacteria 2493
242 Ga0316577_10089205 3300031733 Bacteria 1726
243 Ga0316583_10009356 3300032133 Bacteria 3528
244 Ga0373928_0227450 3300035084 Bacteria 548
245 Ga0373944_0056455 3300035089 Bacteria 1250
246 Ga0373936_0004501 3300035113 Bacteria 5274
247 Ga0373936_0061044 3300035113 Bacteria 1539
248 Ga0373953_0142796 3300035117 Bacteria 1024
249 Ga0373954_0133395 3300035118 Bacteria 1210
250 Ga0373954_0245706 3300035118 Bacteria 881
251 Ga0373957_0070751 3300035120 Bacteria 1364
252 Ga0373943_0013091 3300035170 Bacteria 3742
253 Ga0373955_0024236 3300035172 Bacteria 3101
254 Ga0316574_0085429 3300035398 Bacteria 2008
255 Ga0373931_0061246 3300035691 Bacteria 2029
256 Ga0373931_0072391 3300035691 Bacteria 1885
257 Ga0373935_0012090 3300035692 Bacteria 5190
258 Ga0373935_0404629 3300035692 Bacteria 981
259 Ga0373927_0004370 3300035695 Bacteria 9913
260 Ga0373927_0213047 3300035695 Bacteria 1269
261 Ga0373933_0005227 3300035724 Bacteria 7081
262 Ga0373937_0462201 3300036401 Bacteria 1205
263 Ga0316582_0019082 3300036647 Bacteria 4006
264 Ga0316582_0151059 3300036647 Bacteria 1570
265 Ga0316582_0153153 3300036647 Bacteria 1559
266 Ga0316584_0029803 3300036712 Bacteria 4029
267 Ga0373925_0405913 3300037068 Bacteria 1112
268 Ga0373925_0437239 3300037068 Bacteria 1070
269 Ga0395899_0159805 3300037312 Bacteria 1593
270 Ga0395900_0089252 3300037418 Bacteria 3169
271 Ga0395901_0188840 3300038443 Bacteria 2161
272 Ga0439461_0041984 3300041410 Bacteria 991
273 Ga0439441_039394 3300042001 Bacteria 942
274 Ga0439441_111105 3300042001 Bacteria 622
275 Ga0439446_0004419 3300042156 Bacteria 3567
276 Ga0439435_0005380 3300042436 Bacteria 2814
277 Ga0439459_0060953 3300042438 Bacteria 852
278 Ga0451577_0932699 3300042876 Unclassified 781
279 Ga0453683_0527783 3300044673 Bacteria 767
280 Ga0453684_0096611 3300044712 Unclassified 3629
281 Ga0451576_0003305 3300045051 Bacteria 22388
282 Ga0451576_0524242 3300045051 Bacteria 1245
283 Ga0451576_0630836 3300045051 Bacteria 1126
284 Ga0451576_0807434 3300045051 Bacteria 985
285 Ga0451576_2090681 3300045051 Bacteria 582
286 Ga0495603_0009490 3300046455 Bacteria 5879
287 Ga0495651_0216272 3300046462 Bacteria 1330
288 Ga0495580_0019651 3300046472 Bacteria 5016
289 Ga0495639_0075514 3300046475 Bacteria 1562
290 Ga0495664_0187551 3300046477 Bacteria 1254
291 Ga0495630_0285971 3300046517 Bacteria 1260
292 Ga0495644_0143231 3300046523 Bacteria 913
293 Ga0495621_0116342 3300046539 Bacteria 1030
294 Ga0495656_0682910 3300046615 Bacteria 552
295 Ga0495657_0239625 3300046675 Bacteria 1095
296 Ga0495674_0216043 3300047319 Bacteria 1587
297 Ga0496112_0324129 3300048915 Bacteria 1485
298 Ga0496112_1407932 3300048915 Unclassified 612
299 Ga0501033_0015444 3300049570 Bacteria 5793
300 Ga0501033_0078052 3300049570 Bacteria 2430
301 Ga0501036_0005876 3300049572 Bacteria 9940
302 Ga0501036_0148791 3300049572 Bacteria 1975
303 Ga0501037_0209143 3300049573 Bacteria 1376
304 Ga0501038_0001150 3300049574 Bacteria 23992
305 Ga0501039_0005097 3300049575 Bacteria 9952
306 Ga0501039_0020287 3300049575 Bacteria 5094
307 Ga0501040_0000302 3300049576 Bacteria 28825
308 Ga0501040_0021318 3300049576 Bacteria 4326
309 Ga0501041_0000776 3300049577 Bacteria 17119
310 Ga0501041_0245101 3300049577 Bacteria 1126
311 Ga0501042_0004472 3300049578 Bacteria 8914
312 Ga0501042_0041136 3300049578 Bacteria 3286
313 Ga0501043_0446248 3300049579 Bacteria 973
314 Ga0501043_0771362 3300049579 Bacteria 697
315 Ga0501046_0000992 3300049580 Bacteria 27750
316 Ga0501048_0002096 3300049582 Bacteria 15203
317 Ga0501048_0040147 3300049582 Bacteria 3354
318 Ga0501067_0096143 3300049583 Bacteria 1645
319 Ga0501067_0201363 3300049583 Bacteria 1109
320 Ga0501068_0003789 3300049584 Bacteria 8195
321 Ga0501068_0069490 3300049584 Bacteria 2148
322 Ga0501069_0130087 3300049585 Unclassified 1441
323 Ga0501070_0024831 3300049586 Bacteria 5026
324 Ga0501071_0106871 3300049587 Bacteria 2066
325 Ga0501071_0214573 3300049587 Bacteria 1447
326 Ga0501072_0002409 3300049588 Bacteria 14027
327 Ga0501072_0017594 3300049588 Bacteria 5496
328 Ga0501072_0326254 3300049588 Bacteria 1220
329 Ga0501073_0319531 3300049589 Bacteria 1071
330 Ga0501074_0005553 3300049590 Bacteria 9069
331 Ga0501074_0338845 3300049590 Bacteria 1067
332 Ga0501075_0000045 3300049591 Bacteria 50874
333 Ga0501075_0006755 3300049591 Bacteria 7918
334 Ga0501076_0000394 3300049592 Bacteria 27363
335 Ga0501076_0017733 3300049592 Bacteria 5413
336 Ga0501077_0000629 3300049593 Bacteria 21374
337 Ga0501077_0022161 3300049593 Bacteria 4023
338 Ga0501079_0003366 3300049741 Bacteria 11728
339 Ga0501079_0098474 3300049741 Bacteria 2266
340 Ga0501080_0016075 3300049742 Bacteria 6908
341 Ga0501080_0048047 3300049742 Bacteria 3973
342 Ga0501081_0002657 3300049743 Bacteria 11303
343 Ga0501081_0009292 3300049743 Bacteria 6404
344 Ga0501035_0010634 3300049822 Bacteria 8521
345 Ga0501035_0581831 3300049822 Bacteria 914
346 Ga0501045_0019880 3300049824 Bacteria 4793
347 nmdc:mga05p37_15555_c2 3300050507 Bacteria 7678
348 nmdc:mga05p37_1968283_c1 3300050507 Bacteria 554
349 nmdc:mga05p37_335106_c1 3300050507 Bacteria 1786
350 nmdc:mga05p37_355409_c1 3300050507 Bacteria 1724
351 nmdc:mga05p37_63715_c1 3300050507 Bacteria 4537
352 nmdc:mga09592_30795_c1 3300050508 Bacteria 4467
353 nmdc:mga0qj67_11376_c1 3300050509 Bacteria 6667
354 nmdc:mga0qj67_143451_c1 3300050509 Bacteria 1936
355 nmdc:mga0qj67_46079_c1 3300050509 Bacteria 3441
356 nmdc:mga06r32_156714_c1 3300050510 Bacteria 2258
357 nmdc:mga06r32_76213_c1 3300050510 Bacteria 3256
358 nmdc:mga08y16_608906_c1 3300050511 Bacteria 1100
359 nmdc:mga0n895_1331613_c1 3300050512 Bacteria 688
360 nmdc:mga0n895_134581_c1 3300050512 Unclassified 2497
361 nmdc:mga0n895_139522_c1 3300050512 Bacteria 2452
362 nmdc:mga0n895_1874966_c1 3300050512 Bacteria 559
363 nmdc:mga0n895_251218_c1 3300050512 Bacteria 1795
364 nmdc:mga0n895_493106_c1 3300050512 Unclassified 1235
365 nmdc:mga0rr50_110792_c1 3300050513 Bacteria 2172
366 nmdc:mga0rr50_190364_c1 3300050513 Bacteria 1681
367 nmdc:mga0rr50_19344_c1 3300050513 Bacteria 4594
368 nmdc:mga0rr50_305187_c1 3300050513 Bacteria 1332
369 nmdc:mga0rr50_409747_c1 3300050513 Unclassified 1146
370 nmdc:mga0rr50_72055_c1 3300050513 Bacteria 2638
371 nmdc:mga08x19_13150_c1 3300050514 Bacteria 4998
372 nmdc:mga08x19_256473_c1 3300050514 Bacteria 1208
373 nmdc:mga08x19_286426_c1 3300050514 Bacteria 1142
374 nmdc:mga08x19_62133_c1 3300050514 Bacteria 2421
375 nmdc:mga0a205_115826_c1 3300050515 Bacteria 2579
376 nmdc:mga0a205_132098_c1 3300050515 Bacteria 2397
377 nmdc:mga0a205_185785_c1 3300050515 Unclassified 1971
378 nmdc:mga0a205_209084_c1 3300050515 Bacteria 1840
379 nmdc:mga0a205_529231_c1 3300050515 Bacteria 1035
380 nmdc:mga0a205_69242_c1 3300050515 Bacteria 3408
381 Ga0501084_0031298 3300054114 Bacteria 4449
382 Ga0501084_0372549 3300054114 Bacteria 1206
383 Ga0590077_054893 3300059426 Bacteria 898
384 Ga0501082_0009730 3300060353 Bacteria 8281
385 Ga0501082_0123685 3300060353 Bacteria 2243
386 Ga0530510_0000797 3300061734 Bacteria 20554
387 Ga0530510_0013765 3300061734 Bacteria 5695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100001230 Ga0075428_1000012306 144
2 3300006846 Ga0075430_100199904 Ga0075430_1001999043 144
3 3300045051 Ga0451576_0003305 Ga0451576_0003305_11680_12141 144
4 3300050509 nmdc:mga0qj67_46079_c1 nmdc:mga0qj67_46079_c1_2128_2586 144
5 3300005440 Ga0070705_100143720 Ga0070705_1001437202 147
6 3300005444 Ga0070694_100165437 Ga0070694_1001654372 147
7 3300005444 Ga0070694_100580607 Ga0070694_1005806071 147
8 3300005459 Ga0068867_100141406 Ga0068867_1001414062 147
9 3300005471 Ga0070698_100563398 Ga0070698_1005633982 147
10 3300005518 Ga0070699_100001364 Ga0070699_10000136411 147
11 3300005545 Ga0070695_100027783 Ga0070695_1000277833 147
12 3300005545 Ga0070695_100131676 Ga0070695_1001316763 147
13 3300005545 Ga0070695_100848841 Ga0070695_1008488412 147
14 3300005546 Ga0070696_100446503 Ga0070696_1004465031 147
15 3300005546 Ga0070696_100556253 Ga0070696_1005562532 147
16 3300005546 Ga0070696_100630941 Ga0070696_1006309412 147
17 3300005549 Ga0070704_100056786 Ga0070704_1000567863 147
18 3300005549 Ga0070704_100604004 Ga0070704_1006040042 147
19 3300005615 Ga0070702_100045943 Ga0070702_1000459432 147
20 3300005617 Ga0068859_100223940 Ga0068859_1002239402 147
21 3300006846 Ga0075430_100057671 Ga0075430_1000576714 147
22 3300006847 Ga0075431_100232491 Ga0075431_1002324912 147
23 3300006852 Ga0075433_10058816 Ga0075433_100588164 147
24 3300006871 Ga0075434_100000003 Ga0075434_1000000032 147
25 3300006871 Ga0075434_100659498 Ga0075434_1006594982 147
26 3300006880 Ga0075429_101495128 Ga0075429_1014951282 147
27 3300006914 Ga0075436_100032095 Ga0075436_1000320954 147
28 3300006931 Ga0097620_100223939 Ga0097620_1002239392 147
29 3300007076 Ga0075435_100000614 Ga0075435_1000006142 147
30 3300007076 Ga0075435_100099323 Ga0075435_1000993234 147
31 3300007076 Ga0075435_100673502 Ga0075435_1006735022 147
32 3300007076 Ga0075435_101221680 Ga0075435_1012216802 147
33 3300007265 Ga0099794_10008759 Ga0099794_100087594 147
34 3300009098 Ga0105245_10061016 Ga0105245_100610162 147
35 3300009176 Ga0105242_10016961 Ga0105242_100169616 147
36 3300025918 Ga0207662_10066492 Ga0207662_100664922 147
37 3300025934 Ga0207686_10004433 Ga0207686_100044338 147
38 3300025936 Ga0207670_10519821 Ga0207670_105198211 147
39 3300025949 Ga0207667_10296800 Ga0207667_102968002 147
40 3300026023 Ga0207677_10109231 Ga0207677_101092312 147
41 3300027907 Ga0207428_10226396 Ga0207428_102263962 147
42 3300028380 Ga0268265_10107889 Ga0268265_101078892 147
43 3300028381 Ga0268264_10114564 Ga0268264_101145642 147
44 3300031242 Ga0265329_10005431 Ga0265329_100054312 147
45 3300031250 Ga0265331_10151470 Ga0265331_101514702 147
46 3300031548 Ga0307408_100312810 Ga0307408_1003128102 147
47 3300031595 Ga0265313_10016145 Ga0265313_100161452 147
48 3300031711 Ga0265314_10064745 Ga0265314_100647452 147
49 3300031712 Ga0265342_10267252 Ga0265342_102672522 147
50 3300035084 Ga0373928_0227450 Ga0373928_0227450_71_535 147
51 3300035089 Ga0373944_0056455 Ga0373944_0056455_160_639 147
52 3300035113 Ga0373936_0004501 Ga0373936_0004501_3535_4014 147
53 3300035113 Ga0373936_0061044 Ga0373936_0061044_836_1315 147
54 3300035117 Ga0373953_0142796 Ga0373953_0142796_10_474 147
55 3300035120 Ga0373957_0070751 Ga0373957_0070751_310_789 147
56 3300035170 Ga0373943_0013091 Ga0373943_0013091_1154_1633 147
57 3300035172 Ga0373955_0024236 Ga0373955_0024236_1823_2302 147
58 3300035691 Ga0373931_0072391 Ga0373931_0072391_819_1307 147
59 3300035692 Ga0373935_0012090 Ga0373935_0012090_764_1243 147
60 3300035692 Ga0373935_0404629 Ga0373935_0404629_49_528 147
61 3300035724 Ga0373933_0005227 Ga0373933_0005227_2617_3096 147
62 3300037068 Ga0373925_0405913 Ga0373925_0405913_609_1088 147
63 3300041410 Ga0439461_0041984 Ga0439461_0041984_383_862 147
64 3300042001 Ga0439441_039394 Ga0439441_039394_37_525 147
65 3300042156 Ga0439446_0004419 Ga0439446_0004419_973_1452 147
66 3300042436 Ga0439435_0005380 Ga0439435_0005380_2068_2547 147
67 3300042438 Ga0439459_0060953 Ga0439459_0060953_288_776 147
68 3300042876 Ga0451577_0932699 Ga0451577_0932699_190_702 147
69 3300044712 Ga0453684_0096611 Ga0453684_0096611_2988_3500 147
70 3300045051 Ga0451576_0630836 Ga0451576_0630836_143_631 147
71 3300045051 Ga0451576_0807434 Ga0451576_0807434_442_954 147
72 3300045051 Ga0451576_2090681 Ga0451576_2090681_42_530 147
73 3300046455 Ga0495603_0009490 Ga0495603_0009490_3990_4469 147
74 3300046462 Ga0495651_0216272 Ga0495651_0216272_471_950 147
75 3300046472 Ga0495580_0019651 Ga0495580_0019651_728_1207 147
76 3300046475 Ga0495639_0075514 Ga0495639_0075514_35_514 147
77 3300046477 Ga0495664_0187551 Ga0495664_0187551_430_909 147
78 3300046517 Ga0495630_0285971 Ga0495630_0285971_566_1045 147
79 3300046523 Ga0495644_0143231 Ga0495644_0143231_171_650 147
80 3300046539 Ga0495621_0116342 Ga0495621_0116342_376_864 147
81 3300046615 Ga0495656_0682910 Ga0495656_0682910_62_541 147
82 3300046675 Ga0495657_0239625 Ga0495657_0239625_295_774 147
83 3300047319 Ga0495674_0216043 Ga0495674_0216043_608_1087 147
84 3300049570 Ga0501033_0015444 Ga0501033_0015444_852_1331 147
85 3300049570 Ga0501033_0078052 Ga0501033_0078052_1548_2027 147
86 3300049572 Ga0501036_0005876 Ga0501036_0005876_5788_6267 147
87 3300049572 Ga0501036_0148791 Ga0501036_0148791_138_617 147
88 3300049573 Ga0501037_0209143 Ga0501037_0209143_256_735 147
89 3300049574 Ga0501038_0001150 Ga0501038_0001150_4275_4754 147
90 3300049575 Ga0501039_0005097 Ga0501039_0005097_2175_2654 147
91 3300049575 Ga0501039_0020287 Ga0501039_0020287_4416_4895 147
92 3300049576 Ga0501040_0000302 Ga0501040_0000302_3459_3938 147
93 3300049576 Ga0501040_0021318 Ga0501040_0021318_3576_4055 147
94 3300049577 Ga0501041_0000776 Ga0501041_0000776_7018_7497 147
95 3300049577 Ga0501041_0245101 Ga0501041_0245101_185_664 147
96 3300049578 Ga0501042_0004472 Ga0501042_0004472_4815_5294 147
97 3300049578 Ga0501042_0041136 Ga0501042_0041136_424_903 147
98 3300049579 Ga0501043_0446248 Ga0501043_0446248_274_753 147
99 3300049579 Ga0501043_0771362 Ga0501043_0771362_28_507 147
100 3300049580 Ga0501046_0000992 Ga0501046_0000992_20272_20751 147
101 3300049582 Ga0501048_0002096 Ga0501048_0002096_12083_12562 147
102 3300049582 Ga0501048_0040147 Ga0501048_0040147_2045_2524 147
103 3300049584 Ga0501068_0003789 Ga0501068_0003789_2445_2924 147
104 3300049586 Ga0501070_0024831 Ga0501070_0024831_314_793 147
105 3300049587 Ga0501071_0106871 Ga0501071_0106871_672_1151 147
106 3300049587 Ga0501071_0214573 Ga0501071_0214573_659_1138 147
107 3300049588 Ga0501072_0002409 Ga0501072_0002409_6265_6744 147
108 3300049588 Ga0501072_0017594 Ga0501072_0017594_4414_4893 147
109 3300049588 Ga0501072_0326254 Ga0501072_0326254_460_939 147
110 3300049589 Ga0501073_0319531 Ga0501073_0319531_272_751 147
111 3300049590 Ga0501074_0005553 Ga0501074_0005553_1423_1902 147
112 3300049590 Ga0501074_0338845 Ga0501074_0338845_104_583 147
113 3300049591 Ga0501075_0000045 Ga0501075_0000045_30817_31296 147
114 3300049591 Ga0501075_0006755 Ga0501075_0006755_2530_3009 147
115 3300049592 Ga0501076_0000394 Ga0501076_0000394_22833_23312 147
116 3300049592 Ga0501076_0017733 Ga0501076_0017733_4282_4761 147
117 3300049593 Ga0501077_0000629 Ga0501077_0000629_8471_8950 147
118 3300049593 Ga0501077_0022161 Ga0501077_0022161_523_1002 147
119 3300049741 Ga0501079_0003366 Ga0501079_0003366_6912_7391 147
120 3300049741 Ga0501079_0098474 Ga0501079_0098474_1620_2099 147
121 3300049742 Ga0501080_0016075 Ga0501080_0016075_1725_2204 147
122 3300049742 Ga0501080_0048047 Ga0501080_0048047_802_1281 147
123 3300049743 Ga0501081_0002657 Ga0501081_0002657_7076_7555 147
124 3300049743 Ga0501081_0009292 Ga0501081_0009292_2564_3043 147
125 3300049822 Ga0501035_0010634 Ga0501035_0010634_2645_3124 147
126 3300049822 Ga0501035_0581831 Ga0501035_0581831_115_594 147
127 3300049824 Ga0501045_0019880 Ga0501045_0019880_53_532 147
128 3300050509 nmdc:mga0qj67_11376_c1 nmdc:mga0qj67_11376_c1_1634_2113 147
129 3300050509 nmdc:mga0qj67_143451_c1 nmdc:mga0qj67_143451_c1_889_1368 147
130 3300050510 nmdc:mga06r32_76213_c1 nmdc:mga06r32_76213_c1_1797_2276 147
131 3300050512 nmdc:mga0n895_139522_c1 nmdc:mga0n895_139522_c1_686_1165 147
132 3300050512 nmdc:mga0n895_1874966_c1 nmdc:mga0n895_1874966_c1_16_480 147
133 3300050512 nmdc:mga0n895_251218_c1 nmdc:mga0n895_251218_c1_1097_1576 147
134 3300050513 nmdc:mga0rr50_110792_c1 nmdc:mga0rr50_110792_c1_865_1344 147
135 3300050513 nmdc:mga0rr50_190364_c1 nmdc:mga0rr50_190364_c1_1146_1625 147
136 3300050513 nmdc:mga0rr50_19344_c1 nmdc:mga0rr50_19344_c1_3306_3797 147
137 3300050514 nmdc:mga08x19_256473_c1 nmdc:mga08x19_256473_c1_478_957 147
138 3300050515 nmdc:mga0a205_132098_c1 nmdc:mga0a205_132098_c1_1555_2034 147
139 3300050515 nmdc:mga0a205_69242_c1 nmdc:mga0a205_69242_c1_380_871 147
140 3300054114 Ga0501084_0031298 Ga0501084_0031298_3404_3883 147
141 3300054114 Ga0501084_0372549 Ga0501084_0372549_85_564 147
142 3300059426 Ga0590077_054893 Ga0590077_054893_258_737 147
143 3300060353 Ga0501082_0009730 Ga0501082_0009730_2523_3002 147
144 3300060353 Ga0501082_0123685 Ga0501082_0123685_1539_2018 147
145 3300061734 Ga0530510_0000797 Ga0530510_0000797_15748_16227 147
146 3300061734 Ga0530510_0013765 Ga0530510_0013765_4454_4933 147
147 3300005329 Ga0070683_100082141 Ga0070683_1000821413 148
148 3300005535 Ga0070684_100127586 Ga0070684_1001275862 148
149 3300005719 Ga0068861_100483774 Ga0068861_1004837742 148
150 3300005842 Ga0068858_100327486 Ga0068858_1003274862 148
151 3300006914 Ga0075436_100961603 Ga0075436_1009616031 148
152 3300009553 Ga0105249_10606237 Ga0105249_106062372 148
153 3300025944 Ga0207661_10105175 Ga0207661_101051753 148
154 3300025961 Ga0207712_10815026 Ga0207712_108150261 148
155 3300025972 Ga0207668_10765644 Ga0207668_107656441 148
156 3300026089 Ga0207648_10664053 Ga0207648_106640531 148
157 3300026118 Ga0207675_100023658 Ga0207675_1000236584 148
158 3300048915 Ga0496112_0324129 Ga0496112_0324129_912_1400 148
159 3300005345 Ga0070692_10397833 Ga0070692_103978331 149
160 3300005347 Ga0070668_100627447 Ga0070668_1006274471 149
161 3300005353 Ga0070669_100082311 Ga0070669_1000823112 149
162 3300005356 Ga0070674_100016447 Ga0070674_1000164475 149
163 3300005441 Ga0070700_100287346 Ga0070700_1002873462 149
164 3300005441 Ga0070700_100714997 Ga0070700_1007149971 149
165 3300005444 Ga0070694_100168921 Ga0070694_1001689212 149
166 3300005445 Ga0070708_101254006 Ga0070708_1012540061 149
167 3300005459 Ga0068867_100673705 Ga0068867_1006737051 149
168 3300005468 Ga0070707_100255788 Ga0070707_1002557881 149
169 3300005468 Ga0070707_100476066 Ga0070707_1004760662 149
170 3300005536 Ga0070697_100815249 Ga0070697_1008152492 149
171 3300005539 Ga0068853_101019379 Ga0068853_1010193791 149
172 3300005545 Ga0070695_100250098 Ga0070695_1002500983 149
173 3300005549 Ga0070704_100182088 Ga0070704_1001820882 149
174 3300005719 Ga0068861_100486273 Ga0068861_1004862732 149
175 3300006852 Ga0075433_10104186 Ga0075433_101041862 149
176 3300006914 Ga0075436_100090465 Ga0075436_1000904652 149
177 3300006914 Ga0075436_100582802 Ga0075436_1005828022 149
178 3300009098 Ga0105245_12135555 Ga0105245_121355551 149
179 3300009147 Ga0114129_10044134 Ga0114129_100441342 149
180 3300009147 Ga0114129_10098943 Ga0114129_100989435 149
181 3300009147 Ga0114129_10892184 Ga0114129_108921842 149
182 3300009148 Ga0105243_10698924 Ga0105243_106989241 149
183 3300009176 Ga0105242_10540079 Ga0105242_105400791 149
184 3300009177 Ga0105248_10063580 Ga0105248_100635803 149
185 3300013105 Ga0157369_10568791 Ga0157369_105687912 149
186 3300014326 Ga0157380_10009190 Ga0157380_100091902 149
187 3300025899 Ga0207642_10102257 Ga0207642_101022571 149
188 3300025916 Ga0207663_10867193 Ga0207663_108671932 149
189 3300025934 Ga0207686_10269577 Ga0207686_102695771 149
190 3300025937 Ga0207669_10022892 Ga0207669_100228922 149
191 3300025941 Ga0207711_10214779 Ga0207711_102147792 149
192 3300025942 Ga0207689_10286513 Ga0207689_102865131 149
193 3300025961 Ga0207712_10216185 Ga0207712_102161851 149
194 3300026041 Ga0207639_10581668 Ga0207639_105816682 149
195 3300026075 Ga0207708_10037202 Ga0207708_100372021 149
196 3300026075 Ga0207708_10331160 Ga0207708_103311602 149
197 3300026089 Ga0207648_10026223 Ga0207648_100262232 149
198 3300026118 Ga0207675_100558318 Ga0207675_1005583182 149
199 3300028666 Ga0265336_10024107 Ga0265336_100241072 149
200 3300029957 Ga0265324_10136315 Ga0265324_101363151 149
201 3300031235 Ga0265330_10022434 Ga0265330_100224345 149
202 3300031250 Ga0265331_10020657 Ga0265331_100206573 149
203 3300031344 Ga0265316_10078329 Ga0265316_100783293 149
204 3300031665 Ga0316575_10012758 Ga0316575_100127582 149
205 3300031665 Ga0316575_10024359 Ga0316575_100243593 149
206 3300031691 Ga0316579_10009386 Ga0316579_100093863 149
207 3300031691 Ga0316579_10183648 Ga0316579_101836482 149
208 3300031727 Ga0316576_10357778 Ga0316576_103577781 149
209 3300031728 Ga0316578_10047971 Ga0316578_100479713 149
210 3300031733 Ga0316577_10089205 Ga0316577_100892052 149
211 3300032133 Ga0316583_10009356 Ga0316583_100093562 149
212 3300035118 Ga0373954_0133395 Ga0373954_0133395_186_668 149
213 3300035118 Ga0373954_0245706 Ga0373954_0245706_87_557 149
214 3300035398 Ga0316574_0085429 Ga0316574_0085429_113_577 149
215 3300035691 Ga0373931_0061246 Ga0373931_0061246_1104_1613 149
216 3300035695 Ga0373927_0004370 Ga0373927_0004370_4377_4886 149
217 3300035695 Ga0373927_0213047 Ga0373927_0213047_73_582 149
218 3300036401 Ga0373937_0462201 Ga0373937_0462201_89_559 149
219 3300036647 Ga0316582_0019082 Ga0316582_0019082_1441_1932 149
220 3300036647 Ga0316582_0151059 Ga0316582_0151059_692_1183 149
221 3300036647 Ga0316582_0153153 Ga0316582_0153153_752_1246 149
222 3300036712 Ga0316584_0029803 Ga0316584_0029803_2086_2577 149
223 3300037068 Ga0373925_0437239 Ga0373925_0437239_258_728 149
224 3300044673 Ga0453683_0527783 Ga0453683_0527783_38_508 149
225 3300049583 Ga0501067_0096143 Ga0501067_0096143_785_1291 149
226 3300049583 Ga0501067_0201363 Ga0501067_0201363_313_789 149
227 3300050507 nmdc:mga05p37_355409_c1 nmdc:mga05p37_355409_c1_297_803 149
228 3300050514 nmdc:mga08x19_62133_c1 nmdc:mga08x19_62133_c1_1664_2149 149
229 3300005328 Ga0070676_10171765 Ga0070676_101717652 151
230 3300005330 Ga0070690_100274169 Ga0070690_1002741692 151
231 3300005330 Ga0070690_100527877 Ga0070690_1005278772 151
232 3300005336 Ga0070680_100114533 Ga0070680_1001145332 151
233 3300005340 Ga0070689_100389689 Ga0070689_1003896892 151
234 3300005343 Ga0070687_100176544 Ga0070687_1001765442 151
235 3300005345 Ga0070692_10099594 Ga0070692_100995942 151
236 3300005345 Ga0070692_11153694 Ga0070692_111536941 151
237 3300005353 Ga0070669_101316686 Ga0070669_1013166861 151
238 3300005355 Ga0070671_100335380 Ga0070671_1003353801 151
239 3300005366 Ga0070659_100630950 Ga0070659_1006309502 151
240 3300005406 Ga0070703_10003886 Ga0070703_100038864 151
241 3300005438 Ga0070701_10090759 Ga0070701_100907592 151
242 3300005440 Ga0070705_100438453 Ga0070705_1004384531 151
243 3300005444 Ga0070694_100032640 Ga0070694_1000326402 151
244 3300005444 Ga0070694_100164946 Ga0070694_1001649462 151
245 3300005445 Ga0070708_100032954 Ga0070708_1000329543 151
246 3300005445 Ga0070708_100068927 Ga0070708_1000689272 151
247 3300005458 Ga0070681_10611819 Ga0070681_106118192 151
248 3300005467 Ga0070706_100041215 Ga0070706_1000412152 151
249 3300005467 Ga0070706_100297736 Ga0070706_1002977362 151
250 3300005467 Ga0070706_100461379 Ga0070706_1004613792 151
251 3300005467 Ga0070706_100704422 Ga0070706_1007044222 151
252 3300005467 Ga0070706_101041682 Ga0070706_1010416822 151
253 3300005468 Ga0070707_100042587 Ga0070707_1000425874 151
254 3300005468 Ga0070707_100312486 Ga0070707_1003124862 151
255 3300005468 Ga0070707_100579358 Ga0070707_1005793582 151
256 3300005468 Ga0070707_101840974 Ga0070707_1018409741 151
257 3300005471 Ga0070698_100015200 Ga0070698_1000152002 151
258 3300005471 Ga0070698_100097284 Ga0070698_1000972842 151
259 3300005471 Ga0070698_100276598 Ga0070698_1002765982 151
260 3300005518 Ga0070699_100058874 Ga0070699_1000588743 151
261 3300005518 Ga0070699_100077301 Ga0070699_1000773012 151
262 3300005518 Ga0070699_100240702 Ga0070699_1002407022 151
263 3300005518 Ga0070699_100307887 Ga0070699_1003078872 151
264 3300005518 Ga0070699_100503388 Ga0070699_1005033882 151
265 3300005530 Ga0070679_100212724 Ga0070679_1002127241 151
266 3300005530 Ga0070679_100282006 Ga0070679_1002820062 151
267 3300005536 Ga0070697_100062551 Ga0070697_1000625513 151
268 3300005536 Ga0070697_100073834 Ga0070697_1000738343 151
269 3300005536 Ga0070697_100077544 Ga0070697_1000775443 151
270 3300005536 Ga0070697_100384446 Ga0070697_1003844461 151
271 3300005536 Ga0070697_100682572 Ga0070697_1006825722 151
272 3300005536 Ga0070697_100782452 Ga0070697_1007824521 151
273 3300005545 Ga0070695_100059601 Ga0070695_1000596013 151
274 3300005546 Ga0070696_100054686 Ga0070696_1000546862 151
275 3300005546 Ga0070696_100109770 Ga0070696_1001097702 151
276 3300005546 Ga0070696_100132335 Ga0070696_1001323352 151
277 3300005547 Ga0070693_100297223 Ga0070693_1002972232 151
278 3300005549 Ga0070704_100195598 Ga0070704_1001955982 151
279 3300005549 Ga0070704_100213657 Ga0070704_1002136572 151
280 3300005549 Ga0070704_100247764 Ga0070704_1002477642 151
281 3300005549 Ga0070704_101099207 Ga0070704_1010992072 151
282 3300005564 Ga0070664_100425170 Ga0070664_1004251701 151
283 3300005577 Ga0068857_100015283 Ga0068857_1000152835 151
284 3300005577 Ga0068857_100440110 Ga0068857_1004401101 151
285 3300005578 Ga0068854_100218200 Ga0068854_1002182002 151
286 3300005617 Ga0068859_100169271 Ga0068859_1001692712 151
287 3300005719 Ga0068861_100126419 Ga0068861_1001264192 151
288 3300006844 Ga0075428_100445687 Ga0075428_1004456872 151
289 3300006847 Ga0075431_100028535 Ga0075431_1000285357 151
290 3300006852 Ga0075433_10056016 Ga0075433_100560162 151
291 3300006852 Ga0075433_10147136 Ga0075433_101471362 151
292 3300006852 Ga0075433_10197814 Ga0075433_101978141 151
293 3300006852 Ga0075433_10206004 Ga0075433_102060042 151
294 3300006852 Ga0075433_11151948 Ga0075433_111519482 151
295 3300006871 Ga0075434_100470802 Ga0075434_1004708022 151
296 3300006871 Ga0075434_100597786 Ga0075434_1005977862 151
297 3300006871 Ga0075434_100760259 Ga0075434_1007602592 151
298 3300006871 Ga0075434_100966990 Ga0075434_1009669902 151
299 3300006871 Ga0075434_100996528 Ga0075434_1009965282 151
300 3300006880 Ga0075429_100005954 Ga0075429_1000059546 151
301 3300006914 Ga0075436_100118426 Ga0075436_1001184262 151
302 3300006914 Ga0075436_100423576 Ga0075436_1004235761 151
303 3300006931 Ga0097620_100169270 Ga0097620_1001692702 151
304 3300007076 Ga0075435_100019695 Ga0075435_1000196955 151
305 3300007076 Ga0075435_100334351 Ga0075435_1003343512 151
306 3300007076 Ga0075435_100522810 Ga0075435_1005228101 151
307 3300009094 Ga0111539_10289852 Ga0111539_102898522 151
308 3300009098 Ga0105245_12005354 Ga0105245_120053542 151
309 3300009147 Ga0114129_10012796 Ga0114129_100127965 151
310 3300009147 Ga0114129_10034590 Ga0114129_100345909 151
311 3300009147 Ga0114129_10060065 Ga0114129_100600653 151
312 3300009147 Ga0114129_10130479 Ga0114129_101304792 151
313 3300009147 Ga0114129_10137414 Ga0114129_101374142 151
314 3300009147 Ga0114129_10160489 Ga0114129_101604892 151
315 3300009147 Ga0114129_10300709 Ga0114129_103007092 151
316 3300009148 Ga0105243_10126389 Ga0105243_101263892 151
317 3300009148 Ga0105243_11682750 Ga0105243_116827501 151
318 3300009176 Ga0105242_10078423 Ga0105242_100784233 151
319 3300009553 Ga0105249_10773346 Ga0105249_107733462 151
320 3300013297 Ga0157378_10566166 Ga0157378_105661662 151
321 3300013297 Ga0157378_10605716 Ga0157378_106057162 151
322 3300014326 Ga0157380_10903968 Ga0157380_109039682 151
323 3300014745 Ga0157377_10048518 Ga0157377_100485182 151
324 3300025885 Ga0207653_10000388 Ga0207653_100003889 151
325 3300025901 Ga0207688_10101503 Ga0207688_101015032 151
326 3300025904 Ga0207647_10369925 Ga0207647_103699252 151
327 3300025907 Ga0207645_10194390 Ga0207645_101943902 151
328 3300025910 Ga0207684_10000013 Ga0207684_1000001399 151
329 3300025910 Ga0207684_10015911 Ga0207684_100159116 151
330 3300025910 Ga0207684_10105754 Ga0207684_101057542 151
331 3300025910 Ga0207684_10141218 Ga0207684_101412182 151
332 3300025910 Ga0207684_11215118 Ga0207684_112151181 151
333 3300025912 Ga0207707_10288678 Ga0207707_102886782 151
334 3300025912 Ga0207707_10994376 Ga0207707_109943761 151
335 3300025917 Ga0207660_10035840 Ga0207660_100358403 151
336 3300025917 Ga0207660_10108234 Ga0207660_101082342 151
337 3300025918 Ga0207662_10006022 Ga0207662_100060227 151
338 3300025918 Ga0207662_10050039 Ga0207662_100500392 151
339 3300025918 Ga0207662_10683961 Ga0207662_106839612 151
340 3300025921 Ga0207652_10064403 Ga0207652_100644033 151
341 3300025922 Ga0207646_10000254 Ga0207646_100002542 151
342 3300025922 Ga0207646_10001660 Ga0207646_1000166010 151
343 3300025922 Ga0207646_10002550 Ga0207646_1000255010 151
344 3300025922 Ga0207646_10005942 Ga0207646_100059425 151
345 3300025922 Ga0207646_10292735 Ga0207646_102927352 151
346 3300025922 Ga0207646_10344184 Ga0207646_103441842 151
347 3300025922 Ga0207646_10582775 Ga0207646_105827752 151
348 3300025923 Ga0207681_10321487 Ga0207681_103214872 151
349 3300025932 Ga0207690_10444845 Ga0207690_104448452 151
350 3300025935 Ga0207709_10034779 Ga0207709_100347792 151
351 3300025942 Ga0207689_10101686 Ga0207689_101016864 151
352 3300025945 Ga0207679_10200616 Ga0207679_102006162 151
353 3300025960 Ga0207651_10569512 Ga0207651_105695122 151
354 3300025961 Ga0207712_11093079 Ga0207712_110930792 151
355 3300026075 Ga0207708_10123892 Ga0207708_101238922 151
356 3300026089 Ga0207648_10188508 Ga0207648_101885082 151
357 3300026116 Ga0207674_10002294 Ga0207674_100022947 151
358 3300026118 Ga0207675_100030262 Ga0207675_1000302622 151
359 3300026118 Ga0207675_100115297 Ga0207675_1001152972 151
360 3300028380 Ga0268265_10154390 Ga0268265_101543902 151
361 3300037312 Ga0395899_0159805 Ga0395899_0159805_409_891 151
362 3300037418 Ga0395900_0089252 Ga0395900_0089252_1794_2276 151
363 3300038443 Ga0395901_0188840 Ga0395901_0188840_518_1000 151
364 3300042001 Ga0439441_111105 Ga0439441_111105_39_494 151
365 3300045051 Ga0451576_0524242 Ga0451576_0524242_526_1005 151
366 3300048915 Ga0496112_1407932 Ga0496112_1407932_106_585 151
367 3300049584 Ga0501068_0069490 Ga0501068_0069490_813_1268 151
368 3300049585 Ga0501069_0130087 Ga0501069_0130087_457_936 151
369 3300050507 nmdc:mga05p37_15555_c2 nmdc:mga05p37_15555_c2_6497_6976 151
370 3300050507 nmdc:mga05p37_1968283_c1 nmdc:mga05p37_1968283_c1_84_539 151
371 3300050507 nmdc:mga05p37_335106_c1 nmdc:mga05p37_335106_c1_1152_1631 151
372 3300050507 nmdc:mga05p37_63715_c1 nmdc:mga05p37_63715_c1_2449_2928 151
373 3300050508 nmdc:mga09592_30795_c1 nmdc:mga09592_30795_c1_3039_3518 151
374 3300050510 nmdc:mga06r32_156714_c1 nmdc:mga06r32_156714_c1_1687_2166 151
375 3300050511 nmdc:mga08y16_608906_c1 nmdc:mga08y16_608906_c1_15_494 151
376 3300050512 nmdc:mga0n895_1331613_c1 nmdc:mga0n895_1331613_c1_169_648 151
377 3300050512 nmdc:mga0n895_134581_c1 nmdc:mga0n895_134581_c1_97_579 151
378 3300050512 nmdc:mga0n895_493106_c1 nmdc:mga0n895_493106_c1_512_991 151
379 3300050513 nmdc:mga0rr50_305187_c1 nmdc:mga0rr50_305187_c1_775_1257 151
380 3300050513 nmdc:mga0rr50_409747_c1 nmdc:mga0rr50_409747_c1_76_555 151
381 3300050513 nmdc:mga0rr50_72055_c1 nmdc:mga0rr50_72055_c1_1851_2330 151
382 3300050514 nmdc:mga08x19_13150_c1 nmdc:mga08x19_13150_c1_1846_2325 151
383 3300050514 nmdc:mga08x19_286426_c1 nmdc:mga08x19_286426_c1_229_708 151
384 3300050515 nmdc:mga0a205_115826_c1 nmdc:mga0a205_115826_c1_1962_2441 151
385 3300050515 nmdc:mga0a205_185785_c1 nmdc:mga0a205_185785_c1_107_589 151
386 3300050515 nmdc:mga0a205_209084_c1 nmdc:mga0a205_209084_c1_1215_1694 151
387 3300050515 nmdc:mga0a205_529231_c1 nmdc:mga0a205_529231_c1_248_727 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

29

178

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5clg-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4 0.9618 1 146
3trh-assembly2.cif.gz_G structure of a phosphoribosylaminoimidazole carboxylase catalytic subunit (pure) from coxiella burnetii 0.9608 1 150
3kuu-assembly1.cif.gz_A structure of the pure phosphoribosylaminoimidazole carboxylase catalytic subunit from yersinia pestis 0.9569 1 150
1xmp-assembly1.cif.gz_G crystal structure of pure (ba0288) from bacillus anthracis at 1.8 resolution 0.9562 1 148
6o55-assembly1.cif.gz_A crystal structure of n5-carboxyaminoimidazole ribonucleotide mutase (pure) from legionella pneumophila 0.955 1 151
ID Description Score Start End Superfamily
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9599 17 150 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9568 1 150 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9546 1 150 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9543 1 146 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9532 1 150 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A1F8KSZ1-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9711 1 151 GO:0006189
GO:0034023
AF-A0A6V8LQZ7-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9692 2 150 GO:0006189
GO:0034023
AF-A0A7V3RZZ7-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9682 2 150 GO:0004638
GO:0006189
GO:0034023
AF-A0A7C7NX38-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9679 1 150 GO:0006189
GO:0016829
GO:0034023
AF-A7GZC2-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.967 1 150 GO:0006189
GO:0034023

Feature Viewer

pLDDT pTM Quality
90.19 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map